SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344998233|ref|YP_004801087.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344998233|ref|YP_004801087.1|
Domain Number 1 Region: 180-385
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.2e-47
Family ATP-dependent DNA ligase catalytic domain 0.00062
Further Details:      
 
Domain Number 2 Region: 387-506
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.88e-30
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0025
Further Details:      
 
Domain Number 3 Region: 4-202
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 1.57e-28
Family ATP-dependent DNA ligase DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344998233|ref|YP_004801087.1|
Sequence length 511
Comment DNA ligase I, ATP-dependent Dnl1 [Streptomyces sp. SirexAA-E]
Sequence
MLLARLAHVSLEVAATSARNRKVALLAGLFRETGPDDVPTVIPYLAGRLPQGRLGIGWSA
LSDPPRPADTPVLTVAEAHAELTAVGALSGPGSQAARKERLRRLFAAATADEQHFLRGLL
TGELRQGALEALAADALAAATGAPPADVRRAVMLAGSLQSVARALLADGPEALAAFRLTV
GRPVLPMLAHTAGSVTEAVDKLGPCAVEEKLDGIRVQVHRDGAGVRIYTRTLDDITDRLP
EPATAVARFPGERFVLDGEVIALGPDGRPRPFQETAARVGSRRDVATAAAAVPVVAVFFD
VLALDGRELIDLPFTERHTALDTLVPEPMRVRRVTVTDPRDPAARRAAEEFFEAALGRGH
EGVVAKGASAPYSAGRRGASWLKVKPVHTLDLVVLAAEWGHGRRTGKLSNLHLGARRPDG
TFAMLGKTFKGLTDTMLAWQTERLLELSTGDDGHVVTVRPELVVEIAYDGLQDSTRYPAG
VTLRFARVLGYREDKPPEEADTVDTVLSRRA
Download sequence
Identical sequences G2NNB6
WP_014044539.1.27930 WP_014044539.1.39937 WP_014044539.1.47793 WP_014044539.1.79727 gi|344998233|ref|YP_004801087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]