SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345000836|ref|YP_004803690.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345000836|ref|YP_004803690.1|
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-77
Family Protein kinases, catalytic subunit 0.0000000324
Further Details:      
 
Domain Number 2 Region: 580-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|345000836|ref|YP_004803690.1|
Domain Number - Region: 446-506
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00012
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0085
Further Details:      
 
Domain Number - Region: 380-440
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000929
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345000836|ref|YP_004803690.1|
Sequence length 655
Comment serine/threonine protein kinase with PASTA sensor(s) [Streptomyces sp. SirexAA-E]
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRRLLPERTLEMTV
GILQALEYSHRAGIVHRDIKPANVMLTRTGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLAVRPPFVGDSPVAVAYQHVREEPQPPSTFD
PEITPAMDAIVLKALTKDPDYRYQSADEMRADIEACLDGQPVAAAAAMGAAGYGGYDGYG
NDQPTQALRPTDPGGAPTSMLPPINPDDGGYDDRGGRRRQQKKSNTSTILLVVAGVLVLI
GAILIGRTVFTSDSGSDEIPAPKVVGYTVDEAQNFADNSGVTLKVGAKEECENQAEGKIC
SQDPAADATMKKGDTVTVVVSTGAPKVEVPDVLEKSQESAQKILEDKGFTVKVESVESDS
TPDTVTKQSPEPGDKAERESEVTITVAKEKLLDLPVLNRTYDEAVSQLNGIGFSNISKQE
VDADQPAGTVVGQTPEGPSKQAKDVQIVLKVSKGPPQPEQVAVPDLSNKTLAEAKAALAQ
AGLQISVQGVDEDNARVLGFQPQAGQMVDKNSTVNVQTMPGGNGNFFGGQSGSRD
Download sequence
Identical sequences G2NEW4
WP_014047132.1.27930 WP_014047132.1.39937 WP_014047132.1.47793 WP_014047132.1.79727 gi|345000836|ref|YP_004803690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]