SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345002904|ref|YP_004805758.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345002904|ref|YP_004805758.1|
Domain Number 1 Region: 204-490
Classification Level Classification E-value
Superfamily Subtilisin-like 4.19e-82
Family Subtilases 0.00000224
Further Details:      
 
Domain Number 2 Region: 782-866
Classification Level Classification E-value
Superfamily PA domain 0.000000301
Family PA domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345002904|ref|YP_004805758.1|
Sequence length 1231
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Streptomyces sp. SirexAA-E]
Sequence
MATAVALVSGVMLPAAGSATAAGPAAPRPHTLDDRHRPPTESHDITLVTGDVVHYVDGPG
AQDTVTVDRPDGASGGVRVRQAGDELYVLPDEATTLLAAGKLDRRLFNVTALVKMGYDDA
ATDGIPLIATYPASKARTLPAAPRGATRVRTLESVNGAALHAGKDTARTFWSDIARTEKA
RSLDNGIARLWLDGRSEALLKDSVPQVRAPEAWAAGFDGKGVKVAVLDTGIDADHPDVKD
RVLASRSFVPGEEVDDKNGHGTHVASTIAGSGAASQGANKGVAPGAGLLVGKVLGDEGSG
ADSGIIEAMEWAKAEGADVVSMSLGSPVPDDGSDPMSLAVDALSVDGGPLFVIAAGNAYG
AGTIGSPGSAEAALTVAAVDKSDDRADFSSMGPLVGTYGLKPDLSAPGVDIDAAASQSVP
GVQGMYQSMSGTSMATPHVAGAAAILKQRHPDWSGERVKDALMSTSARLPGRTPYEQGTG
RLDVKAAIDTTIEATGSVEVASYAWPHSADDPVAERTLTYRNTGDEDVTLHLATDTDADA
YTLSTPTLTVPAGSTAEAVLSLDPAKVANDTRFSGQVVATDASGAVLAHTGFALQKEQEL
YDLTLRIRDRAGRPADGQVVLGALGDPQLGVVQVSGETTLRLPPGNYTAWTAVDVDGDAA
DSKGLAFLAAPETILDKATTVTLDASKARKISVRTPEETETRQLRYDMARTSPEGAVQRD
AYQIPLIYDQLWASPTKKVTQGGFSFLTRWRQGEELIGLTADGDDIPVTVQGGSVVAEDS
ERKLTGVFVGDGAAADYRGRSVKGKAVVVTRSDAVAPAERIANARAAGAQALFVVNDARG
VLMESYAPYGEETAIPVASVRAGAGRDLIRAAQRGRKLAVDQKKFASYVYDLVDRHDGTI
PDRSLAYAPKARQLAKVQNTFYGHRATLGGGFRYDIPEYGPGIGFEEYEKYPGTRTEWAT
PLPGASFWYENHSVLDAETEATGHEMRSAELDYEAGRTYRDAWFAPVVGPRLGTGYWGPF
RTSYNDVQFNITPWTDGSEGHSGAMPEDEYDTTSYAFYQGDTLIKKGPGRAGYAWDLSPE
RLPYRLVVDSERDGALWKTSTRTHTAWDFVSGALPDGTVQADIPMLQPRYDVDTDLAGDV
RAGGSVEIGLEAGTQAWLEGAVKATRASLSVSYDDGATWTEVKLRKKSSGTWSVKLRTPA
KGAAAVSLRAHAEGPGGLAVDQEIIRAFGLK
Download sequence
Identical sequences G2NR76
gi|345002904|ref|YP_004805758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]