SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478454287|ref|YP_007716666.1| from Chlamydia trachomatis L2b/UCH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478454287|ref|YP_007716666.1|
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.04e-59
Family Phosphate binding protein-like 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478454287|ref|YP_007716666.1|
Sequence length 256
Comment putative periplasmic solute-binding protein [Chlamydia trachomatis L2b/UCH-2]
Sequence
MTFSAAFSPCPNDIFLFRSFLEKHKGFPSLRQIMIADISSLNYYALETRFPLIKISASLY
PQIADSYDVLNVGTTLGYKIGPLILSKQLDSPLKSLATPGETTTAHALCRLFYPRAELVP
MKYHEIIPAILSNRVDGGAVIHEERFSFPKDLCIVEDLGQLWEKTWHLPLPLGCIVISKK
VSDDDSYLLSHALQESLKKSLTDSALAIQKASEYSRDKNPTTIQHFIDTYVTEETFNLSS
IGRQAFSTLWTACRNV
Download sequence
Identical sequences A0A0E9E686 A0A0H3MC13
gi|166154473|ref|YP_001654591.1| gi|478471416|ref|YP_007740019.1| 471472.CTL0514 471473.CTLon_0510 gi|478463319|ref|YP_007739131.1| gi|478465117|ref|YP_007741799.1| gi|527318074|ref|YP_008344276.1| gi|478452482|ref|YP_007720230.1| gi|482546565|ref|YP_007852481.1| gi|527326705|ref|YP_008352897.1| WP_009873682.1.100883 WP_009873682.1.101735 WP_009873682.1.11148 WP_009873682.1.11732 WP_009873682.1.17082 WP_009873682.1.18643 WP_009873682.1.22210 WP_009873682.1.25195 WP_009873682.1.27753 WP_009873682.1.27980 WP_009873682.1.32801 WP_009873682.1.38181 WP_009873682.1.38794 WP_009873682.1.40464 WP_009873682.1.40808 WP_009873682.1.42718 WP_009873682.1.45552 WP_009873682.1.48923 WP_009873682.1.49465 WP_009873682.1.51159 WP_009873682.1.53299 WP_009873682.1.5416 WP_009873682.1.58046 WP_009873682.1.58308 WP_009873682.1.5967 WP_009873682.1.60427 WP_009873682.1.62489 WP_009873682.1.64162 WP_009873682.1.67104 WP_009873682.1.71307 WP_009873682.1.79775 WP_009873682.1.83642 WP_009873682.1.85365 WP_009873682.1.95142 WP_009873682.1.97423 WP_009873682.1.99598 YP_001654591.1.27483 gi|339625922|ref|YP_004717401.1| gi|478449781|ref|YP_007719338.1| gi|527325783|ref|YP_008351976.1| gi|527323724|ref|YP_008349920.1| gi|478450682|ref|YP_007721124.1| gi|478453395|ref|YP_007717557.1| gi|527318996|ref|YP_008345197.1| gi|478469626|ref|YP_007722906.1| gi|478466916|ref|YP_007718448.1| gi|478462420|ref|YP_007738241.1| gi|478447981|ref|YP_007722015.1| gi|478467817|ref|YP_007742690.1| gi|527327633|ref|YP_008353824.1| gi|478470525|ref|YP_007729166.1| gi|478451582|ref|YP_007714888.1| gi|166155348|ref|YP_001653603.1| gi|478447089|ref|YP_007715777.1| gi|482545622|ref|YP_007851540.1| gi|478454287|ref|YP_007716666.1| gi|527324859|ref|YP_008351053.1| gi|478464217|ref|YP_007740909.1| gi|527321822|ref|YP_008348020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]