SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pismi1|107531|e_gw1.99.122.1 from Pisolithus microcarpus 441 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pismi1|107531|e_gw1.99.122.1
Domain Number 1 Region: 2-69
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000956
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pismi1|107531|e_gw1.99.122.1
Sequence length 79
Sequence
QRQFPVHLAYAMTINKSQGQSVKNVGIDLRSEVFSHGQLYVAPSHCTHPRRIKVLLKEGQ
DNMKTRNVVWAEVFRHLNI
Download sequence
Identical sequences A0A0C9Y437
jgi|Pismi1|107531|e_gw1.99.122.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]