SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pismi1|470463|CE346011_1981 from Pisolithus microcarpus 441 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pismi1|470463|CE346011_1981
Domain Number 1 Region: 19-132
Classification Level Classification E-value
Superfamily DOPA-like 8.5e-37
Family DOPA dioxygenase-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pismi1|470463|CE346011_1981
Sequence length 138
Sequence
MSQAGKPRSSAYETFPAPILPSRNGFDFHVYFMPTNPVHVQHALQLHQRISSEFPELPIY
RVWDRPIGPHPTAMFEVQTTTPHQTGALFGWLVVNRGPLDVFVHPNTDDAYRDHAELASW
IGKPWPLNLEILKGHRTK
Download sequence
Identical sequences A0A0C9ZAQ2
jgi|Pismi1|470463|CE346011_1981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]