SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384447059|ref|YP_005661277.1| from Brucella melitensis NI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384447059|ref|YP_005661277.1|
Domain Number 1 Region: 8-317
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.63e-68
Family beta-Lactamase/D-ala carboxypeptidase 0.000000000113
Further Details:      
 
Domain Number 2 Region: 420-517
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 1.02e-41
Family D-aminopeptidase, middle and C-terminal domains 0.00000337
Further Details:      
 
Domain Number 3 Region: 336-417
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 9.68e-39
Family D-aminopeptidase, middle and C-terminal domains 0.0000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384447059|ref|YP_005661277.1|
Sequence length 518
Comment D-aminopeptidase [Brucella melitensis NI]
Sequence
MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPI
CSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLC
GAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRILADLIEQHTGRSLADLLAER
IFAPAAMKTAELIPDTALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWEQ
FIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWH
CADERISTIVMFNFEGNASDAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLS
LEDAGGGRMKARFGTGPEKMDISGENEAQSSMTTLRRDGDMIHLARKDENLHLAMHRLKG
KARQDIAGRYRSDELEADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDVWLLPVQRSM
DAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL
Download sequence
Identical sequences A0A2D3K923 C0RM93
gi|384213455|ref|YP_005602538.1| gi|225686708|ref|YP_002734680.1| gi|384410557|ref|YP_005599177.1| 546272.BMEA_B0933 WP_004685968.1.100628 WP_004685968.1.100807 WP_004685968.1.101411 WP_004685968.1.102026 WP_004685968.1.1055 WP_004685968.1.10844 WP_004685968.1.10866 WP_004685968.1.11066 WP_004685968.1.11859 WP_004685968.1.11933 WP_004685968.1.12981 WP_004685968.1.18494 WP_004685968.1.19483 WP_004685968.1.22142 WP_004685968.1.24607 WP_004685968.1.24895 WP_004685968.1.24923 WP_004685968.1.24971 WP_004685968.1.25135 WP_004685968.1.25450 WP_004685968.1.27794 WP_004685968.1.29765 WP_004685968.1.29997 WP_004685968.1.31644 WP_004685968.1.31680 WP_004685968.1.32779 WP_004685968.1.33032 WP_004685968.1.33289 WP_004685968.1.34183 WP_004685968.1.34423 WP_004685968.1.35338 WP_004685968.1.35577 WP_004685968.1.36149 WP_004685968.1.36712 WP_004685968.1.40189 WP_004685968.1.4091 WP_004685968.1.41105 WP_004685968.1.41344 WP_004685968.1.42065 WP_004685968.1.42633 WP_004685968.1.42774 WP_004685968.1.4295 WP_004685968.1.43058 WP_004685968.1.43148 WP_004685968.1.4319 WP_004685968.1.44045 WP_004685968.1.44060 WP_004685968.1.44541 WP_004685968.1.48075 WP_004685968.1.48184 WP_004685968.1.51553 WP_004685968.1.52478 WP_004685968.1.52541 WP_004685968.1.54481 WP_004685968.1.55047 WP_004685968.1.55284 WP_004685968.1.56621 WP_004685968.1.57541 WP_004685968.1.60134 WP_004685968.1.60920 WP_004685968.1.61081 WP_004685968.1.61543 WP_004685968.1.61961 WP_004685968.1.6440 WP_004685968.1.64585 WP_004685968.1.65501 WP_004685968.1.65597 WP_004685968.1.66268 WP_004685968.1.66407 WP_004685968.1.66647 WP_004685968.1.66855 WP_004685968.1.67107 WP_004685968.1.67659 WP_004685968.1.69997 WP_004685968.1.70160 WP_004685968.1.71228 WP_004685968.1.72189 WP_004685968.1.73628 WP_004685968.1.73739 WP_004685968.1.7388 WP_004685968.1.74236 WP_004685968.1.75128 WP_004685968.1.75563 WP_004685968.1.7667 WP_004685968.1.76877 WP_004685968.1.77281 WP_004685968.1.77685 WP_004685968.1.79327 WP_004685968.1.80059 WP_004685968.1.80167 WP_004685968.1.81377 WP_004685968.1.82205 WP_004685968.1.82390 WP_004685968.1.82753 WP_004685968.1.82834 WP_004685968.1.82990 WP_004685968.1.84601 WP_004685968.1.84764 WP_004685968.1.85684 WP_004685968.1.85753 WP_004685968.1.86832 WP_004685968.1.86901 WP_004685968.1.88658 WP_004685968.1.88867 WP_004685968.1.89113 WP_004685968.1.9096 WP_004685968.1.91081 WP_004685968.1.92383 WP_004685968.1.95141 WP_004685968.1.95178 WP_004685968.1.95770 WP_004685968.1.96661 WP_004685968.1.97320 WP_004685968.1.97331 WP_004685968.1.97860 WP_004685968.1.98764 gi|384447059|ref|YP_005661277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]