SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pismi1|550091|CE425639_75498 from Pisolithus microcarpus 441 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pismi1|550091|CE425639_75498
Domain Number 1 Region: 39-364
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.48e-57
Family TK-like PP module 0.09
Further Details:      
 
Domain Number 2 Region: 405-614
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.47e-19
Family TK-like Pyr module 0.084
Further Details:      
 
Domain Number 3 Region: 622-759
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000192
Family Transketolase C-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pismi1|550091|CE425639_75498
Sequence length 817
Sequence
MPGQRLFQSDPPADPSHLPDAVLGNSVKLDVSSFAISNAELEALQKFRSAANYIAAAMIF
LKDDVLLERQLTFDDIKPRLLGHWGTCPGLTLVYAHLNRIIRRTDLDSLLVIGPGHGAPA
ILSCLWLEDSISPFYPSYTRDRAGLTNLIKKFSAPGGFPSHINAETPGCIHEGGELGYAL
AVAFGAALDNPHLVVTCVVGDGEAETGPTATAWHGYKFIDPVVSGAVLPIVHVNGFKISN
RTIYGCMDDKELVALFCGYGYQPRIVKDMANIDKDLAASMEWALGEIARIQKAARSGKPI
VKPRWPVIILRTPKGFSGPKELHGEYIEGSYRSHQVPLPNAKTDETELKMLQSWLASYDP
QQLFCIGGDKNTPDCAPCPEVLQIVPDNRDKRLGMRKEAYAAYQPLKVPAWATFGVQKRS
QASCMKTVGEFLKQVITDNPTRFRIFSPDELESNKLGAVLEVTGRDMQWDVACRAQDGRI
IEILSEHTCQGMLQGYTLTGRTGLFPSYEAFLGIVHTMMVQYSKFAKMAFETKWRQDVGS
INYIETSTWARQEHNGFSHQNPGFIGAVLNLKPKIARVYLPPDANCWLSTMAHCLRSRNY
INLIVGSKQPTSVWLDPEEADRHCIAGASVWKFASVDEGVDPDVVLVGIGTEVTFEVIAA
AALLRRQVPDLRVRVVNVTDLMILGPYGSHPHALSDDDFDTLFTVDRSIIINFHGYPLDI
KGMVFGRPVVERMVIEGYREEGTTTTPFDMMLCNGTSRYHLAAAAVRAGALFNSKVSCVA
HEAASFFMHRAAKDKEYIYVHGHDPDGMFDTPVFEKN
Download sequence
Identical sequences A0A0C9YUK0
jgi|Pismi1|550091|CE425639_75498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]