SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERN15822 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN15822
Domain Number 1 Region: 102-543
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000214
Family Cystathionine synthase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ERN15822
Sequence length 565
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00039:2430027:2431724:1 gene:AMTR_s00039p00158550 transcript:ERN15822 description:"hypothetical protein"
Sequence
MSKKHADIVSQRGGCTCITITISSTTKPSKKPSNRASTLSHYQSFISLLSKTAFPKSHIT
NPEAIPSLRTAFSHFTEAFQNYQEESETTDGIRDRFYPHLKTTNRVFFDYFGVGLFSGVE
KNPNFDFRPISKYGNLVLHSLYGDPDTLTFESQMKKRIMEFLNVEQKDYAMVFAVNRESA
FKLLAESYPFSHKTRLLSVCDYNSHGLSLMKEIAVKKGAIAKSASFKWPSLSLRGDQLER
EICYGKSYGGSERNKRERACGRGMFVVQLQSRVTGARHSYQWVGVAQEEGWHVVLDSSGL
GPKEMKSIALSLYKPDFIISSFYKVFGHDPTGLCTLLIKRPTLSLLDSQVSTTGIACLVP
IDENPSPSISLSTSSSSCLSNFSSSSSFSYGVFSEKKSAGNDSGHTVKLQCDGLDQTDTV
GLSRERNKLRCLVNWLVHALLKLHHPPLNNEDIGLPLIKIYGPKVKFNRGYSVAFNVFDW
EGAMVDPFLFQKLADRHDISVGCWDLQRVELGFQKIRVVSVSLSFLSSFEDVYRLWSFVG
RFLDADFVEKEKWRYVTLKQEIVLV
Download sequence
Identical sequences U5D327
ERN15822 XP_006854355.1.86515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]