SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344998581|ref|YP_004801435.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|344998581|ref|YP_004801435.1|
Domain Number - Region: 9-86
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0589
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344998581|ref|YP_004801435.1|
Sequence length 119
Comment putative integral membrane protein [Streptomyces sp. SirexAA-E]
Sequence
MLVALTVAVAVTALALAAWCGFAAYRDQPTKDWHFIGMAVVSVLALAQLVVGVVRLAGGE
RPDQGMTIFIAYLIGAFAAVPAAGFLSLTERTRWGSVTVAAGAVVLAVLEVRLYDIWGS
Download sequence
Identical sequences G2NSB9
WP_014044884.1.27930 WP_014044884.1.39937 WP_014044884.1.47793 WP_014044884.1.79727 gi|344998581|ref|YP_004801435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]