SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345000985|ref|YP_004803839.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345000985|ref|YP_004803839.1|
Domain Number 1 Region: 48-100,241-480
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.6e-63
Family Bacterial dinuclear zinc exopeptidases 0.0000125
Further Details:      
 
Domain Number 2 Region: 133-219
Classification Level Classification E-value
Superfamily PA domain 0.00000000000000157
Family PA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345000985|ref|YP_004803839.1|
Sequence length 515
Comment Aminopeptidase Y [Streptomyces sp. SirexAA-E]
Sequence
MHATRRRSLAVVAATTLAAPLLLGASPHHGHTPRDPAKDAAELSRQLVEKASAKDAYRHL
RAFQAIADASGGHRAAGSPGHEASAAYVHELLRKAGYKVGYQSFDFVYTETLAEKLSVVS
PTPRDVPVKAMTYTKSTEEGGVRAALAAVPDDGTPGCEASDYASGNFTGKIALIKRGACS
FAEKQAAAAEAGAVAAVIYNNTEGVLSGTLGDAAAGRIPTGGLVQEEGEKLVADLAKGEV
TVSLEIRELQEERTTRNVVAETRGGDAAKTVMLGAHLDSVTDGPGINDNASGSAGLLEVA
LELARTHKTPADRIRFAWWSAEENGLLGSEAYVAKLSETQRDRIALYLNFDMIASPNGAQ
FVFDGDDSDGVGEGPGPEGSAQLERDITAFLDARGKPHTGTDFTGRSDYGPFIEVGIPSG
GTDTGAEGIKTADEAEIFGGTAGVAYDPCYHAACDDLKNIDMAHFETNIDVIAHAVGTYA
YDLRSLTRPVPAAATAAERSGGPEVREGHAHGVTR
Download sequence
Identical sequences G2NLJ0
gi|345000985|ref|YP_004803839.1| WP_014047278.1.27930 WP_014047278.1.39937 WP_014047278.1.47793 WP_014047278.1.79727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]