SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344999144|ref|YP_004801998.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344999144|ref|YP_004801998.1|
Domain Number 1 Region: 15-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-70
Family Protein kinases, catalytic subunit 0.0000032
Further Details:      
 
Domain Number 2 Region: 578-636
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000536
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|344999144|ref|YP_004801998.1|
Domain Number - Region: 511-571
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344999144|ref|YP_004801998.1|
Sequence length 639
Comment serine/threonine protein kinase with PASTA sensor(s) [Streptomyces sp. SirexAA-E]
Sequence
MDTTLQDPLVGQLLDGRYRIDARIAVGGMATVYRATDMRLDRVLALKVMHPTLATDAAFV
ERFIREAKSVARLAHPNVVGVFDQGAEGAYVYLAMEYVAGCTLRDVLRERGALQPRAALD
ILEPVLAALGAAHRAGFVHRDMKPENVLIGDDGRVKVADFGLVRAVGTVTDTTGSLLGTV
SYLAPEQIEHGSADTRSDVYACGVVLYEMLTGSKPHAGDTAAQVIYQHLNEDVPAPSSAV
PGLAAGLDELVAEATARDAEVRPTDAVALLARAREVRAALTEEQLDATPPQALADAHDAA
EDRTSVIPRVIPAGQGTAHHTSRLEMPPDGPPAEPRGGRRFTAGRRRGPVAVLLGLLLVL
GAGTGVWYINSGQFTQVPSLLGQTQAVAEDRLEDAGLGLKGVERAYSDTVERGKVLSSDP
ASGERIRGNGSVKLVVSRGPEIVKVPDVEGLASADARRELKKAGFEQGMVTREFSEEIAR
GEVVRTDPAIGTERHAGSAVALVVSKGSPVDVPDVTGLDVEDATAELKEAGLKAEVLPDR
VESAQAAGDIARQAPGGGAEAAEGDTVELTVSKGPRMVAVPDVTGKDVDEARETLEEAGF
EVKVDRPFLSFSDTVASQSVKGGDKAAEGSRITVKTKGF
Download sequence
Identical sequences G2NDP9
WP_014045445.1.27930 WP_014045445.1.39937 WP_014045445.1.47793 WP_014045445.1.79727 gi|344999144|ref|YP_004801998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]