SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345002085|ref|YP_004804939.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345002085|ref|YP_004804939.1|
Domain Number 1 Region: 285-550,610-652
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.65e-80
Family Type II chitinase 0.00000342
Further Details:      
 
Domain Number 2 Region: 76-179
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.65e-30
Family Cellulose-binding domain family II 0.00033
Further Details:      
 
Domain Number 3 Region: 188-271
Classification Level Classification E-value
Superfamily Fibronectin type III 2.89e-16
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 4 Region: 552-611
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000121
Family Chitinase insertion domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345002085|ref|YP_004804939.1|
Sequence length 655
Comment glycoside hydrolase family protein [Streptomyces sp. SirexAA-E]
Sequence
MTSALRATQGLQSTNHPRLSDLTRGAPLSTESPRRSSRLRWRLGPGRATRAKAVAGFTAL
LLPLAAMVGLASPAQAATSATATYLKKSDWGSGFEGQWTVKNTGTTALSSWTIEWDFPSG
TAVGSAWDASVTSSGTHWTAKNLGWNGTVAPGASISFGFNGTGSGSPTGCKLNGASCDGG
GTVPGDSAPSKPGTPTASGITDTSVKLSWSAATDDKGIKNYDVLRDGAKVATVTTTTYTD
TGLTKGTDYSYSVQARDTADQTGPVSGAVAVRTTGGNDNPGPGTGSKVNLGYFTNWGVYG
RNYHVKNLVTSGSAEKITHINYAFGNVQGGKCTIGDSYADYDKAYTADQSVDGVADTWDQ
PLRGNFNQLRKLKAKYPHIKVIWSFGGWTWSGGFGAAAQNPAAFAQSCYDLVEDPRWADV
FDGIDIDWEYPNACGLTCDTSGPAALKNLSSALRAKFGAKNLVTAAITADGSDGGKIDAA
DYAGAAQSFDWYNVMTYDFFGAWEAKGPTAPHSPLNAYAGIPQDGFNSAAAIAKLKAKGV
PASKLLLGIGFYGRGWTGVTQAAPGGTATGAAPGTYEAGIEDYKVLKTSCPATGTIAGTA
YAHCGTNWWSYDTPATITSKMAWANSQGLGGAFFWEFSGDTANGELVSAMDSGLN
Download sequence
Identical sequences G2NPG5
gi|345002085|ref|YP_004804939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]