SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERN17697 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN17697
Domain Number 1 Region: 152-410
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000153
Family Cystathionine synthase-like 0.012
Further Details:      
 
Weak hits

Sequence:  ERN17697
Domain Number - Region: 762-852,890-917
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00187
Family Cystathionine synthase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ERN17697
Sequence length 936
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00059:4025843:4028653:-1 gene:AMTR_s00059p00209410 transcript:ERN17697 description:"hypothetical protein"
Sequence
MHLSLWKPISHCAALIMEKKSKKKDGSGLTEEEKKKKPSILRQLQESRLREALEEASEDG
SLVKSQDMDSDPSATQDGSFGRSRSLARLHAQRDFLKATAMAAEKIFDSEDSIPDLNESF
NKFLTMYPKFQTSEKIDEIRSDEYGHLSEVGSKVCLDYCGFGLFSFFQQLQYYESAAFSL
SEITANLSNHALYGGAEKGTAEHDIKARIMDYLNIPENEYGLVFTVSRGSAFKLLADSYP
FQTNKKLLTMFDYESQSVNWMAQSAKEKGAKIYSAWFKWPTLKLCYTELRKQIMSTKRRR
KKDSSVGLFVFPVQSRVTGAKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPD
FIITSFYRVFGSDPTGFGCLLIKKSVMGSLQNPSAGSGMVRIVPVFPQYLSDSVDGFDGL
TGIEDETVDEANEFLPETRKGSQLPAFSGAFTSSQVRDVFDNEMEHDNSSDRDGASTIFE
EAESISIGEVMKSPIFSEDESDNSFWIDLGQSPFGSDNSGQLNRGRSGSPLPPSWFSSKK
NQKRLSPKGMKNSKNSRSPIYDDHVLSFDAAVMSVSQELDRVKEVSEEEQSMEHDGSGRK
GGASMDNAPQVSHATKSQDYIEEIQEERDINGSKLENSTPRFHGNGTSKGEIFQESLGET
KESAIRRETEGEFRLLGRREGSRFSGGRFFGVDDNERTASMGRRVSFTMEENTRERFSHN
SEGGEASATTLGDEDGISEGEAGDTQDWSRREPEIICRHLHHVDMMGLNKTTLRLRYLIN
WLVTSLLQLRLTGPEGETPLVSIYGPKIKYERGAAVAFNLNKGNGGLINPEIVQKLADKD
GISLGIGYLSHIKIMENQKQLHGTVDLDNTSLCRPISNGRHDSKNVIIRVEVVTASLGFL
TNFEDVYRMWAFVAKFLDPTFAEGEELTAIPEAEES
Download sequence
Identical sequences U5D8F0
XP_006856230.1.86515 XP_020530252.1.86515 ERN17697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]