SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERN15331 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN15331
Domain Number 1 Region: 257-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.17e-17
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 40-177
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000424
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ERN15331
Sequence length 576
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00036:1475712:1492018:1 gene:AMTR_s00036p00114630 transcript:ERN15331 description:"hypothetical protein"
Sequence
MASHSSPSQDGGGSCISNGETTVFSDYLQQTTPDLVALTKLSECLDSLFHSSDLGFCADA
RIIAGKREIPVHRCVLACRSPFLQKAFAENSGKERFEIGELAKDFEVGPDALMVVLGYIY
SGKVGVLPQGVCVCADEECSHHGCRPAVDFAVEVLYASFIFQINELVSLFQRHLLEILDK
VAIDDILVILSVATICDKASERLLLKCKEIVVNSDLDITSFEKALPIAVVKEITDLRSAL
GLVGPGGGDGFPDKHVKRIHRALDSDDVELVRMLLKEEHSNLDDAYALHYAVAYCDSKTT
IDLLDLGLADVNHRNQRGYTVLHIAAMRREPKIIVSLLTKGARPSDLTSDGRKALHISKR
LTKFIDFSRSTEEAEPTPKERLCIEILEQAERRDPLPGEASVSLAIAGDDLRRSLIYLET
RVGLAKFLYPMEAQVAMEIAQVEGTLELPLAAISKFTSREQMMTAVDLNDSPFKIKDEYL
SRMKALSRTVELGKRFFPRCSAELNKIMNDADVWELAFLGKGTSEEQTKKRKRYVEVQEM
LRMAFNKDKEENKSAMSSCSSSLSIDGGMVFNIAKL
Download sequence
Identical sequences U5CQ74
ERN15331 XP_006853864.1.86515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]