SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pismi1|113920|e_gw1.182.5.1 from Pisolithus microcarpus 441 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pismi1|113920|e_gw1.182.5.1
Domain Number - Region: 4-56
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00271
Family Tandem AAA-ATPase domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pismi1|113920|e_gw1.182.5.1
Sequence length 95
Sequence
ISCHQLPIIPVWAFTDYKVQGTSLQKVVVDLASAGGVQNAYVMLSRASSLSNLAILRSFA
PHRPFGRLQEDLHNEFERLSDLDQKMSHWLHHEHL
Download sequence
Identical sequences A0A0C9Z1G7
jgi|Pismi1|113920|e_gw1.182.5.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]