SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345003552|ref|YP_004806406.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345003552|ref|YP_004806406.1|
Domain Number 1 Region: 33-393
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.6e-110
Family FMN-linked oxidoreductases 0.00000000179
Further Details:      
 
Domain Number 2 Region: 364-549
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.47e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000155
Further Details:      
 
Domain Number 3 Region: 499-656
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.39e-18
Family C-terminal domain of adrenodoxin reductase-like 0.0000227
Further Details:      
 
Weak hits

Sequence:  gi|345003552|ref|YP_004806406.1|
Domain Number - Region: 637-694
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0291
Family C-terminal domain of adrenodoxin reductase-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345003552|ref|YP_004806406.1|
Sequence length 701
Comment NADH:flavin oxidoreductase/NADH oxidase [Streptomyces sp. SirexAA-E]
Sequence
MRRRSLCNLLHKRGRLFYNWHDDTVREEIRMSPYPTLLSPLDLGFTTLPNRVLMGSMHTG
LEEVEGGFERMAAFYAARARGGVGLMVTGGIAPDERGCAFPGGAKMTTEAEAAQHAEVTA
AVHAAGGRIAMQILHFGRYAHHPDLVAPSALKAPISAFTPHALTDDEVEETVESFVRAAE
LARCAGYDGVEIMGSEGYLVNEFVVAATNHRVDRWGGSYENRVRFPVEIVRRVRERVGSD
FIVIYRLSMLDLVPGGSTLEEVVLLAREIEAAGATLINTGIGWHEARIPTIATSVPRGAF
TWVTEKVRGAVSVPLVTGNRVNTPELAEEILASGRADMVSMARPFLADPDFVAKAAAGRA
DAINTCIGCNQACLDHAFDLKITSCLVNPRACHETEMVLSATRRRRRVAVVGAGPAGLAC
AVTAAERGHTVTLFESADRIGGQLNVARRVPGKEEFDETLRYFRTRLAEEGVEVRLGTPA
TAAVLTGYDEVVLATGVEPRSPAIPGVGHPSVVSYPDVLRDGAPVGDRVAIVGAGGIGFD
VAEWLTDGGEGASRDPEVFARTWGVDTAYAGRGGLRTPKRPEPPRSVFLVQRRTTKVGAG
LGRTTGWIHRTELRRRGVTMIAGATYDLIDDAGLHLTVDGERRTLAVDTVILCTGQEPRR
ELYEGLRAAGRPVRLVGGADVAAELDAKRAIRQGTEVAARL
Download sequence
Identical sequences G2NQ91
gi|345003552|ref|YP_004806406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]