SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344999057|ref|YP_004801911.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344999057|ref|YP_004801911.1|
Domain Number 1 Region: 17-359
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 4.45e-47
Family ADP-ribosylglycohydrolase 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344999057|ref|YP_004801911.1|
Sequence length 396
Comment ADP-ribosylation/Crystallin J1 [Streptomyces sp. SirexAA-E]
Sequence
MTSKTSTVAEPDTTTTPTLDERVTGALVGAAVGDALGGPVEGWSPEQIAERHGGRVTGVV
GPWYGDGWRTARPIAPYHKGDGHVTDDTLMTHALVRVYATVRDHLDAYAVADHLVPDLMS
RPRWIPELEAEALPLQRIFLAEKWIVTRLHYGHADPREAGSGNIVNCGAAMYMAPVGLVN
AAHPEAAYAEALDVAGAHQSSYGREAAGVLAAGVAAACAPGATPASVVETCLALAKDGTR
SAIEAVCEVAAHHSDFESALAPLRAAVAPFDTVGPDYREPSLGARRPSRLHAIEELPVAL
GMLLVSGGDYRHAVLGSVNYGRDCDSIATMSGALAGALHGEAPIPDAWVKTVADASRLDL
HAPARTLTEVAREVFVRDTARRRAHESAFAELAGPR
Download sequence
Identical sequences G2NBJ0
gi|344999057|ref|YP_004801911.1| WP_014045358.1.27930 WP_014045358.1.39937 WP_014045358.1.47793 WP_014045358.1.77718 WP_014045358.1.79727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]