SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|511059575|ref|YP_008071460.1| from Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511059575|ref|YP_008071460.1|
Domain Number 1 Region: 85-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000157
Family NfeD domain-like 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|511059575|ref|YP_008071460.1|
Domain Number - Region: 171-228
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00118
Family NfeD domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|511059575|ref|YP_008071460.1|
Sequence length 229
Comment hypothetical protein H729_03445 [Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1]
Sequence
MMIAIIMLIIGIILLLAEAAAPGNFIIVPATMLTILGIVFVFIPDQLLTIYTPILAVIIL
IIAAVLAIQLYKRMSPVAPPETLVGTSLVGRVGIVTTMITPSTMLGKVRVNGEVWSAEAN
CSIAAGTPVKIIASEGVHVTVEEISKEEYDKCSAQESKATVPPITEAKPAKSKNGETAVV
VTLISPGLGTGKVKIGDEVFNATADCNIYAGTEVRVLSKDANGVRVEEI
Download sequence
Identical sequences R9T5X0
gi|511059575|ref|YP_008071460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]