SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|511060240|ref|YP_008072125.1| from Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511060240|ref|YP_008072125.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.71e-62
Family Phosphate binding protein-like 0.0000407
Further Details:      
 
Domain Number 2 Region: 214-286
Classification Level Classification E-value
Superfamily GlnB-like 1.45e-19
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|511060240|ref|YP_008072125.1|
Sequence length 287
Comment ATP phosphoribosyltransferase [Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1]
Sequence
MPIKLAVPNKGRLNERSLEMLKRAGLEIENGGDRLLFASVKNGNFSVLFLRAQDIVRFVQ
TGAVDAGITGWDLVLENGNGVELVREMGFGKCRLSVAVPESSGINSLEDIADGSRVATSF
PNMTKQFFESIGKKVEIAVISGAAEVMPRMGVADFITDLVSSGSTLKSNNLRELAVISDS
QAVLIASKNLHSEKMKELEELANALESVEIAEHKKYLMADVPVAVLDEVRTFLPGIDGPT
VMNIAGRDDVVAIHVVIDKSQIYNTVNKLKKLGASGILIVPIDRMVP
Download sequence
Identical sequences R9T7T4
WP_020449295.1.21401 gi|511060240|ref|YP_008072125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]