SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344997947|ref|YP_004800801.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344997947|ref|YP_004800801.1|
Domain Number 1 Region: 26-301
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.45e-60
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000334
Further Details:      
 
Domain Number 2 Region: 256-408
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.31e-16
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344997947|ref|YP_004800801.1|
Sequence length 547
Comment Cytochrome b/b6 domain-containing protein [Streptomyces sp. SirexAA-E]
Sequence
MLLAKERARARRSRRRHTAKGAVGALDARLPLAEAGRALLRKAFPDHWSFLLGELALYSF
LVLLLTGVHLTMFFEPSMNEVVYDGSHGPLRGLRMSEAYASTLRISFDVRGGLLVRQIHH
WSALVFVASIGAHLLRVFLTGAFRRPRELNWAVGVTMFLLALLEGFAGYSLPDDLLSGTG
LRTAQGIMLSVPVVGSYLSFFVFGGEFPADDIVSRLYPVHILLVPGLLLGLISLHLLLVV
HLKHTQWAAPGRTGRNVVGKPFHPQYTAKSGGLFFLVFGVLTLLAAVAQINPVWDYGPYR
PDQVSTGSQPDWYVGFLEGALRLMPGVETRLWGHTLIWNPLVPGVILPGALFLVLYAYPF
FERWITRGSGEHHLCDRPRDRPVRTGLGVAALTAYAVLLLAGGQDVLGYVFDVPVHALTW
TFRVALFVLPVAAFLVTGRLCLAAQARDRDLLEEGEETGEVRQSVEGGYHPGHRRLPAGK
RYVLTARDLPRPLEPRTTGRDPAPARLADRLRVSLSRWYYRDAVRPPATEKQRRETAEIL
AGPDRPG
Download sequence
Identical sequences G2NB60
WP_014044253.1.27930 WP_014044253.1.39937 WP_014044253.1.47793 WP_014044253.1.79727 gi|344997947|ref|YP_004800801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]