SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345000844|ref|YP_004803698.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345000844|ref|YP_004803698.1|
Domain Number 1 Region: 84-269
Classification Level Classification E-value
Superfamily Rhomboid-like 5.1e-43
Family Rhomboid-like 0.0008
Further Details:      
 
Domain Number 2 Region: 15-46
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000229
Family B-box zinc-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345000844|ref|YP_004803698.1|
Sequence length 299
Comment Rhomboid family protein [Streptomyces sp. SirexAA-E]
Sequence
MEQQPDDQDGSAAAGGPLTCYRHPDRETGIRCVRCERPICTECMIDASVGFQCPECVREG
SGTGHHPAASRPRTLAGGSVAADPRLITKILLVLNLAVFIAVSVDDSLLDELLLFGRAYL
GDPSAGIEGVAEGQWYRLFTSMFLHQEVWHIAFNMLGLWWLGGPLEAALGRVRYLALYLL
SGLAGSALTYAVSDPAQGSLGASGAVFGLLGATAVLMRRMNYDMRPVIALLVVNLIFTFN
PWGSIAWQAHLGGLVAGVVMAIAMVHAPRAHRGLVQFGTCALVLMTVVVTVLVRTAVLV
Download sequence
Identical sequences G2NEX2
WP_014047140.1.27930 WP_014047140.1.39937 WP_014047140.1.47793 WP_014047140.1.79727 gi|345000844|ref|YP_004803698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]