SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344998475|ref|YP_004801329.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344998475|ref|YP_004801329.1|
Domain Number 1 Region: 74-390,505-536
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.01e-78
Family Type II chitinase 0.000027
Further Details:      
 
Domain Number 2 Region: 390-503
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000366
Family Chitinase insertion domain 0.0059
Further Details:      
 
Domain Number 3 Region: 734-785
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.00000000000196
Family Carbohydrate binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344998475|ref|YP_004801329.1|
Sequence length 785
Comment chitinase [Streptomyces sp. SirexAA-E]
Sequence
MLSPTRARPTLPAAVAAVAGLLLGALAVIPSTAAATPSAATADQESCRPDGLYRTPGVDV
PYCSVYDTEGREKMGADHQRRVIGYFTSWRTGKDGKDAYLASDIPWDKVTHLNYAFAHVD
GDNKISVGSDGPRNASTGMTWPGVAGAEMDPALPYKGHFNLLSKFKKQHPDVKTLVSVGG
WAETGGYFDDNGDRVDSGGFYSMATNADGSVNQKGIDTFADSTVAFIKKYGFNGVDIDYE
YPTTMKDAGNPLDHTLANARRAGLVKGYGALMKTLREKLDRASAADGTHYLLTVAAPSSG
YLLRGMETFQVQKYLDYVNIMSYDLHGAWNEYVGPNASLFDDGKDAELAQAGVYSTSQYG
GVGYLNTDWAYHYFRGSMPAGRINIGLPYYTRGFKNVQGGTDGLWGKAATTDCPAGAGLT
KCGDGAVGIDNLWHDLDANGKESPAGSNPMWHAKNLEKGIVGDYVTQYGFPADTTLTGTY
TRKYDSTLVAPWLWNAQKKVFLSTEDEQSVAAKADYVVDKGIGGTMIWELAGDYGWDAAK
GQYEQGSTLTSAMYEKFKAASPYGATRSTIDLPAQALDIDVSFEQFALGDSNYPIGPKLR
ITNNTTATLPGGTEFRFDYATSAPANAKDQSGFGTTVVRSDHTAAGNVGGLKGDYNRVSL
KLPAWQTLAPGASVRLDFVYYLPTSTPSNWTVAFDGSTYALAGDLARGTTVVQPGAGPGT
GPGTSPSPDPGGGTCSPAAWSATAEYGTGATVSHGSHTWKAKWWTKGETPGSTGEWGVWQ
DLGAC
Download sequence
Identical sequences G2N9A4
gi|344998475|ref|YP_004801329.1| WP_014044780.1.27930 WP_014044780.1.39937 WP_014044780.1.47793 WP_014044780.1.79727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]