SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344999176|ref|YP_004802030.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344999176|ref|YP_004802030.1|
Domain Number 1 Region: 19-296
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.02e-63
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344999176|ref|YP_004802030.1|
Sequence length 541
Comment Cytochrome b/b6 domain-containing protein [Streptomyces sp. SirexAA-E]
Sequence
MSTVTDTQRKAPAGERVADWADGRLGIYGLAKANMRKIFPDHWSFMLGEICLYSFIIIIL
TGVYLTLFFHPSMNEVVYHGPYEPMQGIRMSEAYASTLDISFDVRGGLLMRQIHHWAAVI
FLAGMFVHMFRVFFTGAYRKPREINWLFGFLLFVLGMFTGFTGYSLPDDLLSGTGVRFTQ
GAILSMPIVGTYISMFLFGGEFPGTDIIARFYSIHILLLPGIMLGLVVGHLILVFFHKHT
QFAGPGKTNKNVVGMPLLPVYMAKAGGFFFLVFGFIAMIAAIATINPIWALGPYRPDQVS
TGAQPDWYMGFAEGFVRVMPGWEINLWGHTLVLGVLIPLVLFGLVLGALALYPFIESWVT
GDKREHHILDKPRNAPTRTALGVAWVTIYFVMLIGGGNDIWATHFHLSLNAISWFVRIAF
FAGPVLAFIVTRRICLGLQRRDKEKVLHGRESGTIKRLPHGEFVEIHEPLGPEQLHTLTA
HEQYKPIEIGPTVDENGVERKPSALQKLRARLSRSYYGEGNQIPKPTAEEYKEITSGHGH
H
Download sequence
Identical sequences G2NDT1
WP_014045477.1.27930 WP_014045477.1.39937 WP_014045477.1.47793 WP_014045477.1.77718 WP_014045477.1.79727 gi|344999176|ref|YP_004802030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]