SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pismi1|26779|fgenesh1_pm.3_#_200 from Pisolithus microcarpus 441 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pismi1|26779|fgenesh1_pm.3_#_200
Domain Number 1 Region: 160-449
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-58
Family Kelch motif 0.0012
Further Details:      
 
Domain Number 2 Region: 825-1016
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000647
Family Tropomyosin 0.0036
Further Details:      
 
Domain Number 3 Region: 1044-1298
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000196
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pismi1|26779|fgenesh1_pm.3_#_200
Sequence length 1490
Sequence
MSFFSRKKHPSSSHLVSNVTVAQTPSQALAQLAPQDSSQQGSSSRENDATTNGPASLAPQ
QRQQQNRNGSPNVIPQPSQPHPQQQQGTPPSQQAQPTQPLPPQQPQPQQRPAYPWSVRRL
QLPLPVVLPKPGVAPPSAPSPSPFPRYGHALPATATAAGELYLFGGLVREAARNDLYLFS
TRDLSATLIQTTGEVPSPRVGHASAIVSSVLIVWGGDTNTEPTANPAEKQDDGLYLLNLV
SKEWTRVTMYGSSPAGRYGHAVTMVGSKFFVFGGQVDGEFLNDLWSFDLNTLRSQTQWEL
CQPAGSEKPAPRTGHICVTYGDRIIVFGGTDGQYHYNDTWAYDVNSRRWTELQCIGFIPS
PRESHAAAVVDDVIYIFGGRGVDGKDLGDLAAFKMSNQRWYMFQNMGPAPTARSGHAMAS
MGSRVFVLGGESFAPTRGDDHEIVHVLDTKHIKYPDANKPPANPSSNAGNPRKTAISHQP
PTQSGGPVHSQSHAQQYTASGTRAMSPTGPGAVDVDELRPAISPPGIRAGARTPNGSVTQ
GTPGGNGMAVNGKDKAPTKSRRDDEDVAGTDDGHGLDTGATSDLGASAARASSPMEPQRA
RSPTSLSNAGRAVSPVSGGGSQQQRQAHQAAPSMTSVAMNLHTGLSARSPSPIVDRSKSP
QDALVQPSPSGSSLANGYAHPHHTHGGSKLGSTGNVAADLIRDYKAKEIEVEVLRKREAW
MKTALLKARRNGFIQFDEQSIEAENLSLGEETSDERQKLTDMILNFKHFKTQMQMLLATQ
AREASDRVADAERMKAGAIQEAAYYRAKLIAWEANAPVDVARAERERIAELERHLATLSS
EHSTLRRKVVEVTDSLALQTTLLEQAEARAVDANKRADTLEESHERHIRSHAELQDRQML
LEAALREHADRLASQTSLLEQKEAECAQAKKHVQELTQSQDQHIRALEQARVAVQAATSR
SEEVDSSHQLSRERITQLEADLVEVKGDLETRTLEVESLRARLAEVENSWAKSREEADAF
RALTTGGLGELLDSHRDLKTDEDRHARSYAEKTEAVEMEAASLRKLLQETSQRVEDVQAE
LSEERRRVRETESEQLFLRSQIVGLRAQLSSSFSDNGRLRKEYADKEAELCEALKEAADT
NVRLAMLRNYLAENGISPDQDASGSISDSSARIAELERQLEERIRLHENSERELAQAVRR
TRDVETQLSAIKSQLDRTRSSPQGPVIENDSAVARAVEVERKLEETERNYKARMQQMEDD
YQLAVRYVKGTEKMMRKIKDELTKQKAANATLQAELDSARGRSSTEPGSRARVNGRTTPS
DDSHDLRAQLVEAQQHSQRLSTENGELRQRIEVLEKDLVAMRESLIISQRESDDRYSHVE
ELEHEIERLNATLAIYRKGSDENAVEQLTMENTNLKRENEQLSHKIHLLLEVDQPPFNRP
SSMSSSENFEHLSNELDDWQRHLASSMSTRRPLSGIESPPHGHSRINSRS
Download sequence
Identical sequences A0A0D0ADZ5
jgi|Pismi1|26779|fgenesh1_pm.3_#_200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]