SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197738033|ref|YP_002159349.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197738033|ref|YP_002159349.1|
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-35
Family PadR-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197738033|ref|YP_002159349.1|
Sequence length 180
Comment hypothetical protein TBHG_00047 [Mycobacterium tuberculosis str. Haarlem]
Sequence
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADGLIAENAAPAG
TPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVHLAFFNRTPAEARMRILEGRR
RQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWLNELIAAERAAPNPAEQT
Download sequence
Identical sequences A0A045HU72 A0A089QGS1 A0A0H3LB54 A0A0H3M768 A0A0K2HQP7 A0A109STK9 A0A197J2S0 A0A1A9T6B2 A0A1R3XWC5 A5TYB8 F8LZG4 G0TLT0 P71704
gi|15607189|ref|NP_214561.1| gi|340625080|ref|YP_004743532.1| gi|383305985|ref|YP_005358796.1| gi|449062026|ref|YP_007429109.1| Rv0047c gi|433640176|ref|YP_007285935.1| gi|433625139|ref|YP_007258768.1| gi|121635957|ref|YP_976180.1| gi|253796962|ref|YP_003029963.1| gi|494698413|ref|YP_007963895.1| NP_214561.1.84033 WP_003899787.1.100000 WP_003899787.1.100021 WP_003899787.1.100069 WP_003899787.1.100087 WP_003899787.1.10015 WP_003899787.1.100208 WP_003899787.1.100216 WP_003899787.1.10022 WP_003899787.1.100255 WP_003899787.1.100260 WP_003899787.1.100270 WP_003899787.1.100279 WP_003899787.1.100286 WP_003899787.1.100308 WP_003899787.1.100309 WP_003899787.1.100318 WP_003899787.1.100337 WP_003899787.1.100338 WP_003899787.1.10037 WP_003899787.1.100383 WP_003899787.1.100395 WP_003899787.1.100396 WP_003899787.1.1004 WP_003899787.1.100401 WP_003899787.1.100459 WP_003899787.1.100460 WP_003899787.1.100552 WP_003899787.1.100581 WP_003899787.1.100600 WP_003899787.1.100625 WP_003899787.1.10064 WP_003899787.1.100666 WP_003899787.1.100671 WP_003899787.1.100677 WP_003899787.1.100682 WP_003899787.1.100697 WP_003899787.1.100703 WP_003899787.1.100716 WP_003899787.1.100722 WP_003899787.1.100754 WP_003899787.1.100757 WP_003899787.1.100772 WP_003899787.1.1008 WP_003899787.1.100812 WP_003899787.1.100866 WP_003899787.1.10088 WP_003899787.1.100889 WP_003899787.1.10090 WP_003899787.1.100910 WP_003899787.1.100915 WP_003899787.1.100918 WP_003899787.1.100935 WP_003899787.1.100984 WP_003899787.1.100992 WP_003899787.1.100998 WP_003899787.1.101 WP_003899787.1.101025 WP_003899787.1.101028 WP_003899787.1.10104 WP_003899787.1.101048 WP_003899787.1.101054 WP_003899787.1.101075 WP_003899787.1.101143 WP_003899787.1.101146 WP_003899787.1.10116 WP_003899787.1.10117 WP_003899787.1.101209 WP_003899787.1.10125 WP_003899787.1.101290 WP_003899787.1.101323 WP_003899787.1.101324 WP_003899787.1.101350 WP_003899787.1.101367 WP_003899787.1.101398 WP_003899787.1.101403 WP_003899787.1.101421 WP_003899787.1.10144 WP_003899787.1.101442 WP_003899787.1.10145 WP_003899787.1.101452 WP_003899787.1.101456 WP_003899787.1.101481 WP_003899787.1.101493 WP_003899787.1.101496 WP_003899787.1.101525 WP_003899787.1.101533 WP_003899787.1.101535 WP_003899787.1.101553 WP_003899787.1.101558 WP_003899787.1.10156 WP_003899787.1.101573 WP_003899787.1.101576 WP_003899787.1.10159 WP_003899787.1.101592 WP_003899787.1.101604 WP_003899787.1.101607 WP_003899787.1.101622 WP_003899787.1.101644 WP_003899787.1.101659 WP_003899787.1.101671 WP_003899787.1.101687 WP_003899787.1.101698 WP_003899787.1.10170 WP_003899787.1.101713 WP_003899787.1.101722 WP_003899787.1.101733 WP_003899787.1.101743 WP_003899787.1.101754 WP_003899787.1.101764 WP_003899787.1.101773 WP_003899787.1.101795 WP_003899787.1.101797 WP_003899787.1.101798 WP_003899787.1.101802 WP_003899787.1.101826 WP_003899787.1.101836 WP_003899787.1.101858 WP_003899787.1.101859 WP_003899787.1.101862 WP_003899787.1.101888 WP_003899787.1.101894 WP_003899787.1.101899 WP_003899787.1.1019 WP_003899787.1.101923 WP_003899787.1.101925 WP_003899787.1.10193 WP_003899787.1.101996 WP_003899787.1.102 WP_003899787.1.102008 WP_003899787.1.102017 WP_003899787.1.102053 WP_003899787.1.102055 WP_003899787.1.102063 WP_003899787.1.102099 WP_003899787.1.1021 WP_003899787.1.10211 WP_003899787.1.102119 WP_003899787.1.102121 WP_003899787.1.102143 WP_003899787.1.10216 WP_003899787.1.10224 WP_003899787.1.10253 WP_003899787.1.10262 WP_003899787.1.10272 WP_003899787.1.10277 WP_003899787.1.1033 WP_003899787.1.10350 WP_003899787.1.10362 WP_003899787.1.10366 WP_003899787.1.10376 WP_003899787.1.10396 WP_003899787.1.10410 WP_003899787.1.10414 WP_003899787.1.10421 WP_003899787.1.10430 WP_003899787.1.1044 WP_003899787.1.10440 WP_003899787.1.10445 WP_003899787.1.10471 WP_003899787.1.10472 WP_003899787.1.10489 WP_003899787.1.105 WP_003899787.1.10518 WP_003899787.1.10523 WP_003899787.1.10545 WP_003899787.1.1057 WP_003899787.1.10594 WP_003899787.1.10603 WP_003899787.1.10606 WP_003899787.1.10615 WP_003899787.1.10623 WP_003899787.1.10635 WP_003899787.1.10643 WP_003899787.1.10648 WP_003899787.1.10709 WP_003899787.1.10735 WP_003899787.1.10740 WP_003899787.1.10756 WP_003899787.1.1078 WP_003899787.1.10791 WP_003899787.1.10799 WP_003899787.1.10825 WP_003899787.1.10848 WP_003899787.1.10863 WP_003899787.1.10879 WP_003899787.1.10912 WP_003899787.1.10916 WP_003899787.1.10923 WP_003899787.1.10927 WP_003899787.1.1095 WP_003899787.1.10956 WP_003899787.1.10958 WP_003899787.1.10962 WP_003899787.1.10980 WP_003899787.1.10981 WP_003899787.1.10993 WP_003899787.1.1100 WP_003899787.1.11040 WP_003899787.1.11061 WP_003899787.1.11070 WP_003899787.1.11141 WP_003899787.1.11171 WP_003899787.1.11175 WP_003899787.1.11176 WP_003899787.1.11222 WP_003899787.1.11236 WP_003899787.1.11329 WP_003899787.1.1133 WP_003899787.1.11342 WP_003899787.1.11373 WP_003899787.1.11376 WP_003899787.1.11390 WP_003899787.1.11402 WP_003899787.1.11481 WP_003899787.1.11487 WP_003899787.1.11489 WP_003899787.1.11491 WP_003899787.1.11514 WP_003899787.1.11587 WP_003899787.1.11589 WP_003899787.1.11596 WP_003899787.1.11604 WP_003899787.1.11610 WP_003899787.1.11697 WP_003899787.1.11707 WP_003899787.1.11752 WP_003899787.1.11758 WP_003899787.1.11761 WP_003899787.1.11775 WP_003899787.1.11804 WP_003899787.1.11822 WP_003899787.1.11826 WP_003899787.1.11856 WP_003899787.1.11898 WP_003899787.1.11906 WP_003899787.1.11939 WP_003899787.1.11960 WP_003899787.1.11961 WP_003899787.1.11972 WP_003899787.1.11984 WP_003899787.1.120 WP_003899787.1.12001 WP_003899787.1.12049 WP_003899787.1.12052 WP_003899787.1.12100 WP_003899787.1.12116 WP_003899787.1.12130 WP_003899787.1.12133 WP_003899787.1.12161 WP_003899787.1.12165 WP_003899787.1.12184 WP_003899787.1.12187 WP_003899787.1.12190 WP_003899787.1.12216 WP_003899787.1.12265 WP_003899787.1.12275 WP_003899787.1.12293 WP_003899787.1.12294 WP_003899787.1.123 WP_003899787.1.1231 WP_003899787.1.12314 WP_003899787.1.12327 WP_003899787.1.12338 WP_003899787.1.1236 WP_003899787.1.12371 WP_003899787.1.12372 WP_003899787.1.12389 WP_003899787.1.12406 WP_003899787.1.1241 WP_003899787.1.12421 WP_003899787.1.12424 WP_003899787.1.12446 WP_003899787.1.12464 WP_003899787.1.12479 WP_003899787.1.12519 WP_003899787.1.12523 WP_003899787.1.12526 WP_003899787.1.1255 WP_003899787.1.12550 WP_003899787.1.12551 WP_003899787.1.12563 WP_003899787.1.12611 WP_003899787.1.12669 WP_003899787.1.1267 WP_003899787.1.12672 WP_003899787.1.12692 WP_003899787.1.1271 WP_003899787.1.12710 WP_003899787.1.12768 WP_003899787.1.1279 WP_003899787.1.12794 WP_003899787.1.12801 WP_003899787.1.12804 WP_003899787.1.12821 WP_003899787.1.12841 WP_003899787.1.12854 WP_003899787.1.12871 WP_003899787.1.12901 WP_003899787.1.12941 WP_003899787.1.12947 WP_003899787.1.12957 WP_003899787.1.12972 WP_003899787.1.13028 WP_003899787.1.13043 WP_003899787.1.13086 WP_003899787.1.13087 WP_003899787.1.13090 WP_003899787.1.13096 WP_003899787.1.13163 WP_003899787.1.13175 WP_003899787.1.13183 WP_003899787.1.132 WP_003899787.1.13249 WP_003899787.1.13282 WP_003899787.1.13284 WP_003899787.1.13296 WP_003899787.1.13298 WP_003899787.1.13302 WP_003899787.1.13306 WP_003899787.1.13312 WP_003899787.1.13313 WP_003899787.1.13321 WP_003899787.1.13345 WP_003899787.1.13358 WP_003899787.1.13370 WP_003899787.1.13375 WP_003899787.1.1338 WP_003899787.1.13420 WP_003899787.1.13433 WP_003899787.1.13435 WP_003899787.1.13438 WP_003899787.1.13461 WP_003899787.1.13466 WP_003899787.1.13489 WP_003899787.1.13526 WP_003899787.1.13551 WP_003899787.1.13564 WP_003899787.1.13579 WP_003899787.1.13647 WP_003899787.1.13667 WP_003899787.1.13687 WP_003899787.1.13697 WP_003899787.1.13719 WP_003899787.1.13763 WP_003899787.1.1377 WP_003899787.1.13774 WP_003899787.1.13786 WP_003899787.1.13793 WP_003899787.1.13794 WP_003899787.1.13817 WP_003899787.1.13834 WP_003899787.1.13866 WP_003899787.1.13880 WP_003899787.1.13899 WP_003899787.1.13909 WP_003899787.1.13910 WP_003899787.1.13919 WP_003899787.1.13920 WP_003899787.1.13952 WP_003899787.1.13953 WP_003899787.1.13962 WP_003899787.1.1398 WP_003899787.1.13988 WP_003899787.1.14027 WP_003899787.1.14046 WP_003899787.1.14115 WP_003899787.1.1415 WP_003899787.1.14152 WP_003899787.1.14158 WP_003899787.1.14175 WP_003899787.1.14178 WP_003899787.1.14194 WP_003899787.1.14195 WP_003899787.1.14208 WP_003899787.1.14238 WP_003899787.1.14266 WP_003899787.1.14273 WP_003899787.1.14303 WP_003899787.1.14306 WP_003899787.1.14307 WP_003899787.1.14310 WP_003899787.1.14341 WP_003899787.1.14382 WP_003899787.1.14416 WP_003899787.1.14428 WP_003899787.1.14441 WP_003899787.1.14469 WP_003899787.1.14477 WP_003899787.1.14504 WP_003899787.1.14514 WP_003899787.1.1452 WP_003899787.1.14527 WP_003899787.1.1454 WP_003899787.1.14544 WP_003899787.1.14548 WP_003899787.1.14551 WP_003899787.1.14561 WP_003899787.1.14573 WP_003899787.1.1462 WP_003899787.1.14658 WP_003899787.1.14667 WP_003899787.1.14668 WP_003899787.1.14675 WP_003899787.1.14694 WP_003899787.1.14695 WP_003899787.1.14709 WP_003899787.1.14766 WP_003899787.1.14783 WP_003899787.1.14865 WP_003899787.1.14872 WP_003899787.1.14905 WP_003899787.1.14926 WP_003899787.1.14951 WP_003899787.1.14955 WP_003899787.1.15003 WP_003899787.1.15009 WP_003899787.1.15028 WP_003899787.1.15040 WP_003899787.1.15052 WP_003899787.1.15065 WP_003899787.1.15072 WP_003899787.1.15089 WP_003899787.1.1509 WP_003899787.1.15126 WP_003899787.1.15131 WP_003899787.1.15168 WP_003899787.1.15174 WP_003899787.1.15187 WP_003899787.1.15196 WP_003899787.1.15210 WP_003899787.1.15216 WP_003899787.1.15217 WP_003899787.1.1523 WP_003899787.1.15232 WP_003899787.1.15238 WP_003899787.1.15240 WP_003899787.1.15253 WP_003899787.1.15267 WP_003899787.1.1527 WP_003899787.1.15292 WP_003899787.1.15299 WP_003899787.1.15302 WP_003899787.1.15322 WP_003899787.1.1534 WP_003899787.1.15345 WP_003899787.1.15365 WP_003899787.1.15372 WP_003899787.1.15386 WP_003899787.1.15387 WP_003899787.1.15442 WP_003899787.1.15447 WP_003899787.1.15449 WP_003899787.1.15477 WP_003899787.1.15481 WP_003899787.1.15492 WP_003899787.1.15511 WP_003899787.1.15512 WP_003899787.1.15558 WP_003899787.1.15559 WP_003899787.1.15566 WP_003899787.1.15599 WP_003899787.1.1560 WP_003899787.1.15611 WP_003899787.1.1563 WP_003899787.1.15633 WP_003899787.1.15643 WP_003899787.1.15688 WP_003899787.1.15755 WP_003899787.1.15763 WP_003899787.1.15774 WP_003899787.1.1578 WP_003899787.1.15780 WP_003899787.1.15834 WP_003899787.1.15842 WP_003899787.1.15848 WP_003899787.1.15853 WP_003899787.1.15870 WP_003899787.1.15877 WP_003899787.1.15893 WP_003899787.1.15896 WP_003899787.1.15926 WP_003899787.1.15933 WP_003899787.1.15946 WP_003899787.1.15958 WP_003899787.1.15973 WP_003899787.1.15987 WP_003899787.1.15993 WP_003899787.1.16009 WP_003899787.1.16025 WP_003899787.1.16043 WP_003899787.1.16055 WP_003899787.1.16066 WP_003899787.1.16069 WP_003899787.1.16077 WP_003899787.1.16106 WP_003899787.1.16108 WP_003899787.1.16110 WP_003899787.1.16130 WP_003899787.1.16136 WP_003899787.1.16139 WP_003899787.1.16141 WP_003899787.1.16143 WP_003899787.1.1630 WP_003899787.1.16318 WP_003899787.1.1632 WP_003899787.1.16327 WP_003899787.1.16334 WP_003899787.1.16341 WP_003899787.1.16345 WP_003899787.1.16374 WP_003899787.1.16384 WP_003899787.1.16386 WP_003899787.1.164 WP_003899787.1.1642 WP_003899787.1.16421 WP_003899787.1.16426 WP_003899787.1.16431 WP_003899787.1.16438 WP_003899787.1.1644 WP_003899787.1.16442 WP_003899787.1.16448 WP_003899787.1.16451 WP_003899787.1.16476 WP_003899787.1.16480 WP_003899787.1.16494 WP_003899787.1.1652 WP_003899787.1.16549 WP_003899787.1.16560 WP_003899787.1.16598 WP_003899787.1.16609 WP_003899787.1.16619 WP_003899787.1.16620 WP_003899787.1.16622 WP_003899787.1.16637 WP_003899787.1.1669 WP_003899787.1.16707 WP_003899787.1.16724 WP_003899787.1.16731 WP_003899787.1.16743 WP_003899787.1.1683 WP_003899787.1.16837 WP_003899787.1.16852 WP_003899787.1.16937 WP_003899787.1.16940 WP_003899787.1.16950 WP_003899787.1.16959 WP_003899787.1.16968 WP_003899787.1.1697 WP_003899787.1.16973 WP_003899787.1.16977 WP_003899787.1.16987 WP_003899787.1.17005 WP_003899787.1.17006 WP_003899787.1.17010 WP_003899787.1.17015 WP_003899787.1.17019 WP_003899787.1.17039 WP_003899787.1.17041 WP_003899787.1.17052 WP_003899787.1.17057 WP_003899787.1.17062 WP_003899787.1.1707 WP_003899787.1.17094 WP_003899787.1.17130 WP_003899787.1.17138 WP_003899787.1.17147 WP_003899787.1.17167 WP_003899787.1.17224 WP_003899787.1.17251 WP_003899787.1.17288 WP_003899787.1.17304 WP_003899787.1.17314 WP_003899787.1.17345 WP_003899787.1.17381 WP_003899787.1.17391 WP_003899787.1.17412 WP_003899787.1.1743 WP_003899787.1.17440 WP_003899787.1.17466 WP_003899787.1.17477 WP_003899787.1.17483 WP_003899787.1.17505 WP_003899787.1.17527 WP_003899787.1.17535 WP_003899787.1.17540 WP_003899787.1.17553 WP_003899787.1.17558 WP_003899787.1.17599 WP_003899787.1.17635 WP_003899787.1.17655 WP_003899787.1.17679 WP_003899787.1.1768 WP_003899787.1.17687 WP_003899787.1.17700 WP_003899787.1.17710 WP_003899787.1.17713 WP_003899787.1.17722 WP_003899787.1.17746 WP_003899787.1.17788 WP_003899787.1.17798 WP_003899787.1.17803 WP_003899787.1.17816 WP_003899787.1.17821 WP_003899787.1.17830 WP_003899787.1.17868 WP_003899787.1.17878 WP_003899787.1.1792 WP_003899787.1.17923 WP_003899787.1.1795 WP_003899787.1.17955 WP_003899787.1.17973 WP_003899787.1.18009 WP_003899787.1.18013 WP_003899787.1.18033 WP_003899787.1.18057 WP_003899787.1.18065 WP_003899787.1.18070 WP_003899787.1.18116 WP_003899787.1.18120 WP_003899787.1.18126 WP_003899787.1.1817 WP_003899787.1.18170 WP_003899787.1.18206 WP_003899787.1.18216 WP_003899787.1.18240 WP_003899787.1.18257 WP_003899787.1.18297 WP_003899787.1.18306 WP_003899787.1.18364 WP_003899787.1.18399 WP_003899787.1.18411 WP_003899787.1.18444 WP_003899787.1.18448 WP_003899787.1.18467 WP_003899787.1.18476 WP_003899787.1.18522 WP_003899787.1.18580 WP_003899787.1.18582 WP_003899787.1.18587 WP_003899787.1.186 WP_003899787.1.18601 WP_003899787.1.18639 WP_003899787.1.18646 WP_003899787.1.18647 WP_003899787.1.1868 WP_003899787.1.18694 WP_003899787.1.18710 WP_003899787.1.18751 WP_003899787.1.18781 WP_003899787.1.18793 WP_003899787.1.18804 WP_003899787.1.18816 WP_003899787.1.18823 WP_003899787.1.18827 WP_003899787.1.18838 WP_003899787.1.18849 WP_003899787.1.18856 WP_003899787.1.18945 WP_003899787.1.1898 WP_003899787.1.19005 WP_003899787.1.19056 WP_003899787.1.19063 WP_003899787.1.19066 WP_003899787.1.19071 WP_003899787.1.19085 WP_003899787.1.19094 WP_003899787.1.19144 WP_003899787.1.19159 WP_003899787.1.19193 WP_003899787.1.19231 WP_003899787.1.19243 WP_003899787.1.19264 WP_003899787.1.19295 WP_003899787.1.19307 WP_003899787.1.19326 WP_003899787.1.1933 WP_003899787.1.19364 WP_003899787.1.19382 WP_003899787.1.19400 WP_003899787.1.19426 WP_003899787.1.19429 WP_003899787.1.19464 WP_003899787.1.19480 WP_003899787.1.19512 WP_003899787.1.19553 WP_003899787.1.19562 WP_003899787.1.19564 WP_003899787.1.19568 WP_003899787.1.19572 WP_003899787.1.19595 WP_003899787.1.19596 WP_003899787.1.19600 WP_003899787.1.19630 WP_003899787.1.1967 WP_003899787.1.19694 WP_003899787.1.1970 WP_003899787.1.19707 WP_003899787.1.19742 WP_003899787.1.19785 WP_003899787.1.19820 WP_003899787.1.19868 WP_003899787.1.19874 WP_003899787.1.19890 WP_003899787.1.19900 WP_003899787.1.19922 WP_003899787.1.19936 WP_003899787.1.19946 WP_003899787.1.19949 WP_003899787.1.19960 WP_003899787.1.19964 WP_003899787.1.20007 WP_003899787.1.20016 WP_003899787.1.20028 WP_003899787.1.2003 WP_003899787.1.20037 WP_003899787.1.20039 WP_003899787.1.20082 WP_003899787.1.20085 WP_003899787.1.20097 WP_003899787.1.20116 WP_003899787.1.20130 WP_003899787.1.20140 WP_003899787.1.20141 WP_003899787.1.20142 WP_003899787.1.20239 WP_003899787.1.20243 WP_003899787.1.20259 WP_003899787.1.20262 WP_003899787.1.20268 WP_003899787.1.20272 WP_003899787.1.20273 WP_003899787.1.20280 WP_003899787.1.20294 WP_003899787.1.20300 WP_003899787.1.20309 WP_003899787.1.20322 WP_003899787.1.2037 WP_003899787.1.20372 WP_003899787.1.20381 WP_003899787.1.204 WP_003899787.1.20427 WP_003899787.1.20432 WP_003899787.1.20457 WP_003899787.1.20459 WP_003899787.1.20460 WP_003899787.1.20542 WP_003899787.1.20578 WP_003899787.1.20608 WP_003899787.1.20624 WP_003899787.1.20628 WP_003899787.1.2066 WP_003899787.1.20707 WP_003899787.1.20722 WP_003899787.1.20729 WP_003899787.1.20742 WP_003899787.1.20751 WP_003899787.1.20776 WP_003899787.1.20843 WP_003899787.1.20850 WP_003899787.1.2086 WP_003899787.1.20868 WP_003899787.1.20876 WP_003899787.1.20897 WP_003899787.1.20898 WP_003899787.1.2090 WP_003899787.1.20911 WP_003899787.1.20916 WP_003899787.1.20921 WP_003899787.1.20926 WP_003899787.1.20927 WP_003899787.1.20951 WP_003899787.1.20970 WP_003899787.1.2104 WP_003899787.1.21070 WP_003899787.1.21127 WP_003899787.1.21135 WP_003899787.1.21173 WP_003899787.1.21187 WP_003899787.1.212 WP_003899787.1.2120 WP_003899787.1.21218 WP_003899787.1.21219 WP_003899787.1.2123 WP_003899787.1.21231 WP_003899787.1.21234 WP_003899787.1.2126 WP_003899787.1.21292 WP_003899787.1.21307 WP_003899787.1.2131 WP_003899787.1.21311 WP_003899787.1.21321 WP_003899787.1.21365 WP_003899787.1.2137 WP_003899787.1.21392 WP_003899787.1.21397 WP_003899787.1.21403 WP_003899787.1.21415 WP_003899787.1.21418 WP_003899787.1.21430 WP_003899787.1.21434 WP_003899787.1.21444 WP_003899787.1.21468 WP_003899787.1.21498 WP_003899787.1.21509 WP_003899787.1.21513 WP_003899787.1.21560 WP_003899787.1.21565 WP_003899787.1.21586 WP_003899787.1.21591 WP_003899787.1.21594 WP_003899787.1.21602 WP_003899787.1.21615 WP_003899787.1.21638 WP_003899787.1.21639 WP_003899787.1.21655 WP_003899787.1.21658 WP_003899787.1.2168 WP_003899787.1.2174 WP_003899787.1.21741 WP_003899787.1.21742 WP_003899787.1.21777 WP_003899787.1.21786 WP_003899787.1.21795 WP_003899787.1.218 WP_003899787.1.21826 WP_003899787.1.21829 WP_003899787.1.21840 WP_003899787.1.21843 WP_003899787.1.21872 WP_003899787.1.21873 WP_003899787.1.2188 WP_003899787.1.21882 WP_003899787.1.21906 WP_003899787.1.21912 WP_003899787.1.2194 WP_003899787.1.21941 WP_003899787.1.21956 WP_003899787.1.21958 WP_003899787.1.21960 WP_003899787.1.21971 WP_003899787.1.21973 WP_003899787.1.21983 WP_003899787.1.22003 WP_003899787.1.22013 WP_003899787.1.22025 WP_003899787.1.22036 WP_003899787.1.22075 WP_003899787.1.22092 WP_003899787.1.2212 WP_003899787.1.22127 WP_003899787.1.22140 WP_003899787.1.22233 WP_003899787.1.22255 WP_003899787.1.22277 WP_003899787.1.22305 WP_003899787.1.22348 WP_003899787.1.22356 WP_003899787.1.22366 WP_003899787.1.2238 WP_003899787.1.22380 WP_003899787.1.22437 WP_003899787.1.22438 WP_003899787.1.22445 WP_003899787.1.22490 WP_003899787.1.22511 WP_003899787.1.22524 WP_003899787.1.2253 WP_003899787.1.22585 WP_003899787.1.22589 WP_003899787.1.22606 WP_003899787.1.22608 WP_003899787.1.22609 WP_003899787.1.22618 WP_003899787.1.2262 WP_003899787.1.22624 WP_003899787.1.22629 WP_003899787.1.22647 WP_003899787.1.22664 WP_003899787.1.22665 WP_003899787.1.22670 WP_003899787.1.22674 WP_003899787.1.22680 WP_003899787.1.22725 WP_003899787.1.22728 WP_003899787.1.22733 WP_003899787.1.22737 WP_003899787.1.2275 WP_003899787.1.22754 WP_003899787.1.22797 WP_003899787.1.22800 WP_003899787.1.22804 WP_003899787.1.22829 WP_003899787.1.22840 WP_003899787.1.22844 WP_003899787.1.22963 WP_003899787.1.22970 WP_003899787.1.22996 WP_003899787.1.22997 WP_003899787.1.22999 WP_003899787.1.23015 WP_003899787.1.23032 WP_003899787.1.231 WP_003899787.1.23101 WP_003899787.1.2312 WP_003899787.1.23140 WP_003899787.1.23153 WP_003899787.1.23171 WP_003899787.1.23199 WP_003899787.1.2320 WP_003899787.1.23204 WP_003899787.1.23216 WP_003899787.1.23229 WP_003899787.1.23233 WP_003899787.1.2326 WP_003899787.1.23261 WP_003899787.1.23272 WP_003899787.1.23289 WP_003899787.1.2329 WP_003899787.1.23308 WP_003899787.1.23316 WP_003899787.1.23325 WP_003899787.1.2339 WP_003899787.1.23406 WP_003899787.1.23438 WP_003899787.1.23445 WP_003899787.1.23447 WP_003899787.1.23452 WP_003899787.1.23461 WP_003899787.1.2349 WP_003899787.1.23497 WP_003899787.1.23506 WP_003899787.1.23530 WP_003899787.1.23539 WP_003899787.1.23546 WP_003899787.1.23551 WP_003899787.1.23573 WP_003899787.1.23583 WP_003899787.1.23588 WP_003899787.1.23628 WP_003899787.1.23677 WP_003899787.1.23683 WP_003899787.1.23692 WP_003899787.1.23694 WP_003899787.1.23699 WP_003899787.1.2371 WP_003899787.1.23803 WP_003899787.1.23807 WP_003899787.1.23825 WP_003899787.1.23832 WP_003899787.1.2384 WP_003899787.1.23843 WP_003899787.1.23863 WP_003899787.1.23894 WP_003899787.1.23993 WP_003899787.1.2400 WP_003899787.1.24007 WP_003899787.1.24008 WP_003899787.1.24046 WP_003899787.1.24057 WP_003899787.1.24062 WP_003899787.1.24113 WP_003899787.1.24119 WP_003899787.1.24128 WP_003899787.1.24140 WP_003899787.1.24176 WP_003899787.1.24190 WP_003899787.1.24202 WP_003899787.1.24244 WP_003899787.1.24261 WP_003899787.1.24294 WP_003899787.1.24357 WP_003899787.1.24396 WP_003899787.1.24414 WP_003899787.1.24423 WP_003899787.1.2443 WP_003899787.1.24446 WP_003899787.1.24461 WP_003899787.1.24500 WP_003899787.1.24507 WP_003899787.1.24509 WP_003899787.1.24529 WP_003899787.1.24553 WP_003899787.1.24599 WP_003899787.1.24629 WP_003899787.1.24638 WP_003899787.1.24648 WP_003899787.1.2466 WP_003899787.1.24767 WP_003899787.1.24824 WP_003899787.1.24831 WP_003899787.1.24840 WP_003899787.1.24848 WP_003899787.1.24857 WP_003899787.1.2487 WP_003899787.1.24893 WP_003899787.1.24907 WP_003899787.1.24933 WP_003899787.1.24956 WP_003899787.1.24958 WP_003899787.1.24985 WP_003899787.1.2499 WP_003899787.1.25004 WP_003899787.1.2505 WP_003899787.1.25051 WP_003899787.1.2507 WP_003899787.1.25096 WP_003899787.1.25103 WP_003899787.1.25129 WP_003899787.1.25171 WP_003899787.1.25184 WP_003899787.1.25247 WP_003899787.1.25252 WP_003899787.1.25278 WP_003899787.1.25283 WP_003899787.1.25309 WP_003899787.1.25313 WP_003899787.1.25338 WP_003899787.1.25342 WP_003899787.1.25343 WP_003899787.1.25367 WP_003899787.1.25393 WP_003899787.1.25406 WP_003899787.1.25435 WP_003899787.1.25437 WP_003899787.1.25445 WP_003899787.1.25455 WP_003899787.1.25473 WP_003899787.1.25504 WP_003899787.1.25513 WP_003899787.1.25542 WP_003899787.1.25579 WP_003899787.1.25594 WP_003899787.1.25606 WP_003899787.1.25645 WP_003899787.1.2566 WP_003899787.1.25673 WP_003899787.1.25674 WP_003899787.1.25693 WP_003899787.1.25699 WP_003899787.1.25727 WP_003899787.1.25736 WP_003899787.1.25738 WP_003899787.1.25756 WP_003899787.1.25759 WP_003899787.1.2580 WP_003899787.1.25813 WP_003899787.1.25853 WP_003899787.1.25854 WP_003899787.1.25874 WP_003899787.1.25885 WP_003899787.1.25892 WP_003899787.1.25906 WP_003899787.1.25914 WP_003899787.1.25916 WP_003899787.1.2594 WP_003899787.1.25954 WP_003899787.1.25965 WP_003899787.1.25972 WP_003899787.1.26017 WP_003899787.1.26032 WP_003899787.1.26038 WP_003899787.1.26072 WP_003899787.1.26089 WP_003899787.1.26097 WP_003899787.1.26098 WP_003899787.1.26108 WP_003899787.1.26109 WP_003899787.1.26118 WP_003899787.1.2614 WP_003899787.1.26168 WP_003899787.1.26182 WP_003899787.1.26190 WP_003899787.1.2620 WP_003899787.1.26234 WP_003899787.1.26243 WP_003899787.1.26265 WP_003899787.1.26267 WP_003899787.1.26292 WP_003899787.1.26310 WP_003899787.1.26328 WP_003899787.1.26349 WP_003899787.1.26366 WP_003899787.1.26374 WP_003899787.1.26407 WP_003899787.1.26412 WP_003899787.1.26454 WP_003899787.1.26464 WP_003899787.1.2653 WP_003899787.1.26560 WP_003899787.1.26571 WP_003899787.1.2659 WP_003899787.1.26597 WP_003899787.1.26603 WP_003899787.1.26629 WP_003899787.1.26651 WP_003899787.1.26702 WP_003899787.1.26707 WP_003899787.1.26710 WP_003899787.1.26719 WP_003899787.1.26737 WP_003899787.1.26738 WP_003899787.1.26745 WP_003899787.1.26756 WP_003899787.1.2676 WP_003899787.1.2677 WP_003899787.1.26779 WP_003899787.1.26780 WP_003899787.1.26798 WP_003899787.1.26854 WP_003899787.1.26868 WP_003899787.1.26876 WP_003899787.1.26914 WP_003899787.1.26945 WP_003899787.1.26959 WP_003899787.1.26969 WP_003899787.1.26984 WP_003899787.1.26992 WP_003899787.1.27004 WP_003899787.1.27017 WP_003899787.1.27045 WP_003899787.1.27074 WP_003899787.1.27075 WP_003899787.1.27128 WP_003899787.1.27130 WP_003899787.1.27139 WP_003899787.1.27152 WP_003899787.1.27162 WP_003899787.1.27164 WP_003899787.1.27193 WP_003899787.1.27235 WP_003899787.1.27254 WP_003899787.1.27278 WP_003899787.1.27343 WP_003899787.1.27352 WP_003899787.1.27369 WP_003899787.1.27391 WP_003899787.1.27398 WP_003899787.1.27402 WP_003899787.1.27410 WP_003899787.1.27411 WP_003899787.1.27449 WP_003899787.1.27460 WP_003899787.1.27463 WP_003899787.1.2749 WP_003899787.1.27492 WP_003899787.1.27528 WP_003899787.1.27541 WP_003899787.1.27576 WP_003899787.1.27582 WP_003899787.1.27596 WP_003899787.1.27607 WP_003899787.1.2766 WP_003899787.1.277 WP_003899787.1.27724 WP_003899787.1.27730 WP_003899787.1.27736 WP_003899787.1.27743 WP_003899787.1.27750 WP_003899787.1.27771 WP_003899787.1.27779 WP_003899787.1.27795 WP_003899787.1.27803 WP_003899787.1.27819 WP_003899787.1.27835 WP_003899787.1.27915 WP_003899787.1.27935 WP_003899787.1.27962 WP_003899787.1.28053 WP_003899787.1.28092 WP_003899787.1.28106 WP_003899787.1.28131 WP_003899787.1.28142 WP_003899787.1.28159 WP_003899787.1.2816 WP_003899787.1.28161 WP_003899787.1.28192 WP_003899787.1.28202 WP_003899787.1.28241 WP_003899787.1.28242 WP_003899787.1.28251 WP_003899787.1.28255 WP_003899787.1.28269 WP_003899787.1.28276 WP_003899787.1.28293 WP_003899787.1.28331 WP_003899787.1.28367 WP_003899787.1.28391 WP_003899787.1.2842 WP_003899787.1.28448 WP_003899787.1.2847 WP_003899787.1.28471 WP_003899787.1.28473 WP_003899787.1.28493 WP_003899787.1.28497 WP_003899787.1.28530 WP_003899787.1.28545 WP_003899787.1.28561 WP_003899787.1.28567 WP_003899787.1.28585 WP_003899787.1.286 WP_003899787.1.28610 WP_003899787.1.28617 WP_003899787.1.28634 WP_003899787.1.28642 WP_003899787.1.28671 WP_003899787.1.28682 WP_003899787.1.28698 WP_003899787.1.28703 WP_003899787.1.28739 WP_003899787.1.28758 WP_003899787.1.28781 WP_003899787.1.28787 WP_003899787.1.28827 WP_003899787.1.28839 WP_003899787.1.28847 WP_003899787.1.28850 WP_003899787.1.28851 WP_003899787.1.28865 WP_003899787.1.28897 WP_003899787.1.28914 WP_003899787.1.28935 WP_003899787.1.28936 WP_003899787.1.28939 WP_003899787.1.28943 WP_003899787.1.28952 WP_003899787.1.28975 WP_003899787.1.2899 WP_003899787.1.28993 WP_003899787.1.29000 WP_003899787.1.2901 WP_003899787.1.29028 WP_003899787.1.29033 WP_003899787.1.29058 WP_003899787.1.29078 WP_003899787.1.29102 WP_003899787.1.29115 WP_003899787.1.2916 WP_003899787.1.29217 WP_003899787.1.29223 WP_003899787.1.29234 WP_003899787.1.29264 WP_003899787.1.29275 WP_003899787.1.29306 WP_003899787.1.29339 WP_003899787.1.29348 WP_003899787.1.29364 WP_003899787.1.29367 WP_003899787.1.2938 WP_003899787.1.29399 WP_003899787.1.29426 WP_003899787.1.2944 WP_003899787.1.29449 WP_003899787.1.29450 WP_003899787.1.29452 WP_003899787.1.2949 WP_003899787.1.29510 WP_003899787.1.29515 WP_003899787.1.29525 WP_003899787.1.2953 WP_003899787.1.29559 WP_003899787.1.29587 WP_003899787.1.2959 WP_003899787.1.29592 WP_003899787.1.29599 WP_003899787.1.29611 WP_003899787.1.29632 WP_003899787.1.29649 WP_003899787.1.2965 WP_003899787.1.29659 WP_003899787.1.2969 WP_003899787.1.29696 WP_003899787.1.29698 WP_003899787.1.29718 WP_003899787.1.29742 WP_003899787.1.29745 WP_003899787.1.29747 WP_003899787.1.29769 WP_003899787.1.29825 WP_003899787.1.29830 WP_003899787.1.29847 WP_003899787.1.29861 WP_003899787.1.29869 WP_003899787.1.29883 WP_003899787.1.29890 WP_003899787.1.299 WP_003899787.1.29931 WP_003899787.1.29960 WP_003899787.1.30014 WP_003899787.1.3004 WP_003899787.1.30040 WP_003899787.1.30043 WP_003899787.1.30074 WP_003899787.1.30097 WP_003899787.1.30101 WP_003899787.1.30106 WP_003899787.1.30114 WP_003899787.1.30126 WP_003899787.1.30131 WP_003899787.1.30138 WP_003899787.1.30139 WP_003899787.1.30145 WP_003899787.1.30211 WP_003899787.1.30224 WP_003899787.1.30235 WP_003899787.1.30237 WP_003899787.1.3027 WP_003899787.1.30279 WP_003899787.1.30282 WP_003899787.1.30283 WP_003899787.1.30288 WP_003899787.1.30291 WP_003899787.1.30363 WP_003899787.1.30374 WP_003899787.1.30404 WP_003899787.1.30433 WP_003899787.1.30438 WP_003899787.1.30462 WP_003899787.1.30464 WP_003899787.1.30468 WP_003899787.1.30500 WP_003899787.1.3057 WP_003899787.1.30574 WP_003899787.1.30628 WP_003899787.1.30641 WP_003899787.1.30642 WP_003899787.1.30661 WP_003899787.1.30669 WP_003899787.1.30683 WP_003899787.1.30699 WP_003899787.1.30709 WP_003899787.1.30713 WP_003899787.1.30716 WP_003899787.1.30719 WP_003899787.1.30730 WP_003899787.1.30732 WP_003899787.1.30736 WP_003899787.1.30745 WP_003899787.1.30760 WP_003899787.1.30791 WP_003899787.1.308 WP_003899787.1.30807 WP_003899787.1.30818 WP_003899787.1.30824 WP_003899787.1.30848 WP_003899787.1.30877 WP_003899787.1.30888 WP_003899787.1.30901 WP_003899787.1.30903 WP_003899787.1.30912 WP_003899787.1.30913 WP_003899787.1.30914 WP_003899787.1.30919 WP_003899787.1.30977 WP_003899787.1.3100 WP_003899787.1.31002 WP_003899787.1.3101 WP_003899787.1.31034 WP_003899787.1.31047 WP_003899787.1.31070 WP_003899787.1.31074 WP_003899787.1.31102 WP_003899787.1.31127 WP_003899787.1.31184 WP_003899787.1.31199 WP_003899787.1.31226 WP_003899787.1.31230 WP_003899787.1.31233 WP_003899787.1.31263 WP_003899787.1.31264 WP_003899787.1.31287 WP_003899787.1.31290 WP_003899787.1.31304 WP_003899787.1.31346 WP_003899787.1.31348 WP_003899787.1.31354 WP_003899787.1.31390 WP_003899787.1.31414 WP_003899787.1.31417 WP_003899787.1.31428 WP_003899787.1.3143 WP_003899787.1.31458 WP_003899787.1.31483 WP_003899787.1.3149 WP_003899787.1.31498 WP_003899787.1.31507 WP_003899787.1.31537 WP_003899787.1.31548 WP_003899787.1.31569 WP_003899787.1.316 WP_003899787.1.31629 WP_003899787.1.31666 WP_003899787.1.31693 WP_003899787.1.31703 WP_003899787.1.31744 WP_003899787.1.31770 WP_003899787.1.31776 WP_003899787.1.31783 WP_003899787.1.318 WP_003899787.1.3184 WP_003899787.1.31840 WP_003899787.1.31880 WP_003899787.1.31911 WP_003899787.1.31930 WP_003899787.1.31955 WP_003899787.1.31985 WP_003899787.1.31991 WP_003899787.1.31995 WP_003899787.1.32004 WP_003899787.1.32039 WP_003899787.1.3204 WP_003899787.1.32045 WP_003899787.1.32071 WP_003899787.1.32098 WP_003899787.1.32132 WP_003899787.1.32157 WP_003899787.1.32164 WP_003899787.1.32179 WP_003899787.1.32198 WP_003899787.1.32297 WP_003899787.1.32317 WP_003899787.1.32383 WP_003899787.1.32400 WP_003899787.1.32403 WP_003899787.1.32416 WP_003899787.1.32421 WP_003899787.1.32433 WP_003899787.1.32461 WP_003899787.1.32482 WP_003899787.1.32503 WP_003899787.1.32556 WP_003899787.1.32562 WP_003899787.1.32569 WP_003899787.1.32592 WP_003899787.1.32620 WP_003899787.1.32647 WP_003899787.1.32653 WP_003899787.1.32654 WP_003899787.1.3268 WP_003899787.1.32695 WP_003899787.1.32706 WP_003899787.1.32716 WP_003899787.1.32752 WP_003899787.1.32780 WP_003899787.1.32781 WP_003899787.1.32793 WP_003899787.1.32799 WP_003899787.1.32822 WP_003899787.1.32833 WP_003899787.1.32862 WP_003899787.1.32880 WP_003899787.1.32897 WP_003899787.1.32909 WP_003899787.1.32935 WP_003899787.1.32974 WP_003899787.1.33007 WP_003899787.1.3302 WP_003899787.1.33028 WP_003899787.1.33035 WP_003899787.1.33044 WP_003899787.1.33054 WP_003899787.1.33082 WP_003899787.1.33141 WP_003899787.1.33148 WP_003899787.1.33155 WP_003899787.1.33168 WP_003899787.1.3321 WP_003899787.1.33215 WP_003899787.1.3325 WP_003899787.1.3327 WP_003899787.1.33278 WP_003899787.1.33288 WP_003899787.1.33305 WP_003899787.1.3331 WP_003899787.1.33319 WP_003899787.1.3333 WP_003899787.1.33393 WP_003899787.1.33403 WP_003899787.1.33452 WP_003899787.1.33467 WP_003899787.1.33477 WP_003899787.1.3349 WP_003899787.1.33519 WP_003899787.1.33542 WP_003899787.1.33601 WP_003899787.1.33602 WP_003899787.1.33633 WP_003899787.1.33646 WP_003899787.1.33673 WP_003899787.1.3369 WP_003899787.1.33705 WP_003899787.1.33762 WP_003899787.1.33783 WP_003899787.1.33789 WP_003899787.1.3383 WP_003899787.1.33832 WP_003899787.1.33839 WP_003899787.1.33848 WP_003899787.1.3387 WP_003899787.1.33886 WP_003899787.1.33895 WP_003899787.1.33906 WP_003899787.1.33912 WP_003899787.1.33954 WP_003899787.1.3399 WP_003899787.1.34042 WP_003899787.1.3405 WP_003899787.1.34055 WP_003899787.1.34056 WP_003899787.1.34065 WP_003899787.1.3408 WP_003899787.1.34090 WP_003899787.1.34109 WP_003899787.1.34111 WP_003899787.1.34131 WP_003899787.1.34152 WP_003899787.1.34153 WP_003899787.1.34163 WP_003899787.1.34181 WP_003899787.1.34197 WP_003899787.1.34198 WP_003899787.1.34215 WP_003899787.1.34219 WP_003899787.1.34255 WP_003899787.1.34260 WP_003899787.1.34275 WP_003899787.1.343 WP_003899787.1.34347 WP_003899787.1.34358 WP_003899787.1.34392 WP_003899787.1.344 WP_003899787.1.34428 WP_003899787.1.3443 WP_003899787.1.34435 WP_003899787.1.34446 WP_003899787.1.34499 WP_003899787.1.34505 WP_003899787.1.34516 WP_003899787.1.34529 WP_003899787.1.34551 WP_003899787.1.34563 WP_003899787.1.34576 WP_003899787.1.34581 WP_003899787.1.34588 WP_003899787.1.34596 WP_003899787.1.34599 WP_003899787.1.34639 WP_003899787.1.34673 WP_003899787.1.34724 WP_003899787.1.34740 WP_003899787.1.34755 WP_003899787.1.34777 WP_003899787.1.34783 WP_003899787.1.34841 WP_003899787.1.34908 WP_003899787.1.34919 WP_003899787.1.3492 WP_003899787.1.34933 WP_003899787.1.34945 WP_003899787.1.34946 WP_003899787.1.34954 WP_003899787.1.34960 WP_003899787.1.34961 WP_003899787.1.34963 WP_003899787.1.34965 WP_003899787.1.34968 WP_003899787.1.35023 WP_003899787.1.35069 WP_003899787.1.35072 WP_003899787.1.35078 WP_003899787.1.35100 WP_003899787.1.35146 WP_003899787.1.35156 WP_003899787.1.35160 WP_003899787.1.35162 WP_003899787.1.35173 WP_003899787.1.35176 WP_003899787.1.3520 WP_003899787.1.35213 WP_003899787.1.35221 WP_003899787.1.35246 WP_003899787.1.35278 WP_003899787.1.35301 WP_003899787.1.35311 WP_003899787.1.35312 WP_003899787.1.35317 WP_003899787.1.35319 WP_003899787.1.35347 WP_003899787.1.35363 WP_003899787.1.35382 WP_003899787.1.35385 WP_003899787.1.35396 WP_003899787.1.35397 WP_003899787.1.35426 WP_003899787.1.35439 WP_003899787.1.35455 WP_003899787.1.3548 WP_003899787.1.35484 WP_003899787.1.35492 WP_003899787.1.3553 WP_003899787.1.35553 WP_003899787.1.35555 WP_003899787.1.35561 WP_003899787.1.35602 WP_003899787.1.35610 WP_003899787.1.35635 WP_003899787.1.35657 WP_003899787.1.35680 WP_003899787.1.35687 WP_003899787.1.35689 WP_003899787.1.35707 WP_003899787.1.35732 WP_003899787.1.35754 WP_003899787.1.35767 WP_003899787.1.35770 WP_003899787.1.35771 WP_003899787.1.35780 WP_003899787.1.35805 WP_003899787.1.35811 WP_003899787.1.35821 WP_003899787.1.3584 WP_003899787.1.35848 WP_003899787.1.35864 WP_003899787.1.35874 WP_003899787.1.35876 WP_003899787.1.35897 WP_003899787.1.35899 WP_003899787.1.35923 WP_003899787.1.3593 WP_003899787.1.35954 WP_003899787.1.36005 WP_003899787.1.36014 WP_003899787.1.36023 WP_003899787.1.36051 WP_003899787.1.36053 WP_003899787.1.36075 WP_003899787.1.36089 WP_003899787.1.36097 WP_003899787.1.36098 WP_003899787.1.36116 WP_003899787.1.36145 WP_003899787.1.36156 WP_003899787.1.36205 WP_003899787.1.36228 WP_003899787.1.36246 WP_003899787.1.36252 WP_003899787.1.36260 WP_003899787.1.36270 WP_003899787.1.36271 WP_003899787.1.36303 WP_003899787.1.36309 WP_003899787.1.36315 WP_003899787.1.36319 WP_003899787.1.36321 WP_003899787.1.36326 WP_003899787.1.3634 WP_003899787.1.36356 WP_003899787.1.36357 WP_003899787.1.3636 WP_003899787.1.36385 WP_003899787.1.36399 WP_003899787.1.36436 WP_003899787.1.36465 WP_003899787.1.36469 WP_003899787.1.36473 WP_003899787.1.36485 WP_003899787.1.36508 WP_003899787.1.36540 WP_003899787.1.36561 WP_003899787.1.36571 WP_003899787.1.36573 WP_003899787.1.36578 WP_003899787.1.36585 WP_003899787.1.36597 WP_003899787.1.36614 WP_003899787.1.36657 WP_003899787.1.36674 WP_003899787.1.36720 WP_003899787.1.36727 WP_003899787.1.36733 WP_003899787.1.36785 WP_003899787.1.36810 WP_003899787.1.36844 WP_003899787.1.36851 WP_003899787.1.36862 WP_003899787.1.36893 WP_003899787.1.36901 WP_003899787.1.36921 WP_003899787.1.36935 WP_003899787.1.36941 WP_003899787.1.3695 WP_003899787.1.36951 WP_003899787.1.36968 WP_003899787.1.3700 WP_003899787.1.37004 WP_003899787.1.37012 WP_003899787.1.37071 WP_003899787.1.37088 WP_003899787.1.37131 WP_003899787.1.37157 WP_003899787.1.37175 WP_003899787.1.37188 WP_003899787.1.37213 WP_003899787.1.37229 WP_003899787.1.3724 WP_003899787.1.37277 WP_003899787.1.37305 WP_003899787.1.37330 WP_003899787.1.37389 WP_003899787.1.37400 WP_003899787.1.37440 WP_003899787.1.37459 WP_003899787.1.37468 WP_003899787.1.37475 WP_003899787.1.37484 WP_003899787.1.37601 WP_003899787.1.37612 WP_003899787.1.37632 WP_003899787.1.37643 WP_003899787.1.37655 WP_003899787.1.37660 WP_003899787.1.37674 WP_003899787.1.37700 WP_003899787.1.37701 WP_003899787.1.37709 WP_003899787.1.37711 WP_003899787.1.37721 WP_003899787.1.37722 WP_003899787.1.37747 WP_003899787.1.37765 WP_003899787.1.37772 WP_003899787.1.37804 WP_003899787.1.37809 WP_003899787.1.37859 WP_003899787.1.37877 WP_003899787.1.37912 WP_003899787.1.37913 WP_003899787.1.37950 WP_003899787.1.37973 WP_003899787.1.37975 WP_003899787.1.37983 WP_003899787.1.38 WP_003899787.1.38002 WP_003899787.1.3802 WP_003899787.1.38039 WP_003899787.1.38040 WP_003899787.1.38067 WP_003899787.1.38068 WP_003899787.1.38135 WP_003899787.1.38138 WP_003899787.1.38144 WP_003899787.1.38158 WP_003899787.1.38159 WP_003899787.1.38210 WP_003899787.1.38240 WP_003899787.1.38299 WP_003899787.1.38332 WP_003899787.1.38347 WP_003899787.1.38354 WP_003899787.1.38380 WP_003899787.1.38384 WP_003899787.1.38389 WP_003899787.1.38398 WP_003899787.1.38402 WP_003899787.1.38418 WP_003899787.1.38421 WP_003899787.1.38466 WP_003899787.1.38477 WP_003899787.1.38483 WP_003899787.1.3849 WP_003899787.1.385 WP_003899787.1.38530 WP_003899787.1.38535 WP_003899787.1.38539 WP_003899787.1.38594 WP_003899787.1.38601 WP_003899787.1.38611 WP_003899787.1.38638 WP_003899787.1.38639 WP_003899787.1.38646 WP_003899787.1.38648 WP_003899787.1.38654 WP_003899787.1.38659 WP_003899787.1.38660 WP_003899787.1.38666 WP_003899787.1.38671 WP_003899787.1.38672 WP_003899787.1.38750 WP_003899787.1.38772 WP_003899787.1.38812 WP_003899787.1.38821 WP_003899787.1.38844 WP_003899787.1.38863 WP_003899787.1.38865 WP_003899787.1.38873 WP_003899787.1.3889 WP_003899787.1.38894 WP_003899787.1.38909 WP_003899787.1.38939 WP_003899787.1.38974 WP_003899787.1.38975 WP_003899787.1.38991 WP_003899787.1.39025 WP_003899787.1.39070 WP_003899787.1.39072 WP_003899787.1.39095 WP_003899787.1.39106 WP_003899787.1.39165 WP_003899787.1.39174 WP_003899787.1.39176 WP_003899787.1.39178 WP_003899787.1.39190 WP_003899787.1.39201 WP_003899787.1.39207 WP_003899787.1.39211 WP_003899787.1.39236 WP_003899787.1.39239 WP_003899787.1.39252 WP_003899787.1.39288 WP_003899787.1.39295 WP_003899787.1.39306 WP_003899787.1.39359 WP_003899787.1.39364 WP_003899787.1.39447 WP_003899787.1.3945 WP_003899787.1.39455 WP_003899787.1.3949 WP_003899787.1.39521 WP_003899787.1.39560 WP_003899787.1.39592 WP_003899787.1.39593 WP_003899787.1.396 WP_003899787.1.3960 WP_003899787.1.39616 WP_003899787.1.39654 WP_003899787.1.39657 WP_003899787.1.39661 WP_003899787.1.39674 WP_003899787.1.39678 WP_003899787.1.3968 WP_003899787.1.39694 WP_003899787.1.3971 WP_003899787.1.39718 WP_003899787.1.39728 WP_003899787.1.39739 WP_003899787.1.39748 WP_003899787.1.39751 WP_003899787.1.39759 WP_003899787.1.39801 WP_003899787.1.39804 WP_003899787.1.39848 WP_003899787.1.39877 WP_003899787.1.39925 WP_003899787.1.3994 WP_003899787.1.39959 WP_003899787.1.3996 WP_003899787.1.39960 WP_003899787.1.3997 WP_003899787.1.39980 WP_003899787.1.40000 WP_003899787.1.40028 WP_003899787.1.40029 WP_003899787.1.4003 WP_003899787.1.40094 WP_003899787.1.40096 WP_003899787.1.40150 WP_003899787.1.40156 WP_003899787.1.40174 WP_003899787.1.40186 WP_003899787.1.40276 WP_003899787.1.40277 WP_003899787.1.40323 WP_003899787.1.40336 WP_003899787.1.40353 WP_003899787.1.4036 WP_003899787.1.40372 WP_003899787.1.40402 WP_003899787.1.40413 WP_003899787.1.40440 WP_003899787.1.40446 WP_003899787.1.40451 WP_003899787.1.40455 WP_003899787.1.40523 WP_003899787.1.40543 WP_003899787.1.40641 WP_003899787.1.40646 WP_003899787.1.40651 WP_003899787.1.40653 WP_003899787.1.4067 WP_003899787.1.40705 WP_003899787.1.40723 WP_003899787.1.40731 WP_003899787.1.40735 WP_003899787.1.40795 WP_003899787.1.40799 WP_003899787.1.40852 WP_003899787.1.40876 WP_003899787.1.40881 WP_003899787.1.40922 WP_003899787.1.40948 WP_003899787.1.4095 WP_003899787.1.40956 WP_003899787.1.40957 WP_003899787.1.40964 WP_003899787.1.4097 WP_003899787.1.410 WP_003899787.1.41000 WP_003899787.1.41055 WP_003899787.1.41108 WP_003899787.1.41123 WP_003899787.1.41177 WP_003899787.1.41202 WP_003899787.1.41219 WP_003899787.1.41231 WP_003899787.1.41249 WP_003899787.1.4127 WP_003899787.1.41296 WP_003899787.1.41355 WP_003899787.1.41376 WP_003899787.1.41430 WP_003899787.1.41447 WP_003899787.1.41469 WP_003899787.1.41504 WP_003899787.1.41553 WP_003899787.1.41564 WP_003899787.1.41583 WP_003899787.1.41616 WP_003899787.1.41632 WP_003899787.1.41635 WP_003899787.1.41636 WP_003899787.1.41648 WP_003899787.1.41660 WP_003899787.1.41685 WP_003899787.1.41695 WP_003899787.1.41704 WP_003899787.1.4171 WP_003899787.1.41719 WP_003899787.1.41733 WP_003899787.1.41744 WP_003899787.1.41774 WP_003899787.1.41791 WP_003899787.1.41803 WP_003899787.1.41820 WP_003899787.1.41828 WP_003899787.1.41829 WP_003899787.1.41860 WP_003899787.1.41912 WP_003899787.1.41921 WP_003899787.1.41933 WP_003899787.1.41944 WP_003899787.1.42043 WP_003899787.1.42075 WP_003899787.1.42078 WP_003899787.1.42094 WP_003899787.1.42112 WP_003899787.1.4212 WP_003899787.1.42122 WP_003899787.1.42134 WP_003899787.1.42183 WP_003899787.1.42188 WP_003899787.1.42201 WP_003899787.1.42202 WP_003899787.1.42208 WP_003899787.1.42247 WP_003899787.1.42255 WP_003899787.1.42273 WP_003899787.1.42278 WP_003899787.1.42304 WP_003899787.1.42309 WP_003899787.1.42370 WP_003899787.1.42385 WP_003899787.1.42400 WP_003899787.1.42409 WP_003899787.1.42414 WP_003899787.1.42417 WP_003899787.1.42430 WP_003899787.1.42461 WP_003899787.1.42465 WP_003899787.1.42467 WP_003899787.1.42473 WP_003899787.1.42474 WP_003899787.1.4248 WP_003899787.1.42494 WP_003899787.1.42519 WP_003899787.1.42524 WP_003899787.1.42534 WP_003899787.1.4255 WP_003899787.1.42562 WP_003899787.1.42568 WP_003899787.1.42570 WP_003899787.1.42618 WP_003899787.1.42660 WP_003899787.1.42695 WP_003899787.1.42704 WP_003899787.1.42705 WP_003899787.1.42722 WP_003899787.1.42777 WP_003899787.1.42782 WP_003899787.1.42835 WP_003899787.1.42839 WP_003899787.1.42842 WP_003899787.1.42905 WP_003899787.1.42916 WP_003899787.1.42930 WP_003899787.1.42971 WP_003899787.1.43005 WP_003899787.1.43009 WP_003899787.1.43053 WP_003899787.1.43082 WP_003899787.1.43087 WP_003899787.1.43098 WP_003899787.1.43208 WP_003899787.1.43236 WP_003899787.1.43246 WP_003899787.1.43255 WP_003899787.1.43266 WP_003899787.1.43269 WP_003899787.1.43273 WP_003899787.1.43296 WP_003899787.1.43306 WP_003899787.1.43368 WP_003899787.1.43395 WP_003899787.1.43457 WP_003899787.1.43462 WP_003899787.1.43475 WP_003899787.1.43478 WP_003899787.1.43484 WP_003899787.1.43557 WP_003899787.1.43578 WP_003899787.1.43588 WP_003899787.1.43643 WP_003899787.1.43664 WP_003899787.1.43684 WP_003899787.1.43686 WP_003899787.1.43706 WP_003899787.1.43716 WP_003899787.1.4377 WP_003899787.1.43781 WP_003899787.1.43794 WP_003899787.1.43815 WP_003899787.1.43846 WP_003899787.1.43861 WP_003899787.1.43866 WP_003899787.1.43872 WP_003899787.1.43885 WP_003899787.1.43897 WP_003899787.1.4390 WP_003899787.1.43902 WP_003899787.1.43921 WP_003899787.1.43936 WP_003899787.1.43937 WP_003899787.1.43960 WP_003899787.1.43965 WP_003899787.1.4399 WP_003899787.1.43993 WP_003899787.1.43996 WP_003899787.1.44 WP_003899787.1.44001 WP_003899787.1.44008 WP_003899787.1.44016 WP_003899787.1.44033 WP_003899787.1.44037 WP_003899787.1.44041 WP_003899787.1.44070 WP_003899787.1.44071 WP_003899787.1.44076 WP_003899787.1.44104 WP_003899787.1.44111 WP_003899787.1.44124 WP_003899787.1.44169 WP_003899787.1.44219 WP_003899787.1.44237 WP_003899787.1.44277 WP_003899787.1.44279 WP_003899787.1.44336 WP_003899787.1.44355 WP_003899787.1.44358 WP_003899787.1.4438 WP_003899787.1.44390 WP_003899787.1.44392 WP_003899787.1.4441 WP_003899787.1.44415 WP_003899787.1.44464 WP_003899787.1.44466 WP_003899787.1.44489 WP_003899787.1.44492 WP_003899787.1.44494 WP_003899787.1.44500 WP_003899787.1.44519 WP_003899787.1.44526 WP_003899787.1.44532 WP_003899787.1.44534 WP_003899787.1.44562 WP_003899787.1.44589 WP_003899787.1.44597 WP_003899787.1.44600 WP_003899787.1.44602 WP_003899787.1.44615 WP_003899787.1.4464 WP_003899787.1.44651 WP_003899787.1.44659 WP_003899787.1.44665 WP_003899787.1.44694 WP_003899787.1.44700 WP_003899787.1.44713 WP_003899787.1.44735 WP_003899787.1.44740 WP_003899787.1.44757 WP_003899787.1.4476 WP_003899787.1.44761 WP_003899787.1.44767 WP_003899787.1.44776 WP_003899787.1.44779 WP_003899787.1.44786 WP_003899787.1.44808 WP_003899787.1.44864 WP_003899787.1.44901 WP_003899787.1.44908 WP_003899787.1.44913 WP_003899787.1.4492 WP_003899787.1.44939 WP_003899787.1.44979 WP_003899787.1.44981 WP_003899787.1.45002 WP_003899787.1.4504 WP_003899787.1.45062 WP_003899787.1.45066 WP_003899787.1.45081 WP_003899787.1.45113 WP_003899787.1.45129 WP_003899787.1.45135 WP_003899787.1.45147 WP_003899787.1.45168 WP_003899787.1.4517 WP_003899787.1.45181 WP_003899787.1.45185 WP_003899787.1.45192 WP_003899787.1.45200 WP_003899787.1.45205 WP_003899787.1.45211 WP_003899787.1.45249 WP_003899787.1.4526 WP_003899787.1.45286 WP_003899787.1.45326 WP_003899787.1.45347 WP_003899787.1.45374 WP_003899787.1.45390 WP_003899787.1.454 WP_003899787.1.45407 WP_003899787.1.45451 WP_003899787.1.45453 WP_003899787.1.45460 WP_003899787.1.45463 WP_003899787.1.45470 WP_003899787.1.45474 WP_003899787.1.45491 WP_003899787.1.45510 WP_003899787.1.45563 WP_003899787.1.45584 WP_003899787.1.45590 WP_003899787.1.45619 WP_003899787.1.45626 WP_003899787.1.45631 WP_003899787.1.45666 WP_003899787.1.45697 WP_003899787.1.4571 WP_003899787.1.45731 WP_003899787.1.45743 WP_003899787.1.45765 WP_003899787.1.45776 WP_003899787.1.45783 WP_003899787.1.45805 WP_003899787.1.45815 WP_003899787.1.45849 WP_003899787.1.45884 WP_003899787.1.4590 WP_003899787.1.45923 WP_003899787.1.45926 WP_003899787.1.45963 WP_003899787.1.45989 WP_003899787.1.45992 WP_003899787.1.46025 WP_003899787.1.46083 WP_003899787.1.46090 WP_003899787.1.46092 WP_003899787.1.46100 WP_003899787.1.46101 WP_003899787.1.46103 WP_003899787.1.46107 WP_003899787.1.46127 WP_003899787.1.46128 WP_003899787.1.46129 WP_003899787.1.46141 WP_003899787.1.46150 WP_003899787.1.46201 WP_003899787.1.46226 WP_003899787.1.4624 WP_003899787.1.46253 WP_003899787.1.46268 WP_003899787.1.46285 WP_003899787.1.46300 WP_003899787.1.46313 WP_003899787.1.46336 WP_003899787.1.46365 WP_003899787.1.46370 WP_003899787.1.46381 WP_003899787.1.46402 WP_003899787.1.46411 WP_003899787.1.4644 WP_003899787.1.46442 WP_003899787.1.46453 WP_003899787.1.46463 WP_003899787.1.46478 WP_003899787.1.46492 WP_003899787.1.46521 WP_003899787.1.4653 WP_003899787.1.46532 WP_003899787.1.46539 WP_003899787.1.46568 WP_003899787.1.46585 WP_003899787.1.46609 WP_003899787.1.46613 WP_003899787.1.46625 WP_003899787.1.46642 WP_003899787.1.46647 WP_003899787.1.46674 WP_003899787.1.46724 WP_003899787.1.46758 WP_003899787.1.46773 WP_003899787.1.46777 WP_003899787.1.46786 WP_003899787.1.46792 WP_003899787.1.46847 WP_003899787.1.46851 WP_003899787.1.4687 WP_003899787.1.46897 WP_003899787.1.46936 WP_003899787.1.46980 WP_003899787.1.47011 WP_003899787.1.47012 WP_003899787.1.47066 WP_003899787.1.47077 WP_003899787.1.47083 WP_003899787.1.47106 WP_003899787.1.47142 WP_003899787.1.47166 WP_003899787.1.47178 WP_003899787.1.47179 WP_003899787.1.47194 WP_003899787.1.47207 WP_003899787.1.47210 WP_003899787.1.47261 WP_003899787.1.47262 WP_003899787.1.47402 WP_003899787.1.47423 WP_003899787.1.47467 WP_003899787.1.47502 WP_003899787.1.4751 WP_003899787.1.47511 WP_003899787.1.47537 WP_003899787.1.47540 WP_003899787.1.47568 WP_003899787.1.47572 WP_003899787.1.47588 WP_003899787.1.47636 WP_003899787.1.4764 WP_003899787.1.47653 WP_003899787.1.47679 WP_003899787.1.47681 WP_003899787.1.47690 WP_003899787.1.4771 WP_003899787.1.47717 WP_003899787.1.47743 WP_003899787.1.47754 WP_003899787.1.47773 WP_003899787.1.47776 WP_003899787.1.47780 WP_003899787.1.47805 WP_003899787.1.47832 WP_003899787.1.47847 WP_003899787.1.47858 WP_003899787.1.47861 WP_003899787.1.47868 WP_003899787.1.47893 WP_003899787.1.47899 WP_003899787.1.479 WP_003899787.1.47912 WP_003899787.1.47913 WP_003899787.1.47926 WP_003899787.1.4794 WP_003899787.1.47943 WP_003899787.1.47944 WP_003899787.1.47959 WP_003899787.1.47974 WP_003899787.1.47993 WP_003899787.1.48004 WP_003899787.1.48039 WP_003899787.1.48050 WP_003899787.1.48084 WP_003899787.1.48097 WP_003899787.1.48101 WP_003899787.1.48109 WP_003899787.1.4813 WP_003899787.1.48130 WP_003899787.1.48135 WP_003899787.1.48143 WP_003899787.1.48152 WP_003899787.1.48155 WP_003899787.1.48170 WP_003899787.1.48173 WP_003899787.1.48177 WP_003899787.1.48185 WP_003899787.1.48204 WP_003899787.1.48219 WP_003899787.1.4823 WP_003899787.1.48240 WP_003899787.1.48256 WP_003899787.1.48264 WP_003899787.1.48287 WP_003899787.1.48330 WP_003899787.1.48333 WP_003899787.1.48348 WP_003899787.1.48354 WP_003899787.1.48372 WP_003899787.1.48383 WP_003899787.1.48388 WP_003899787.1.48419 WP_003899787.1.48423 WP_003899787.1.48443 WP_003899787.1.48450 WP_003899787.1.48462 WP_003899787.1.48543 WP_003899787.1.48550 WP_003899787.1.48605 WP_003899787.1.48618 WP_003899787.1.4863 WP_003899787.1.48648 WP_003899787.1.48658 WP_003899787.1.48666 WP_003899787.1.48687 WP_003899787.1.48779 WP_003899787.1.4878 WP_003899787.1.48798 WP_003899787.1.48802 WP_003899787.1.48826 WP_003899787.1.48831 WP_003899787.1.48843 WP_003899787.1.48857 WP_003899787.1.4890 WP_003899787.1.48946 WP_003899787.1.48979 WP_003899787.1.49017 WP_003899787.1.49048 WP_003899787.1.49059 WP_003899787.1.4906 WP_003899787.1.4907 WP_003899787.1.49103 WP_003899787.1.49110 WP_003899787.1.49111 WP_003899787.1.49112 WP_003899787.1.4919 WP_003899787.1.49251 WP_003899787.1.49254 WP_003899787.1.49263 WP_003899787.1.49291 WP_003899787.1.49296 WP_003899787.1.49335 WP_003899787.1.49337 WP_003899787.1.49419 WP_003899787.1.49426 WP_003899787.1.49437 WP_003899787.1.49439 WP_003899787.1.49474 WP_003899787.1.49506 WP_003899787.1.49516 WP_003899787.1.49523 WP_003899787.1.49526 WP_003899787.1.49532 WP_003899787.1.49588 WP_003899787.1.4959 WP_003899787.1.49678 WP_003899787.1.49687 WP_003899787.1.49699 WP_003899787.1.49709 WP_003899787.1.4971 WP_003899787.1.4972 WP_003899787.1.49736 WP_003899787.1.49746 WP_003899787.1.49764 WP_003899787.1.49773 WP_003899787.1.49796 WP_003899787.1.49814 WP_003899787.1.49815 WP_003899787.1.49816 WP_003899787.1.49839 WP_003899787.1.49857 WP_003899787.1.49878 WP_003899787.1.49880 WP_003899787.1.49944 WP_003899787.1.4999 WP_003899787.1.49990 WP_003899787.1.50068 WP_003899787.1.50077 WP_003899787.1.5008 WP_003899787.1.50081 WP_003899787.1.50122 WP_003899787.1.50126 WP_003899787.1.50149 WP_003899787.1.50162 WP_003899787.1.5018 WP_003899787.1.50218 WP_003899787.1.50235 WP_003899787.1.50249 WP_003899787.1.50265 WP_003899787.1.50271 WP_003899787.1.50324 WP_003899787.1.50347 WP_003899787.1.50372 WP_003899787.1.50398 WP_003899787.1.50407 WP_003899787.1.50444 WP_003899787.1.50466 WP_003899787.1.50472 WP_003899787.1.5048 WP_003899787.1.50498 WP_003899787.1.5050 WP_003899787.1.50540 WP_003899787.1.50554 WP_003899787.1.50557 WP_003899787.1.50601 WP_003899787.1.50610 WP_003899787.1.50632 WP_003899787.1.50633 WP_003899787.1.50642 WP_003899787.1.50655 WP_003899787.1.50683 WP_003899787.1.50689 WP_003899787.1.50692 WP_003899787.1.50714 WP_003899787.1.50729 WP_003899787.1.50756 WP_003899787.1.50784 WP_003899787.1.50794 WP_003899787.1.50841 WP_003899787.1.50860 WP_003899787.1.50868 WP_003899787.1.50877 WP_003899787.1.5096 WP_003899787.1.50981 WP_003899787.1.50987 WP_003899787.1.51003 WP_003899787.1.51009 WP_003899787.1.51037 WP_003899787.1.51074 WP_003899787.1.51082 WP_003899787.1.51101 WP_003899787.1.51116 WP_003899787.1.51149 WP_003899787.1.51156 WP_003899787.1.51157 WP_003899787.1.51213 WP_003899787.1.51232 WP_003899787.1.51239 WP_003899787.1.51247 WP_003899787.1.51266 WP_003899787.1.51279 WP_003899787.1.51291 WP_003899787.1.51294 WP_003899787.1.51301 WP_003899787.1.51391 WP_003899787.1.51422 WP_003899787.1.51445 WP_003899787.1.51455 WP_003899787.1.51466 WP_003899787.1.51468 WP_003899787.1.51478 WP_003899787.1.51497 WP_003899787.1.51520 WP_003899787.1.51593 WP_003899787.1.51628 WP_003899787.1.5164 WP_003899787.1.51647 WP_003899787.1.51660 WP_003899787.1.51696 WP_003899787.1.51721 WP_003899787.1.51788 WP_003899787.1.51795 WP_003899787.1.51801 WP_003899787.1.51817 WP_003899787.1.51819 WP_003899787.1.51854 WP_003899787.1.51923 WP_003899787.1.51942 WP_003899787.1.51948 WP_003899787.1.51963 WP_003899787.1.51969 WP_003899787.1.52000 WP_003899787.1.52001 WP_003899787.1.52003 WP_003899787.1.52006 WP_003899787.1.52036 WP_003899787.1.52038 WP_003899787.1.52046 WP_003899787.1.52059 WP_003899787.1.52069 WP_003899787.1.52082 WP_003899787.1.52102 WP_003899787.1.52106 WP_003899787.1.52166 WP_003899787.1.52168 WP_003899787.1.52173 WP_003899787.1.52178 WP_003899787.1.52206 WP_003899787.1.52216 WP_003899787.1.52238 WP_003899787.1.52241 WP_003899787.1.52280 WP_003899787.1.52314 WP_003899787.1.52385 WP_003899787.1.52390 WP_003899787.1.524 WP_003899787.1.52460 WP_003899787.1.52485 WP_003899787.1.52486 WP_003899787.1.52495 WP_003899787.1.52504 WP_003899787.1.52522 WP_003899787.1.52531 WP_003899787.1.52533 WP_003899787.1.52545 WP_003899787.1.52553 WP_003899787.1.52563 WP_003899787.1.52564 WP_003899787.1.52574 WP_003899787.1.52641 WP_003899787.1.52673 WP_003899787.1.52674 WP_003899787.1.52708 WP_003899787.1.52713 WP_003899787.1.52761 WP_003899787.1.52778 WP_003899787.1.52791 WP_003899787.1.52797 WP_003899787.1.52818 WP_003899787.1.52872 WP_003899787.1.52873 WP_003899787.1.52891 WP_003899787.1.52892 WP_003899787.1.52909 WP_003899787.1.52970 WP_003899787.1.52998 WP_003899787.1.53053 WP_003899787.1.53056 WP_003899787.1.5306 WP_003899787.1.53088 WP_003899787.1.5309 WP_003899787.1.531 WP_003899787.1.53117 WP_003899787.1.53118 WP_003899787.1.53142 WP_003899787.1.53143 WP_003899787.1.53157 WP_003899787.1.53167 WP_003899787.1.53200 WP_003899787.1.53204 WP_003899787.1.53213 WP_003899787.1.53217 WP_003899787.1.53226 WP_003899787.1.53229 WP_003899787.1.53230 WP_003899787.1.53237 WP_003899787.1.53254 WP_003899787.1.53257 WP_003899787.1.5327 WP_003899787.1.53276 WP_003899787.1.53278 WP_003899787.1.533 WP_003899787.1.53302 WP_003899787.1.53306 WP_003899787.1.5334 WP_003899787.1.5335 WP_003899787.1.53353 WP_003899787.1.53381 WP_003899787.1.53413 WP_003899787.1.53458 WP_003899787.1.53460 WP_003899787.1.53480 WP_003899787.1.53517 WP_003899787.1.53522 WP_003899787.1.53525 WP_003899787.1.53526 WP_003899787.1.53553 WP_003899787.1.53606 WP_003899787.1.53609 WP_003899787.1.53628 WP_003899787.1.53643 WP_003899787.1.53667 WP_003899787.1.53679 WP_003899787.1.53715 WP_003899787.1.53730 WP_003899787.1.53742 WP_003899787.1.53743 WP_003899787.1.53754 WP_003899787.1.53775 WP_003899787.1.53787 WP_003899787.1.53803 WP_003899787.1.53818 WP_003899787.1.53822 WP_003899787.1.53853 WP_003899787.1.53865 WP_003899787.1.53888 WP_003899787.1.53900 WP_003899787.1.53912 WP_003899787.1.53914 WP_003899787.1.53952 WP_003899787.1.53973 WP_003899787.1.5398 WP_003899787.1.5408 WP_003899787.1.54089 WP_003899787.1.54093 WP_003899787.1.54099 WP_003899787.1.54112 WP_003899787.1.54125 WP_003899787.1.54141 WP_003899787.1.54162 WP_003899787.1.54179 WP_003899787.1.54206 WP_003899787.1.54218 WP_003899787.1.54225 WP_003899787.1.54227 WP_003899787.1.54232 WP_003899787.1.54241 WP_003899787.1.54245 WP_003899787.1.54247 WP_003899787.1.54260 WP_003899787.1.54275 WP_003899787.1.54280 WP_003899787.1.5429 WP_003899787.1.54294 WP_003899787.1.54314 WP_003899787.1.54347 WP_003899787.1.54351 WP_003899787.1.54370 WP_003899787.1.54428 WP_003899787.1.54449 WP_003899787.1.54494 WP_003899787.1.54502 WP_003899787.1.54514 WP_003899787.1.54519 WP_003899787.1.5452 WP_003899787.1.54531 WP_003899787.1.54537 WP_003899787.1.54553 WP_003899787.1.54555 WP_003899787.1.54575 WP_003899787.1.54633 WP_003899787.1.54686 WP_003899787.1.54687 WP_003899787.1.54705 WP_003899787.1.54730 WP_003899787.1.54732 WP_003899787.1.5475 WP_003899787.1.54797 WP_003899787.1.54807 WP_003899787.1.54836 WP_003899787.1.54838 WP_003899787.1.54860 WP_003899787.1.54888 WP_003899787.1.54897 WP_003899787.1.54905 WP_003899787.1.54909 WP_003899787.1.54937 WP_003899787.1.54939 WP_003899787.1.54944 WP_003899787.1.54945 WP_003899787.1.54953 WP_003899787.1.54964 WP_003899787.1.55015 WP_003899787.1.55022 WP_003899787.1.55023 WP_003899787.1.55051 WP_003899787.1.55072 WP_003899787.1.55088 WP_003899787.1.55106 WP_003899787.1.55126 WP_003899787.1.55128 WP_003899787.1.55140 WP_003899787.1.55150 WP_003899787.1.55210 WP_003899787.1.55227 WP_003899787.1.55248 WP_003899787.1.55257 WP_003899787.1.55258 WP_003899787.1.55267 WP_003899787.1.55279 WP_003899787.1.55307 WP_003899787.1.55326 WP_003899787.1.55328 WP_003899787.1.5533 WP_003899787.1.55345 WP_003899787.1.55396 WP_003899787.1.55398 WP_003899787.1.55441 WP_003899787.1.55459 WP_003899787.1.55501 WP_003899787.1.55504 WP_003899787.1.55578 WP_003899787.1.55626 WP_003899787.1.55641 WP_003899787.1.5569 WP_003899787.1.55723 WP_003899787.1.55735 WP_003899787.1.5574 WP_003899787.1.55772 WP_003899787.1.55802 WP_003899787.1.55807 WP_003899787.1.55819 WP_003899787.1.55821 WP_003899787.1.5583 WP_003899787.1.55849 WP_003899787.1.55856 WP_003899787.1.55860 WP_003899787.1.55882 WP_003899787.1.55883 WP_003899787.1.55894 WP_003899787.1.55902 WP_003899787.1.55908 WP_003899787.1.55909 WP_003899787.1.5591 WP_003899787.1.55961 WP_003899787.1.55977 WP_003899787.1.55983 WP_003899787.1.56028 WP_003899787.1.56057 WP_003899787.1.56060 WP_003899787.1.56107 WP_003899787.1.56132 WP_003899787.1.56163 WP_003899787.1.56167 WP_003899787.1.56178 WP_003899787.1.56287 WP_003899787.1.56292 WP_003899787.1.56327 WP_003899787.1.56341 WP_003899787.1.56359 WP_003899787.1.56365 WP_003899787.1.56394 WP_003899787.1.56443 WP_003899787.1.56473 WP_003899787.1.56478 WP_003899787.1.56500 WP_003899787.1.56517 WP_003899787.1.56534 WP_003899787.1.5656 WP_003899787.1.56577 WP_003899787.1.56593 WP_003899787.1.56625 WP_003899787.1.56637 WP_003899787.1.56670 WP_003899787.1.56697 WP_003899787.1.567 WP_003899787.1.56701 WP_003899787.1.56709 WP_003899787.1.56729 WP_003899787.1.56743 WP_003899787.1.56755 WP_003899787.1.56764 WP_003899787.1.56769 WP_003899787.1.56770 WP_003899787.1.56795 WP_003899787.1.5681 WP_003899787.1.56827 WP_003899787.1.56839 WP_003899787.1.56863 WP_003899787.1.56868 WP_003899787.1.56869 WP_003899787.1.56915 WP_003899787.1.56926 WP_003899787.1.56961 WP_003899787.1.56971 WP_003899787.1.56972 WP_003899787.1.57023 WP_003899787.1.57035 WP_003899787.1.57077 WP_003899787.1.57087 WP_003899787.1.57094 WP_003899787.1.57134 WP_003899787.1.57151 WP_003899787.1.57169 WP_003899787.1.57208 WP_003899787.1.57212 WP_003899787.1.57230 WP_003899787.1.5724 WP_003899787.1.5725 WP_003899787.1.5727 WP_003899787.1.57273 WP_003899787.1.573 WP_003899787.1.57326 WP_003899787.1.57328 WP_003899787.1.57331 WP_003899787.1.57340 WP_003899787.1.57351 WP_003899787.1.57352 WP_003899787.1.57380 WP_003899787.1.57430 WP_003899787.1.5744 WP_003899787.1.57440 WP_003899787.1.5745 WP_003899787.1.57461 WP_003899787.1.57469 WP_003899787.1.57489 WP_003899787.1.575 WP_003899787.1.57509 WP_003899787.1.57519 WP_003899787.1.57525 WP_003899787.1.57551 WP_003899787.1.5758 WP_003899787.1.57596 WP_003899787.1.57604 WP_003899787.1.57616 WP_003899787.1.57617 WP_003899787.1.57619 WP_003899787.1.57627 WP_003899787.1.57642 WP_003899787.1.57667 WP_003899787.1.57675 WP_003899787.1.57689 WP_003899787.1.57708 WP_003899787.1.57794 WP_003899787.1.57821 WP_003899787.1.57825 WP_003899787.1.57843 WP_003899787.1.57906 WP_003899787.1.57924 WP_003899787.1.57926 WP_003899787.1.57930 WP_003899787.1.57957 WP_003899787.1.57960 WP_003899787.1.57964 WP_003899787.1.57991 WP_003899787.1.58000 WP_003899787.1.58086 WP_003899787.1.58101 WP_003899787.1.58103 WP_003899787.1.58108 WP_003899787.1.5811 WP_003899787.1.58121 WP_003899787.1.58145 WP_003899787.1.58164 WP_003899787.1.58174 WP_003899787.1.582 WP_003899787.1.58202 WP_003899787.1.58209 WP_003899787.1.58215 WP_003899787.1.5824 WP_003899787.1.58250 WP_003899787.1.58259 WP_003899787.1.58283 WP_003899787.1.58288 WP_003899787.1.5830 WP_003899787.1.58303 WP_003899787.1.58311 WP_003899787.1.58330 WP_003899787.1.58359 WP_003899787.1.58386 WP_003899787.1.58393 WP_003899787.1.58431 WP_003899787.1.5844 WP_003899787.1.58457 WP_003899787.1.58488 WP_003899787.1.58518 WP_003899787.1.58534 WP_003899787.1.58559 WP_003899787.1.58567 WP_003899787.1.58573 WP_003899787.1.58602 WP_003899787.1.58612 WP_003899787.1.58619 WP_003899787.1.58630 WP_003899787.1.5865 WP_003899787.1.58671 WP_003899787.1.58690 WP_003899787.1.58702 WP_003899787.1.58743 WP_003899787.1.58754 WP_003899787.1.5879 WP_003899787.1.5881 WP_003899787.1.58848 WP_003899787.1.58857 WP_003899787.1.58891 WP_003899787.1.58892 WP_003899787.1.5890 WP_003899787.1.58921 WP_003899787.1.58930 WP_003899787.1.58939 WP_003899787.1.58941 WP_003899787.1.58953 WP_003899787.1.58961 WP_003899787.1.5898 WP_003899787.1.59025 WP_003899787.1.59029 WP_003899787.1.59037 WP_003899787.1.59044 WP_003899787.1.59085 WP_003899787.1.59088 WP_003899787.1.59112 WP_003899787.1.59130 WP_003899787.1.5914 WP_003899787.1.59147 WP_003899787.1.59166 WP_003899787.1.59205 WP_003899787.1.59209 WP_003899787.1.59237 WP_003899787.1.59240 WP_003899787.1.59253 WP_003899787.1.59254 WP_003899787.1.59262 WP_003899787.1.59270 WP_003899787.1.5928 WP_003899787.1.59304 WP_003899787.1.59305 WP_003899787.1.59309 WP_003899787.1.59316 WP_003899787.1.59326 WP_003899787.1.59328 WP_003899787.1.59333 WP_003899787.1.59338 WP_003899787.1.59388 WP_003899787.1.59428 WP_003899787.1.59487 WP_003899787.1.59537 WP_003899787.1.59561 WP_003899787.1.59722 WP_003899787.1.59727 WP_003899787.1.59732 WP_003899787.1.59738 WP_003899787.1.59750 WP_003899787.1.59757 WP_003899787.1.59761 WP_003899787.1.59808 WP_003899787.1.59850 WP_003899787.1.59856 WP_003899787.1.59860 WP_003899787.1.59861 WP_003899787.1.5987 WP_003899787.1.59878 WP_003899787.1.59888 WP_003899787.1.59952 WP_003899787.1.5996 WP_003899787.1.59961 WP_003899787.1.59974 WP_003899787.1.6000 WP_003899787.1.60007 WP_003899787.1.60016 WP_003899787.1.6003 WP_003899787.1.60047 WP_003899787.1.6007 WP_003899787.1.60091 WP_003899787.1.60121 WP_003899787.1.60125 WP_003899787.1.60135 WP_003899787.1.60139 WP_003899787.1.60152 WP_003899787.1.60171 WP_003899787.1.60197 WP_003899787.1.6020 WP_003899787.1.60205 WP_003899787.1.60207 WP_003899787.1.60215 WP_003899787.1.60217 WP_003899787.1.60267 WP_003899787.1.60288 WP_003899787.1.60291 WP_003899787.1.60301 WP_003899787.1.60305 WP_003899787.1.60312 WP_003899787.1.60313 WP_003899787.1.60314 WP_003899787.1.60367 WP_003899787.1.60376 WP_003899787.1.60403 WP_003899787.1.60413 WP_003899787.1.60421 WP_003899787.1.60451 WP_003899787.1.60460 WP_003899787.1.60479 WP_003899787.1.60487 WP_003899787.1.60512 WP_003899787.1.60573 WP_003899787.1.60583 WP_003899787.1.60632 WP_003899787.1.60657 WP_003899787.1.60687 WP_003899787.1.60689 WP_003899787.1.60727 WP_003899787.1.60738 WP_003899787.1.60763 WP_003899787.1.6077 WP_003899787.1.60791 WP_003899787.1.60834 WP_003899787.1.60870 WP_003899787.1.60878 WP_003899787.1.60879 WP_003899787.1.60913 WP_003899787.1.60978 WP_003899787.1.61000 WP_003899787.1.61001 WP_003899787.1.61012 WP_003899787.1.61014 WP_003899787.1.61015 WP_003899787.1.61037 WP_003899787.1.61052 WP_003899787.1.61065 WP_003899787.1.61100 WP_003899787.1.61101 WP_003899787.1.61138 WP_003899787.1.61142 WP_003899787.1.61198 WP_003899787.1.612 WP_003899787.1.61234 WP_003899787.1.61256 WP_003899787.1.61281 WP_003899787.1.61314 WP_003899787.1.61321 WP_003899787.1.61326 WP_003899787.1.61328 WP_003899787.1.61368 WP_003899787.1.61391 WP_003899787.1.61406 WP_003899787.1.61409 WP_003899787.1.61420 WP_003899787.1.61422 WP_003899787.1.61425 WP_003899787.1.61428 WP_003899787.1.61469 WP_003899787.1.61494 WP_003899787.1.61522 WP_003899787.1.61552 WP_003899787.1.61557 WP_003899787.1.61567 WP_003899787.1.61571 WP_003899787.1.61573 WP_003899787.1.61584 WP_003899787.1.61586 WP_003899787.1.6159 WP_003899787.1.61592 WP_003899787.1.6160 WP_003899787.1.61614 WP_003899787.1.6163 WP_003899787.1.61655 WP_003899787.1.61665 WP_003899787.1.61669 WP_003899787.1.61682 WP_003899787.1.61692 WP_003899787.1.61719 WP_003899787.1.61728 WP_003899787.1.61750 WP_003899787.1.61754 WP_003899787.1.61755 WP_003899787.1.61757 WP_003899787.1.61778 WP_003899787.1.6179 WP_003899787.1.61793 WP_003899787.1.61816 WP_003899787.1.61842 WP_003899787.1.61850 WP_003899787.1.61862 WP_003899787.1.61865 WP_003899787.1.61911 WP_003899787.1.61925 WP_003899787.1.61941 WP_003899787.1.61953 WP_003899787.1.61979 WP_003899787.1.61987 WP_003899787.1.61998 WP_003899787.1.62021 WP_003899787.1.62087 WP_003899787.1.62089 WP_003899787.1.62101 WP_003899787.1.62104 WP_003899787.1.6211 WP_003899787.1.62132 WP_003899787.1.62162 WP_003899787.1.62225 WP_003899787.1.62230 WP_003899787.1.62238 WP_003899787.1.62249 WP_003899787.1.62270 WP_003899787.1.62281 WP_003899787.1.62307 WP_003899787.1.6231 WP_003899787.1.62359 WP_003899787.1.62360 WP_003899787.1.62371 WP_003899787.1.62379 WP_003899787.1.62395 WP_003899787.1.62408 WP_003899787.1.62449 WP_003899787.1.62468 WP_003899787.1.6248 WP_003899787.1.62508 WP_003899787.1.62565 WP_003899787.1.62594 WP_003899787.1.62606 WP_003899787.1.62616 WP_003899787.1.62666 WP_003899787.1.62687 WP_003899787.1.62715 WP_003899787.1.62730 WP_003899787.1.62738 WP_003899787.1.62761 WP_003899787.1.62766 WP_003899787.1.62786 WP_003899787.1.62839 WP_003899787.1.62841 WP_003899787.1.62909 WP_003899787.1.62936 WP_003899787.1.6294 WP_003899787.1.6295 WP_003899787.1.62962 WP_003899787.1.63007 WP_003899787.1.63019 WP_003899787.1.63032 WP_003899787.1.63037 WP_003899787.1.63064 WP_003899787.1.63066 WP_003899787.1.63072 WP_003899787.1.6308 WP_003899787.1.63081 WP_003899787.1.63096 WP_003899787.1.63106 WP_003899787.1.6314 WP_003899787.1.63144 WP_003899787.1.63154 WP_003899787.1.63160 WP_003899787.1.63161 WP_003899787.1.63166 WP_003899787.1.63175 WP_003899787.1.63194 WP_003899787.1.6322 WP_003899787.1.63222 WP_003899787.1.63247 WP_003899787.1.6328 WP_003899787.1.63291 WP_003899787.1.63312 WP_003899787.1.63317 WP_003899787.1.63373 WP_003899787.1.63384 WP_003899787.1.63403 WP_003899787.1.63424 WP_003899787.1.6345 WP_003899787.1.63464 WP_003899787.1.63483 WP_003899787.1.63502 WP_003899787.1.63504 WP_003899787.1.63522 WP_003899787.1.63530 WP_003899787.1.63538 WP_003899787.1.63564 WP_003899787.1.63567 WP_003899787.1.63596 WP_003899787.1.63600 WP_003899787.1.63623 WP_003899787.1.63624 WP_003899787.1.63625 WP_003899787.1.63627 WP_003899787.1.63654 WP_003899787.1.63662 WP_003899787.1.63711 WP_003899787.1.63734 WP_003899787.1.63807 WP_003899787.1.63819 WP_003899787.1.63844 WP_003899787.1.63888 WP_003899787.1.63913 WP_003899787.1.63915 WP_003899787.1.63918 WP_003899787.1.63961 WP_003899787.1.63970 WP_003899787.1.64000 WP_003899787.1.64027 WP_003899787.1.64058 WP_003899787.1.64065 WP_003899787.1.6407 WP_003899787.1.64082 WP_003899787.1.64091 WP_003899787.1.64102 WP_003899787.1.64104 WP_003899787.1.64119 WP_003899787.1.64169 WP_003899787.1.64219 WP_003899787.1.6422 WP_003899787.1.64222 WP_003899787.1.64223 WP_003899787.1.64228 WP_003899787.1.64235 WP_003899787.1.64249 WP_003899787.1.6427 WP_003899787.1.64278 WP_003899787.1.64287 WP_003899787.1.64414 WP_003899787.1.64419 WP_003899787.1.6443 WP_003899787.1.64463 WP_003899787.1.64480 WP_003899787.1.64497 WP_003899787.1.64506 WP_003899787.1.64511 WP_003899787.1.64513 WP_003899787.1.64514 WP_003899787.1.64515 WP_003899787.1.64522 WP_003899787.1.64526 WP_003899787.1.64543 WP_003899787.1.6456 WP_003899787.1.64567 WP_003899787.1.64588 WP_003899787.1.64589 WP_003899787.1.64594 WP_003899787.1.64595 WP_003899787.1.64608 WP_003899787.1.64619 WP_003899787.1.64629 WP_003899787.1.6464 WP_003899787.1.64664 WP_003899787.1.64669 WP_003899787.1.64672 WP_003899787.1.64680 WP_003899787.1.64682 WP_003899787.1.64727 WP_003899787.1.64729 WP_003899787.1.64774 WP_003899787.1.64776 WP_003899787.1.64802 WP_003899787.1.64832 WP_003899787.1.6486 WP_003899787.1.64870 WP_003899787.1.64898 WP_003899787.1.64922 WP_003899787.1.64924 WP_003899787.1.6493 WP_003899787.1.64937 WP_003899787.1.64941 WP_003899787.1.64966 WP_003899787.1.64973 WP_003899787.1.65001 WP_003899787.1.65026 WP_003899787.1.65053 WP_003899787.1.65070 WP_003899787.1.65079 WP_003899787.1.65102 WP_003899787.1.65157 WP_003899787.1.65181 WP_003899787.1.65212 WP_003899787.1.65229 WP_003899787.1.6523 WP_003899787.1.65253 WP_003899787.1.65289 WP_003899787.1.65291 WP_003899787.1.65315 WP_003899787.1.65329 WP_003899787.1.65359 WP_003899787.1.6536 WP_003899787.1.65374 WP_003899787.1.65386 WP_003899787.1.65414 WP_003899787.1.65416 WP_003899787.1.65433 WP_003899787.1.65455 WP_003899787.1.65467 WP_003899787.1.65488 WP_003899787.1.65529 WP_003899787.1.65539 WP_003899787.1.65583 WP_003899787.1.65612 WP_003899787.1.65623 WP_003899787.1.65635 WP_003899787.1.65637 WP_003899787.1.65648 WP_003899787.1.65683 WP_003899787.1.65686 WP_003899787.1.65688 WP_003899787.1.65707 WP_003899787.1.65733 WP_003899787.1.65746 WP_003899787.1.65747 WP_003899787.1.65759 WP_003899787.1.65816 WP_003899787.1.65830 WP_003899787.1.65858 WP_003899787.1.65862 WP_003899787.1.65869 WP_003899787.1.65893 WP_003899787.1.65929 WP_003899787.1.65932 WP_003899787.1.65958 WP_003899787.1.65974 WP_003899787.1.66004 WP_003899787.1.66013 WP_003899787.1.6606 WP_003899787.1.66089 WP_003899787.1.66149 WP_003899787.1.66151 WP_003899787.1.66229 WP_003899787.1.66276 WP_003899787.1.66293 WP_003899787.1.66297 WP_003899787.1.66323 WP_003899787.1.66325 WP_003899787.1.6633 WP_003899787.1.66334 WP_003899787.1.66355 WP_003899787.1.66367 WP_003899787.1.66394 WP_003899787.1.66396 WP_003899787.1.66451 WP_003899787.1.66455 WP_003899787.1.66457 WP_003899787.1.66460 WP_003899787.1.66464 WP_003899787.1.66466 WP_003899787.1.66487 WP_003899787.1.66504 WP_003899787.1.66544 WP_003899787.1.66558 WP_003899787.1.66580 WP_003899787.1.66582 WP_003899787.1.66612 WP_003899787.1.66615 WP_003899787.1.66617 WP_003899787.1.66635 WP_003899787.1.66656 WP_003899787.1.66663 WP_003899787.1.66675 WP_003899787.1.66715 WP_003899787.1.66718 WP_003899787.1.66762 WP_003899787.1.66776 WP_003899787.1.66808 WP_003899787.1.66817 WP_003899787.1.66819 WP_003899787.1.66826 WP_003899787.1.66830 WP_003899787.1.66842 WP_003899787.1.66868 WP_003899787.1.66878 WP_003899787.1.66880 WP_003899787.1.66893 WP_003899787.1.66961 WP_003899787.1.67005 WP_003899787.1.6704 WP_003899787.1.67044 WP_003899787.1.67061 WP_003899787.1.67089 WP_003899787.1.67098 WP_003899787.1.67146 WP_003899787.1.67197 WP_003899787.1.67198 WP_003899787.1.6720 WP_003899787.1.67207 WP_003899787.1.67218 WP_003899787.1.67220 WP_003899787.1.67225 WP_003899787.1.67231 WP_003899787.1.6724 WP_003899787.1.67298 WP_003899787.1.67307 WP_003899787.1.67324 WP_003899787.1.67332 WP_003899787.1.67346 WP_003899787.1.67354 WP_003899787.1.67360 WP_003899787.1.67381 WP_003899787.1.67396 WP_003899787.1.67417 WP_003899787.1.67422 WP_003899787.1.67453 WP_003899787.1.67459 WP_003899787.1.67473 WP_003899787.1.67481 WP_003899787.1.67482 WP_003899787.1.67496 WP_003899787.1.67499 WP_003899787.1.67516 WP_003899787.1.67523 WP_003899787.1.67536 WP_003899787.1.67575 WP_003899787.1.67587 WP_003899787.1.67598 WP_003899787.1.67600 WP_003899787.1.67602 WP_003899787.1.67630 WP_003899787.1.67679 WP_003899787.1.67692 WP_003899787.1.67744 WP_003899787.1.6775 WP_003899787.1.67750 WP_003899787.1.6777 WP_003899787.1.67809 WP_003899787.1.67816 WP_003899787.1.67844 WP_003899787.1.67848 WP_003899787.1.67870 WP_003899787.1.67888 WP_003899787.1.67915 WP_003899787.1.67945 WP_003899787.1.67949 WP_003899787.1.67980 WP_003899787.1.67982 WP_003899787.1.68022 WP_003899787.1.68029 WP_003899787.1.68037 WP_003899787.1.68038 WP_003899787.1.68045 WP_003899787.1.68057 WP_003899787.1.68083 WP_003899787.1.68088 WP_003899787.1.68106 WP_003899787.1.68110 WP_003899787.1.68153 WP_003899787.1.68164 WP_003899787.1.68169 WP_003899787.1.68193 WP_003899787.1.68212 WP_003899787.1.68227 WP_003899787.1.68243 WP_003899787.1.6825 WP_003899787.1.68297 WP_003899787.1.68309 WP_003899787.1.68325 WP_003899787.1.68329 WP_003899787.1.68340 WP_003899787.1.68384 WP_003899787.1.68388 WP_003899787.1.68429 WP_003899787.1.6843 WP_003899787.1.68433 WP_003899787.1.68444 WP_003899787.1.68465 WP_003899787.1.68484 WP_003899787.1.68518 WP_003899787.1.68569 WP_003899787.1.68576 WP_003899787.1.68580 WP_003899787.1.68586 WP_003899787.1.68623 WP_003899787.1.68624 WP_003899787.1.68637 WP_003899787.1.68646 WP_003899787.1.68667 WP_003899787.1.68669 WP_003899787.1.68672 WP_003899787.1.68684 WP_003899787.1.68704 WP_003899787.1.68708 WP_003899787.1.6872 WP_003899787.1.68730 WP_003899787.1.68734 WP_003899787.1.68748 WP_003899787.1.68754 WP_003899787.1.6876 WP_003899787.1.68761 WP_003899787.1.68763 WP_003899787.1.68766 WP_003899787.1.68774 WP_003899787.1.68796 WP_003899787.1.68824 WP_003899787.1.68832 WP_003899787.1.68833 WP_003899787.1.68841 WP_003899787.1.68859 WP_003899787.1.68876 WP_003899787.1.68906 WP_003899787.1.68916 WP_003899787.1.68923 WP_003899787.1.68945 WP_003899787.1.6896 WP_003899787.1.68981 WP_003899787.1.68984 WP_003899787.1.68997 WP_003899787.1.69008 WP_003899787.1.69076 WP_003899787.1.69079 WP_003899787.1.6908 WP_003899787.1.69082 WP_003899787.1.69178 WP_003899787.1.69181 WP_003899787.1.69208 WP_003899787.1.69231 WP_003899787.1.69256 WP_003899787.1.69311 WP_003899787.1.69315 WP_003899787.1.69322 WP_003899787.1.69342 WP_003899787.1.6935 WP_003899787.1.6936 WP_003899787.1.69369 WP_003899787.1.69374 WP_003899787.1.69398 WP_003899787.1.69401 WP_003899787.1.69426 WP_003899787.1.69427 WP_003899787.1.69429 WP_003899787.1.6949 WP_003899787.1.6951 WP_003899787.1.69511 WP_003899787.1.69526 WP_003899787.1.69528 WP_003899787.1.69547 WP_003899787.1.69573 WP_003899787.1.69581 WP_003899787.1.6960 WP_003899787.1.69617 WP_003899787.1.69634 WP_003899787.1.69647 WP_003899787.1.69659 WP_003899787.1.69673 WP_003899787.1.69682 WP_003899787.1.69684 WP_003899787.1.69686 WP_003899787.1.69707 WP_003899787.1.69709 WP_003899787.1.69723 WP_003899787.1.69736 WP_003899787.1.69778 WP_003899787.1.69800 WP_003899787.1.69802 WP_003899787.1.69845 WP_003899787.1.69870 WP_003899787.1.69873 WP_003899787.1.69898 WP_003899787.1.69913 WP_003899787.1.69925 WP_003899787.1.69931 WP_003899787.1.69938 WP_003899787.1.69955 WP_003899787.1.69957 WP_003899787.1.69981 WP_003899787.1.69990 WP_003899787.1.70 WP_003899787.1.70000 WP_003899787.1.70017 WP_003899787.1.70032 WP_003899787.1.70055 WP_003899787.1.70062 WP_003899787.1.70072 WP_003899787.1.70131 WP_003899787.1.70132 WP_003899787.1.7022 WP_003899787.1.70227 WP_003899787.1.70255 WP_003899787.1.70271 WP_003899787.1.70274 WP_003899787.1.7029 WP_003899787.1.70325 WP_003899787.1.70328 WP_003899787.1.70356 WP_003899787.1.70364 WP_003899787.1.70368 WP_003899787.1.70369 WP_003899787.1.70418 WP_003899787.1.70422 WP_003899787.1.70435 WP_003899787.1.70444 WP_003899787.1.70463 WP_003899787.1.70471 WP_003899787.1.70480 WP_003899787.1.70498 WP_003899787.1.70505 WP_003899787.1.70525 WP_003899787.1.70573 WP_003899787.1.70577 WP_003899787.1.70610 WP_003899787.1.70615 WP_003899787.1.70618 WP_003899787.1.70622 WP_003899787.1.70626 WP_003899787.1.70668 WP_003899787.1.70699 WP_003899787.1.70704 WP_003899787.1.70729 WP_003899787.1.70757 WP_003899787.1.70782 WP_003899787.1.70796 WP_003899787.1.70830 WP_003899787.1.70834 WP_003899787.1.7084 WP_003899787.1.70840 WP_003899787.1.70864 WP_003899787.1.70871 WP_003899787.1.70915 WP_003899787.1.70955 WP_003899787.1.70958 WP_003899787.1.70964 WP_003899787.1.70976 WP_003899787.1.71015 WP_003899787.1.71026 WP_003899787.1.71063 WP_003899787.1.71076 WP_003899787.1.71083 WP_003899787.1.7111 WP_003899787.1.71118 WP_003899787.1.71128 WP_003899787.1.7113 WP_003899787.1.71187 WP_003899787.1.71191 WP_003899787.1.71255 WP_003899787.1.71258 WP_003899787.1.71259 WP_003899787.1.71289 WP_003899787.1.71326 WP_003899787.1.71329 WP_003899787.1.71331 WP_003899787.1.71344 WP_003899787.1.71390 WP_003899787.1.71399 WP_003899787.1.71414 WP_003899787.1.71440 WP_003899787.1.71457 WP_003899787.1.7146 WP_003899787.1.71464 WP_003899787.1.71490 WP_003899787.1.71492 WP_003899787.1.71509 WP_003899787.1.71517 WP_003899787.1.71527 WP_003899787.1.71532 WP_003899787.1.71545 WP_003899787.1.71546 WP_003899787.1.71569 WP_003899787.1.71604 WP_003899787.1.71621 WP_003899787.1.71630 WP_003899787.1.71638 WP_003899787.1.71654 WP_003899787.1.71664 WP_003899787.1.71665 WP_003899787.1.71683 WP_003899787.1.71701 WP_003899787.1.71718 WP_003899787.1.71731 WP_003899787.1.71778 WP_003899787.1.71781 WP_003899787.1.71803 WP_003899787.1.71820 WP_003899787.1.71847 WP_003899787.1.7185 WP_003899787.1.71851 WP_003899787.1.71871 WP_003899787.1.71909 WP_003899787.1.71957 WP_003899787.1.71970 WP_003899787.1.72047 WP_003899787.1.72061 WP_003899787.1.72062 WP_003899787.1.72072 WP_003899787.1.72111 WP_003899787.1.72122 WP_003899787.1.72128 WP_003899787.1.72143 WP_003899787.1.7216 WP_003899787.1.72168 WP_003899787.1.72179 WP_003899787.1.72209 WP_003899787.1.72218 WP_003899787.1.72219 WP_003899787.1.72227 WP_003899787.1.7224 WP_003899787.1.72268 WP_003899787.1.72332 WP_003899787.1.72380 WP_003899787.1.72401 WP_003899787.1.72405 WP_003899787.1.72420 WP_003899787.1.72441 WP_003899787.1.72451 WP_003899787.1.72452 WP_003899787.1.72457 WP_003899787.1.72459 WP_003899787.1.72460 WP_003899787.1.72466 WP_003899787.1.72487 WP_003899787.1.72488 WP_003899787.1.72492 WP_003899787.1.72506 WP_003899787.1.72543 WP_003899787.1.7256 WP_003899787.1.72576 WP_003899787.1.72578 WP_003899787.1.72585 WP_003899787.1.72591 WP_003899787.1.72592 WP_003899787.1.7266 WP_003899787.1.72661 WP_003899787.1.72684 WP_003899787.1.72739 WP_003899787.1.72744 WP_003899787.1.72755 WP_003899787.1.72759 WP_003899787.1.72784 WP_003899787.1.72792 WP_003899787.1.72826 WP_003899787.1.72831 WP_003899787.1.72852 WP_003899787.1.72853 WP_003899787.1.72879 WP_003899787.1.72880 WP_003899787.1.72938 WP_003899787.1.72954 WP_003899787.1.72957 WP_003899787.1.72959 WP_003899787.1.72973 WP_003899787.1.7298 WP_003899787.1.72982 WP_003899787.1.72988 WP_003899787.1.72993 WP_003899787.1.73006 WP_003899787.1.73013 WP_003899787.1.73025 WP_003899787.1.73028 WP_003899787.1.73042 WP_003899787.1.73045 WP_003899787.1.73092 WP_003899787.1.73118 WP_003899787.1.7312 WP_003899787.1.73127 WP_003899787.1.73134 WP_003899787.1.73150 WP_003899787.1.73154 WP_003899787.1.73163 WP_003899787.1.73182 WP_003899787.1.73205 WP_003899787.1.7321 WP_003899787.1.73310 WP_003899787.1.73315 WP_003899787.1.73365 WP_003899787.1.73391 WP_003899787.1.73404 WP_003899787.1.73424 WP_003899787.1.73436 WP_003899787.1.73445 WP_003899787.1.73453 WP_003899787.1.73465 WP_003899787.1.73466 WP_003899787.1.73470 WP_003899787.1.73471 WP_003899787.1.73478 WP_003899787.1.73482 WP_003899787.1.73507 WP_003899787.1.73532 WP_003899787.1.73550 WP_003899787.1.73564 WP_003899787.1.73623 WP_003899787.1.73629 WP_003899787.1.73644 WP_003899787.1.7366 WP_003899787.1.73661 WP_003899787.1.7368 WP_003899787.1.73688 WP_003899787.1.73723 WP_003899787.1.73744 WP_003899787.1.73750 WP_003899787.1.73760 WP_003899787.1.73774 WP_003899787.1.7379 WP_003899787.1.73813 WP_003899787.1.73840 WP_003899787.1.73876 WP_003899787.1.7389 WP_003899787.1.74016 WP_003899787.1.74039 WP_003899787.1.74083 WP_003899787.1.74101 WP_003899787.1.74120 WP_003899787.1.74129 WP_003899787.1.74144 WP_003899787.1.7417 WP_003899787.1.74190 WP_003899787.1.74210 WP_003899787.1.7423 WP_003899787.1.74259 WP_003899787.1.74262 WP_003899787.1.74269 WP_003899787.1.74282 WP_003899787.1.74291 WP_003899787.1.74296 WP_003899787.1.74304 WP_003899787.1.7432 WP_003899787.1.74347 WP_003899787.1.7436 WP_003899787.1.74378 WP_003899787.1.74382 WP_003899787.1.74395 WP_003899787.1.74400 WP_003899787.1.74401 WP_003899787.1.74432 WP_003899787.1.74442 WP_003899787.1.74477 WP_003899787.1.74487 WP_003899787.1.74499 WP_003899787.1.74504 WP_003899787.1.74511 WP_003899787.1.74523 WP_003899787.1.74525 WP_003899787.1.74551 WP_003899787.1.74555 WP_003899787.1.74628 WP_003899787.1.74641 WP_003899787.1.74653 WP_003899787.1.74660 WP_003899787.1.74683 WP_003899787.1.7469 WP_003899787.1.74725 WP_003899787.1.74760 WP_003899787.1.74786 WP_003899787.1.74809 WP_003899787.1.74820 WP_003899787.1.74870 WP_003899787.1.74881 WP_003899787.1.74888 WP_003899787.1.74952 WP_003899787.1.7496 WP_003899787.1.74988 WP_003899787.1.75043 WP_003899787.1.75045 WP_003899787.1.75055 WP_003899787.1.75078 WP_003899787.1.75081 WP_003899787.1.75120 WP_003899787.1.75163 WP_003899787.1.75188 WP_003899787.1.75200 WP_003899787.1.75202 WP_003899787.1.75234 WP_003899787.1.75239 WP_003899787.1.75250 WP_003899787.1.75263 WP_003899787.1.75281 WP_003899787.1.75342 WP_003899787.1.7535 WP_003899787.1.75376 WP_003899787.1.75391 WP_003899787.1.75395 WP_003899787.1.75441 WP_003899787.1.75510 WP_003899787.1.75581 WP_003899787.1.75598 WP_003899787.1.75635 WP_003899787.1.75645 WP_003899787.1.75665 WP_003899787.1.75671 WP_003899787.1.75741 WP_003899787.1.75749 WP_003899787.1.75772 WP_003899787.1.75774 WP_003899787.1.75811 WP_003899787.1.75833 WP_003899787.1.7585 WP_003899787.1.75864 WP_003899787.1.75868 WP_003899787.1.75878 WP_003899787.1.75927 WP_003899787.1.75946 WP_003899787.1.75968 WP_003899787.1.75974 WP_003899787.1.76007 WP_003899787.1.76016 WP_003899787.1.76032 WP_003899787.1.76037 WP_003899787.1.7604 WP_003899787.1.76045 WP_003899787.1.76052 WP_003899787.1.76058 WP_003899787.1.76110 WP_003899787.1.76126 WP_003899787.1.76133 WP_003899787.1.76138 WP_003899787.1.76157 WP_003899787.1.76172 WP_003899787.1.76177 WP_003899787.1.76183 WP_003899787.1.76209 WP_003899787.1.76239 WP_003899787.1.76272 WP_003899787.1.76277 WP_003899787.1.76280 WP_003899787.1.76281 WP_003899787.1.76291 WP_003899787.1.76297 WP_003899787.1.76360 WP_003899787.1.76379 WP_003899787.1.76403 WP_003899787.1.76413 WP_003899787.1.76414 WP_003899787.1.76427 WP_003899787.1.76436 WP_003899787.1.76442 WP_003899787.1.76443 WP_003899787.1.76456 WP_003899787.1.76521 WP_003899787.1.76533 WP_003899787.1.76616 WP_003899787.1.76625 WP_003899787.1.76629 WP_003899787.1.76635 WP_003899787.1.76638 WP_003899787.1.76639 WP_003899787.1.76640 WP_003899787.1.76644 WP_003899787.1.76677 WP_003899787.1.76678 WP_003899787.1.76679 WP_003899787.1.76734 WP_003899787.1.76744 WP_003899787.1.76750 WP_003899787.1.76754 WP_003899787.1.76757 WP_003899787.1.76781 WP_003899787.1.76818 WP_003899787.1.76824 WP_003899787.1.76835 WP_003899787.1.76873 WP_003899787.1.76881 WP_003899787.1.76888 WP_003899787.1.76900 WP_003899787.1.7691 WP_003899787.1.76947 WP_003899787.1.76954 WP_003899787.1.76955 WP_003899787.1.76963 WP_003899787.1.76976 WP_003899787.1.770 WP_003899787.1.77000 WP_003899787.1.77008 WP_003899787.1.77021 WP_003899787.1.77056 WP_003899787.1.77065 WP_003899787.1.77075 WP_003899787.1.77093 WP_003899787.1.77107 WP_003899787.1.77115 WP_003899787.1.77118 WP_003899787.1.77125 WP_003899787.1.77142 WP_003899787.1.77166 WP_003899787.1.77250 WP_003899787.1.77252 WP_003899787.1.77260 WP_003899787.1.77266 WP_003899787.1.77280 WP_003899787.1.77285 WP_003899787.1.77312 WP_003899787.1.77348 WP_003899787.1.77351 WP_003899787.1.77352 WP_003899787.1.77361 WP_003899787.1.774 WP_003899787.1.7740 WP_003899787.1.77404 WP_003899787.1.77425 WP_003899787.1.77463 WP_003899787.1.77474 WP_003899787.1.7748 WP_003899787.1.77484 WP_003899787.1.77491 WP_003899787.1.77499 WP_003899787.1.77510 WP_003899787.1.77530 WP_003899787.1.77554 WP_003899787.1.77559 WP_003899787.1.77599 WP_003899787.1.77605 WP_003899787.1.7762 WP_003899787.1.77627 WP_003899787.1.77649 WP_003899787.1.77654 WP_003899787.1.7766 WP_003899787.1.77667 WP_003899787.1.77704 WP_003899787.1.77706 WP_003899787.1.77726 WP_003899787.1.77774 WP_003899787.1.7778 WP_003899787.1.77790 WP_003899787.1.77809 WP_003899787.1.77820 WP_003899787.1.77843 WP_003899787.1.77855 WP_003899787.1.77865 WP_003899787.1.77868 WP_003899787.1.77879 WP_003899787.1.77890 WP_003899787.1.77909 WP_003899787.1.77911 WP_003899787.1.77931 WP_003899787.1.77984 WP_003899787.1.78020 WP_003899787.1.78024 WP_003899787.1.78075 WP_003899787.1.78084 WP_003899787.1.78086 WP_003899787.1.7809 WP_003899787.1.78098 WP_003899787.1.78105 WP_003899787.1.78113 WP_003899787.1.78136 WP_003899787.1.78162 WP_003899787.1.7817 WP_003899787.1.78200 WP_003899787.1.78216 WP_003899787.1.78236 WP_003899787.1.78238 WP_003899787.1.78322 WP_003899787.1.78338 WP_003899787.1.7836 WP_003899787.1.78360 WP_003899787.1.78386 WP_003899787.1.78429 WP_003899787.1.78435 WP_003899787.1.7844 WP_003899787.1.78459 WP_003899787.1.78488 WP_003899787.1.7849 WP_003899787.1.78499 WP_003899787.1.785 WP_003899787.1.78516 WP_003899787.1.78524 WP_003899787.1.78526 WP_003899787.1.78538 WP_003899787.1.78544 WP_003899787.1.78545 WP_003899787.1.78547 WP_003899787.1.78574 WP_003899787.1.78580 WP_003899787.1.7860 WP_003899787.1.78620 WP_003899787.1.78646 WP_003899787.1.78648 WP_003899787.1.78649 WP_003899787.1.78655 WP_003899787.1.78657 WP_003899787.1.78659 WP_003899787.1.7869 WP_003899787.1.78692 WP_003899787.1.78760 WP_003899787.1.78766 WP_003899787.1.78776 WP_003899787.1.78778 WP_003899787.1.78784 WP_003899787.1.78788 WP_003899787.1.78790 WP_003899787.1.78793 WP_003899787.1.78848 WP_003899787.1.78860 WP_003899787.1.7887 WP_003899787.1.78884 WP_003899787.1.78932 WP_003899787.1.78969 WP_003899787.1.78977 WP_003899787.1.78980 WP_003899787.1.79005 WP_003899787.1.79016 WP_003899787.1.79033 WP_003899787.1.79064 WP_003899787.1.79066 WP_003899787.1.79068 WP_003899787.1.79077 WP_003899787.1.79095 WP_003899787.1.79112 WP_003899787.1.79122 WP_003899787.1.79145 WP_003899787.1.79152 WP_003899787.1.79163 WP_003899787.1.79182 WP_003899787.1.79198 WP_003899787.1.79213 WP_003899787.1.79218 WP_003899787.1.79268 WP_003899787.1.79273 WP_003899787.1.79278 WP_003899787.1.79290 WP_003899787.1.79319 WP_003899787.1.79325 WP_003899787.1.79326 WP_003899787.1.7933 WP_003899787.1.79330 WP_003899787.1.79339 WP_003899787.1.79394 WP_003899787.1.79399 WP_003899787.1.79413 WP_003899787.1.79422 WP_003899787.1.79445 WP_003899787.1.79447 WP_003899787.1.79455 WP_003899787.1.79471 WP_003899787.1.79480 WP_003899787.1.79482 WP_003899787.1.79488 WP_003899787.1.79500 WP_003899787.1.79502 WP_003899787.1.79508 WP_003899787.1.79514 WP_003899787.1.79561 WP_003899787.1.79565 WP_003899787.1.79578 WP_003899787.1.79588 WP_003899787.1.79598 WP_003899787.1.79615 WP_003899787.1.79684 WP_003899787.1.79698 WP_003899787.1.797 WP_003899787.1.79744 WP_003899787.1.79784 WP_003899787.1.79802 WP_003899787.1.79806 WP_003899787.1.79819 WP_003899787.1.79826 WP_003899787.1.79828 WP_003899787.1.79851 WP_003899787.1.79853 WP_003899787.1.79863 WP_003899787.1.79881 WP_003899787.1.79885 WP_003899787.1.79898 WP_003899787.1.7990 WP_003899787.1.79900 WP_003899787.1.79913 WP_003899787.1.79918 WP_003899787.1.79947 WP_003899787.1.79948 WP_003899787.1.7995 WP_003899787.1.7997 WP_003899787.1.80004 WP_003899787.1.80015 WP_003899787.1.80022 WP_003899787.1.80030 WP_003899787.1.80054 WP_003899787.1.80084 WP_003899787.1.80099 WP_003899787.1.80129 WP_003899787.1.80177 WP_003899787.1.80234 WP_003899787.1.8026 WP_003899787.1.80275 WP_003899787.1.8029 WP_003899787.1.80299 WP_003899787.1.80300 WP_003899787.1.80304 WP_003899787.1.80326 WP_003899787.1.80351 WP_003899787.1.8037 WP_003899787.1.80370 WP_003899787.1.80399 WP_003899787.1.8044 WP_003899787.1.80451 WP_003899787.1.80458 WP_003899787.1.80461 WP_003899787.1.80490 WP_003899787.1.80503 WP_003899787.1.80507 WP_003899787.1.80576 WP_003899787.1.80588 WP_003899787.1.80599 WP_003899787.1.8060 WP_003899787.1.80624 WP_003899787.1.80636 WP_003899787.1.80669 WP_003899787.1.80673 WP_003899787.1.80711 WP_003899787.1.80714 WP_003899787.1.80743 WP_003899787.1.80784 WP_003899787.1.80815 WP_003899787.1.80853 WP_003899787.1.80918 WP_003899787.1.8093 WP_003899787.1.80967 WP_003899787.1.8097 WP_003899787.1.80988 WP_003899787.1.81007 WP_003899787.1.81013 WP_003899787.1.8105 WP_003899787.1.81059 WP_003899787.1.81063 WP_003899787.1.81066 WP_003899787.1.81075 WP_003899787.1.81091 WP_003899787.1.81119 WP_003899787.1.81125 WP_003899787.1.81136 WP_003899787.1.8114 WP_003899787.1.81189 WP_003899787.1.81192 WP_003899787.1.812 WP_003899787.1.81230 WP_003899787.1.81249 WP_003899787.1.81250 WP_003899787.1.81264 WP_003899787.1.8128 WP_003899787.1.81287 WP_003899787.1.81297 WP_003899787.1.8138 WP_003899787.1.81407 WP_003899787.1.8143 WP_003899787.1.81439 WP_003899787.1.81465 WP_003899787.1.81505 WP_003899787.1.81529 WP_003899787.1.81538 WP_003899787.1.81541 WP_003899787.1.81560 WP_003899787.1.81561 WP_003899787.1.81567 WP_003899787.1.81583 WP_003899787.1.81686 WP_003899787.1.81712 WP_003899787.1.81720 WP_003899787.1.81731 WP_003899787.1.81774 WP_003899787.1.81788 WP_003899787.1.81809 WP_003899787.1.81820 WP_003899787.1.81850 WP_003899787.1.81883 WP_003899787.1.81891 WP_003899787.1.81911 WP_003899787.1.81918 WP_003899787.1.82011 WP_003899787.1.82048 WP_003899787.1.82069 WP_003899787.1.82071 WP_003899787.1.82108 WP_003899787.1.82136 WP_003899787.1.82142 WP_003899787.1.8215 WP_003899787.1.82158 WP_003899787.1.8217 WP_003899787.1.82209 WP_003899787.1.82210 WP_003899787.1.82228 WP_003899787.1.82236 WP_003899787.1.82251 WP_003899787.1.82271 WP_003899787.1.82305 WP_003899787.1.82307 WP_003899787.1.82309 WP_003899787.1.82317 WP_003899787.1.8232 WP_003899787.1.82346 WP_003899787.1.82374 WP_003899787.1.82385 WP_003899787.1.82429 WP_003899787.1.82460 WP_003899787.1.82462 WP_003899787.1.82483 WP_003899787.1.82494 WP_003899787.1.82531 WP_003899787.1.82546 WP_003899787.1.82547 WP_003899787.1.82549 WP_003899787.1.82577 WP_003899787.1.82592 WP_003899787.1.82597 WP_003899787.1.82598 WP_003899787.1.82625 WP_003899787.1.82642 WP_003899787.1.82651 WP_003899787.1.82653 WP_003899787.1.82685 WP_003899787.1.8271 WP_003899787.1.82712 WP_003899787.1.8273 WP_003899787.1.82743 WP_003899787.1.82757 WP_003899787.1.82774 WP_003899787.1.82803 WP_003899787.1.82836 WP_003899787.1.82860 WP_003899787.1.82871 WP_003899787.1.82892 WP_003899787.1.82935 WP_003899787.1.82957 WP_003899787.1.82973 WP_003899787.1.82981 WP_003899787.1.82983 WP_003899787.1.83004 WP_003899787.1.83009 WP_003899787.1.83044 WP_003899787.1.83065 WP_003899787.1.83074 WP_003899787.1.83110 WP_003899787.1.83146 WP_003899787.1.83149 WP_003899787.1.83159 WP_003899787.1.8317 WP_003899787.1.83173 WP_003899787.1.83181 WP_003899787.1.83182 WP_003899787.1.83191 WP_003899787.1.83197 WP_003899787.1.83212 WP_003899787.1.8326 WP_003899787.1.83262 WP_003899787.1.83268 WP_003899787.1.83273 WP_003899787.1.83309 WP_003899787.1.83332 WP_003899787.1.83334 WP_003899787.1.83341 WP_003899787.1.83349 WP_003899787.1.8335 WP_003899787.1.83353 WP_003899787.1.83367 WP_003899787.1.83380 WP_003899787.1.83381 WP_003899787.1.83389 WP_003899787.1.83408 WP_003899787.1.83409 WP_003899787.1.83435 WP_003899787.1.83470 WP_003899787.1.83524 WP_003899787.1.83526 WP_003899787.1.8358 WP_003899787.1.83589 WP_003899787.1.83601 WP_003899787.1.83611 WP_003899787.1.83638 WP_003899787.1.83648 WP_003899787.1.83656 WP_003899787.1.83667 WP_003899787.1.83689 WP_003899787.1.83692 WP_003899787.1.83704 WP_003899787.1.83705 WP_003899787.1.83766 WP_003899787.1.83793 WP_003899787.1.83794 WP_003899787.1.83802 WP_003899787.1.83805 WP_003899787.1.83839 WP_003899787.1.83842 WP_003899787.1.83850 WP_003899787.1.83861 WP_003899787.1.83884 WP_003899787.1.83920 WP_003899787.1.83929 WP_003899787.1.83930 WP_003899787.1.83975 WP_003899787.1.83991 WP_003899787.1.8400 WP_003899787.1.84027 WP_003899787.1.8404 WP_003899787.1.84057 WP_003899787.1.84070 WP_003899787.1.8409 WP_003899787.1.84112 WP_003899787.1.84146 WP_003899787.1.8415 WP_003899787.1.84176 WP_003899787.1.84186 WP_003899787.1.84192 WP_003899787.1.84228 WP_003899787.1.8424 WP_003899787.1.84244 WP_003899787.1.8426 WP_003899787.1.84277 WP_003899787.1.84287 WP_003899787.1.8434 WP_003899787.1.84388 WP_003899787.1.84408 WP_003899787.1.84409 WP_003899787.1.84438 WP_003899787.1.84460 WP_003899787.1.84488 WP_003899787.1.84504 WP_003899787.1.84525 WP_003899787.1.84620 WP_003899787.1.84623 WP_003899787.1.84655 WP_003899787.1.84666 WP_003899787.1.84670 WP_003899787.1.84739 WP_003899787.1.84748 WP_003899787.1.84766 WP_003899787.1.84772 WP_003899787.1.84774 WP_003899787.1.848 WP_003899787.1.84812 WP_003899787.1.84836 WP_003899787.1.84839 WP_003899787.1.84846 WP_003899787.1.84873 WP_003899787.1.84911 WP_003899787.1.84938 WP_003899787.1.84968 WP_003899787.1.84973 WP_003899787.1.84981 WP_003899787.1.84985 WP_003899787.1.8503 WP_003899787.1.85038 WP_003899787.1.85041 WP_003899787.1.85043 WP_003899787.1.8505 WP_003899787.1.85074 WP_003899787.1.8509 WP_003899787.1.8512 WP_003899787.1.85148 WP_003899787.1.8518 WP_003899787.1.8522 WP_003899787.1.85242 WP_003899787.1.85276 WP_003899787.1.85281 WP_003899787.1.85284 WP_003899787.1.85314 WP_003899787.1.85319 WP_003899787.1.85330 WP_003899787.1.85341 WP_003899787.1.85346 WP_003899787.1.8535 WP_003899787.1.85363 WP_003899787.1.85371 WP_003899787.1.85377 WP_003899787.1.85387 WP_003899787.1.85399 WP_003899787.1.85458 WP_003899787.1.8546 WP_003899787.1.85464 WP_003899787.1.85478 WP_003899787.1.85480 WP_003899787.1.85488 WP_003899787.1.85495 WP_003899787.1.85551 WP_003899787.1.85557 WP_003899787.1.85577 WP_003899787.1.85597 WP_003899787.1.85599 WP_003899787.1.85610 WP_003899787.1.8563 WP_003899787.1.85648 WP_003899787.1.85679 WP_003899787.1.85704 WP_003899787.1.85717 WP_003899787.1.85727 WP_003899787.1.85737 WP_003899787.1.85763 WP_003899787.1.85808 WP_003899787.1.85819 WP_003899787.1.85820 WP_003899787.1.85823 WP_003899787.1.85832 WP_003899787.1.8586 WP_003899787.1.85872 WP_003899787.1.85894 WP_003899787.1.85909 WP_003899787.1.85913 WP_003899787.1.85953 WP_003899787.1.85986 WP_003899787.1.86000 WP_003899787.1.86024 WP_003899787.1.86025 WP_003899787.1.86032 WP_003899787.1.86048 WP_003899787.1.86052 WP_003899787.1.86067 WP_003899787.1.86103 WP_003899787.1.86122 WP_003899787.1.86124 WP_003899787.1.86160 WP_003899787.1.86164 WP_003899787.1.86168 WP_003899787.1.86190 WP_003899787.1.86204 WP_003899787.1.86208 WP_003899787.1.86235 WP_003899787.1.86249 WP_003899787.1.86260 WP_003899787.1.86290 WP_003899787.1.863 WP_003899787.1.86327 WP_003899787.1.86334 WP_003899787.1.86337 WP_003899787.1.86368 WP_003899787.1.86377 WP_003899787.1.86425 WP_003899787.1.86459 WP_003899787.1.8649 WP_003899787.1.86499 WP_003899787.1.86520 WP_003899787.1.86561 WP_003899787.1.86568 WP_003899787.1.86575 WP_003899787.1.86584 WP_003899787.1.86605 WP_003899787.1.86626 WP_003899787.1.86648 WP_003899787.1.8666 WP_003899787.1.86684 WP_003899787.1.86696 WP_003899787.1.86705 WP_003899787.1.86718 WP_003899787.1.86725 WP_003899787.1.86757 WP_003899787.1.86766 WP_003899787.1.86801 WP_003899787.1.86814 WP_003899787.1.86820 WP_003899787.1.86825 WP_003899787.1.86834 WP_003899787.1.8685 WP_003899787.1.86851 WP_003899787.1.86855 WP_003899787.1.86867 WP_003899787.1.86877 WP_003899787.1.86883 WP_003899787.1.8689 WP_003899787.1.86892 WP_003899787.1.86933 WP_003899787.1.86941 WP_003899787.1.86950 WP_003899787.1.86962 WP_003899787.1.86963 WP_003899787.1.86979 WP_003899787.1.8700 WP_003899787.1.87001 WP_003899787.1.87002 WP_003899787.1.87031 WP_003899787.1.87116 WP_003899787.1.87117 WP_003899787.1.8714 WP_003899787.1.87162 WP_003899787.1.87178 WP_003899787.1.87191 WP_003899787.1.87201 WP_003899787.1.87209 WP_003899787.1.87240 WP_003899787.1.87266 WP_003899787.1.87273 WP_003899787.1.87275 WP_003899787.1.8733 WP_003899787.1.87345 WP_003899787.1.87369 WP_003899787.1.8737 WP_003899787.1.87401 WP_003899787.1.87404 WP_003899787.1.87406 WP_003899787.1.87409 WP_003899787.1.87444 WP_003899787.1.87446 WP_003899787.1.87459 WP_003899787.1.87472 WP_003899787.1.87489 WP_003899787.1.87494 WP_003899787.1.87496 WP_003899787.1.87582 WP_003899787.1.87588 WP_003899787.1.87617 WP_003899787.1.87619 WP_003899787.1.87620 WP_003899787.1.87634 WP_003899787.1.87643 WP_003899787.1.8765 WP_003899787.1.87650 WP_003899787.1.87654 WP_003899787.1.87658 WP_003899787.1.87665 WP_003899787.1.87676 WP_003899787.1.87677 WP_003899787.1.87684 WP_003899787.1.87692 WP_003899787.1.87707 WP_003899787.1.87732 WP_003899787.1.87784 WP_003899787.1.87796 WP_003899787.1.87809 WP_003899787.1.87817 WP_003899787.1.87827 WP_003899787.1.87831 WP_003899787.1.87835 WP_003899787.1.87837 WP_003899787.1.87866 WP_003899787.1.8789 WP_003899787.1.87911 WP_003899787.1.87924 WP_003899787.1.87951 WP_003899787.1.87955 WP_003899787.1.87956 WP_003899787.1.87991 WP_003899787.1.88 WP_003899787.1.88002 WP_003899787.1.88037 WP_003899787.1.88039 WP_003899787.1.88072 WP_003899787.1.88077 WP_003899787.1.88121 WP_003899787.1.88180 WP_003899787.1.88191 WP_003899787.1.88205 WP_003899787.1.88217 WP_003899787.1.88219 WP_003899787.1.88245 WP_003899787.1.88253 WP_003899787.1.88294 WP_003899787.1.88315 WP_003899787.1.88316 WP_003899787.1.88320 WP_003899787.1.88338 WP_003899787.1.8840 WP_003899787.1.88437 WP_003899787.1.88453 WP_003899787.1.88469 WP_003899787.1.88489 WP_003899787.1.88507 WP_003899787.1.88521 WP_003899787.1.88530 WP_003899787.1.88537 WP_003899787.1.88541 WP_003899787.1.88592 WP_003899787.1.88616 WP_003899787.1.88618 WP_003899787.1.8862 WP_003899787.1.88625 WP_003899787.1.88632 WP_003899787.1.88634 WP_003899787.1.88649 WP_003899787.1.8870 WP_003899787.1.88737 WP_003899787.1.88756 WP_003899787.1.888 WP_003899787.1.88824 WP_003899787.1.88886 WP_003899787.1.88965 WP_003899787.1.88985 WP_003899787.1.8902 WP_003899787.1.89025 WP_003899787.1.89041 WP_003899787.1.89046 WP_003899787.1.89082 WP_003899787.1.89162 WP_003899787.1.89168 WP_003899787.1.8917 WP_003899787.1.89193 WP_003899787.1.89205 WP_003899787.1.89207 WP_003899787.1.89225 WP_003899787.1.8925 WP_003899787.1.89277 WP_003899787.1.89286 WP_003899787.1.89293 WP_003899787.1.89320 WP_003899787.1.8935 WP_003899787.1.89371 WP_003899787.1.89378 WP_003899787.1.89392 WP_003899787.1.89406 WP_003899787.1.8943 WP_003899787.1.89451 WP_003899787.1.89453 WP_003899787.1.89473 WP_003899787.1.89475 WP_003899787.1.89483 WP_003899787.1.895 WP_003899787.1.89513 WP_003899787.1.89517 WP_003899787.1.89522 WP_003899787.1.8954 WP_003899787.1.89543 WP_003899787.1.89567 WP_003899787.1.8957 WP_003899787.1.89572 WP_003899787.1.89589 WP_003899787.1.89607 WP_003899787.1.89613 WP_003899787.1.89625 WP_003899787.1.89648 WP_003899787.1.8967 WP_003899787.1.89670 WP_003899787.1.89676 WP_003899787.1.89729 WP_003899787.1.89739 WP_003899787.1.89762 WP_003899787.1.8977 WP_003899787.1.89802 WP_003899787.1.89808 WP_003899787.1.8982 WP_003899787.1.89829 WP_003899787.1.89831 WP_003899787.1.89844 WP_003899787.1.89849 WP_003899787.1.8989 WP_003899787.1.89901 WP_003899787.1.89903 WP_003899787.1.89909 WP_003899787.1.8992 WP_003899787.1.89922 WP_003899787.1.89926 WP_003899787.1.89963 WP_003899787.1.89971 WP_003899787.1.8998 WP_003899787.1.89987 WP_003899787.1.900 WP_003899787.1.90048 WP_003899787.1.9007 WP_003899787.1.90080 WP_003899787.1.90130 WP_003899787.1.90134 WP_003899787.1.90137 WP_003899787.1.90157 WP_003899787.1.90184 WP_003899787.1.90199 WP_003899787.1.90231 WP_003899787.1.90245 WP_003899787.1.90308 WP_003899787.1.90322 WP_003899787.1.90328 WP_003899787.1.90372 WP_003899787.1.90439 WP_003899787.1.90481 WP_003899787.1.90499 WP_003899787.1.9050 WP_003899787.1.90527 WP_003899787.1.90550 WP_003899787.1.90560 WP_003899787.1.90612 WP_003899787.1.90640 WP_003899787.1.90672 WP_003899787.1.90687 WP_003899787.1.90691 WP_003899787.1.90711 WP_003899787.1.90722 WP_003899787.1.90744 WP_003899787.1.9075 WP_003899787.1.90767 WP_003899787.1.90771 WP_003899787.1.90785 WP_003899787.1.90788 WP_003899787.1.90800 WP_003899787.1.90810 WP_003899787.1.90816 WP_003899787.1.90819 WP_003899787.1.9082 WP_003899787.1.90831 WP_003899787.1.90884 WP_003899787.1.90899 WP_003899787.1.90906 WP_003899787.1.90958 WP_003899787.1.90976 WP_003899787.1.90977 WP_003899787.1.90987 WP_003899787.1.9102 WP_003899787.1.91026 WP_003899787.1.91032 WP_003899787.1.91043 WP_003899787.1.91053 WP_003899787.1.91082 WP_003899787.1.91106 WP_003899787.1.91112 WP_003899787.1.91144 WP_003899787.1.91151 WP_003899787.1.91157 WP_003899787.1.91167 WP_003899787.1.91169 WP_003899787.1.91192 WP_003899787.1.91201 WP_003899787.1.91207 WP_003899787.1.91208 WP_003899787.1.91211 WP_003899787.1.91214 WP_003899787.1.91230 WP_003899787.1.91244 WP_003899787.1.91251 WP_003899787.1.91260 WP_003899787.1.91265 WP_003899787.1.9128 WP_003899787.1.91284 WP_003899787.1.91294 WP_003899787.1.91303 WP_003899787.1.91322 WP_003899787.1.91352 WP_003899787.1.91386 WP_003899787.1.9139 WP_003899787.1.91398 WP_003899787.1.91411 WP_003899787.1.91430 WP_003899787.1.91436 WP_003899787.1.91483 WP_003899787.1.91496 WP_003899787.1.91507 WP_003899787.1.91508 WP_003899787.1.91576 WP_003899787.1.91589 WP_003899787.1.91694 WP_003899787.1.91695 WP_003899787.1.91713 WP_003899787.1.91716 WP_003899787.1.91717 WP_003899787.1.91728 WP_003899787.1.91743 WP_003899787.1.91759 WP_003899787.1.91784 WP_003899787.1.91785 WP_003899787.1.91786 WP_003899787.1.91802 WP_003899787.1.91822 WP_003899787.1.91828 WP_003899787.1.9189 WP_003899787.1.91896 WP_003899787.1.9190 WP_003899787.1.91915 WP_003899787.1.91931 WP_003899787.1.91937 WP_003899787.1.91944 WP_003899787.1.91953 WP_003899787.1.91957 WP_003899787.1.91976 WP_003899787.1.91978 WP_003899787.1.92021 WP_003899787.1.92083 WP_003899787.1.92127 WP_003899787.1.92144 WP_003899787.1.92150 WP_003899787.1.92153 WP_003899787.1.92190 WP_003899787.1.92192 WP_003899787.1.92200 WP_003899787.1.92220 WP_003899787.1.92221 WP_003899787.1.92222 WP_003899787.1.92273 WP_003899787.1.92289 WP_003899787.1.9229 WP_003899787.1.92294 WP_003899787.1.92300 WP_003899787.1.92317 WP_003899787.1.92334 WP_003899787.1.92338 WP_003899787.1.92345 WP_003899787.1.92356 WP_003899787.1.92364 WP_003899787.1.92380 WP_003899787.1.92416 WP_003899787.1.92447 WP_003899787.1.92456 WP_003899787.1.92467 WP_003899787.1.92471 WP_003899787.1.92490 WP_003899787.1.92508 WP_003899787.1.9251 WP_003899787.1.92511 WP_003899787.1.92523 WP_003899787.1.92527 WP_003899787.1.92536 WP_003899787.1.92592 WP_003899787.1.92597 WP_003899787.1.92603 WP_003899787.1.92606 WP_003899787.1.92610 WP_003899787.1.92613 WP_003899787.1.9263 WP_003899787.1.9265 WP_003899787.1.92650 WP_003899787.1.92660 WP_003899787.1.92677 WP_003899787.1.92685 WP_003899787.1.92689 WP_003899787.1.92690 WP_003899787.1.92706 WP_003899787.1.92714 WP_003899787.1.92736 WP_003899787.1.9274 WP_003899787.1.92752 WP_003899787.1.92760 WP_003899787.1.92777 WP_003899787.1.92803 WP_003899787.1.92833 WP_003899787.1.92856 WP_003899787.1.92881 WP_003899787.1.92892 WP_003899787.1.92907 WP_003899787.1.92908 WP_003899787.1.9291 WP_003899787.1.92917 WP_003899787.1.92996 WP_003899787.1.93006 WP_003899787.1.93008 WP_003899787.1.93009 WP_003899787.1.93015 WP_003899787.1.93043 WP_003899787.1.9307 WP_003899787.1.93097 WP_003899787.1.93137 WP_003899787.1.93192 WP_003899787.1.93199 WP_003899787.1.93203 WP_003899787.1.93212 WP_003899787.1.93234 WP_003899787.1.93245 WP_003899787.1.93257 WP_003899787.1.93265 WP_003899787.1.93297 WP_003899787.1.93320 WP_003899787.1.93328 WP_003899787.1.93337 WP_003899787.1.93343 WP_003899787.1.93349 WP_003899787.1.93363 WP_003899787.1.93377 WP_003899787.1.9338 WP_003899787.1.93407 WP_003899787.1.93417 WP_003899787.1.93419 WP_003899787.1.93426 WP_003899787.1.9344 WP_003899787.1.93443 WP_003899787.1.93447 WP_003899787.1.93470 WP_003899787.1.93483 WP_003899787.1.93487 WP_003899787.1.93495 WP_003899787.1.93499 WP_003899787.1.93516 WP_003899787.1.93536 WP_003899787.1.93544 WP_003899787.1.93555 WP_003899787.1.93560 WP_003899787.1.93564 WP_003899787.1.9357 WP_003899787.1.93573 WP_003899787.1.93576 WP_003899787.1.93588 WP_003899787.1.9363 WP_003899787.1.93645 WP_003899787.1.93649 WP_003899787.1.93659 WP_003899787.1.93677 WP_003899787.1.9368 WP_003899787.1.93689 WP_003899787.1.93693 WP_003899787.1.93698 WP_003899787.1.93706 WP_003899787.1.9371 WP_003899787.1.93792 WP_003899787.1.93823 WP_003899787.1.93871 WP_003899787.1.9388 WP_003899787.1.93894 WP_003899787.1.93903 WP_003899787.1.93907 WP_003899787.1.93913 WP_003899787.1.93946 WP_003899787.1.93950 WP_003899787.1.93953 WP_003899787.1.93954 WP_003899787.1.93988 WP_003899787.1.9407 WP_003899787.1.94143 WP_003899787.1.94154 WP_003899787.1.94184 WP_003899787.1.94204 WP_003899787.1.94205 WP_003899787.1.94226 WP_003899787.1.94231 WP_003899787.1.94256 WP_003899787.1.94261 WP_003899787.1.94281 WP_003899787.1.94292 WP_003899787.1.94297 WP_003899787.1.9431 WP_003899787.1.94326 WP_003899787.1.94339 WP_003899787.1.94392 WP_003899787.1.94416 WP_003899787.1.94421 WP_003899787.1.94456 WP_003899787.1.94470 WP_003899787.1.94480 WP_003899787.1.94495 WP_003899787.1.94511 WP_003899787.1.94512 WP_003899787.1.94525 WP_003899787.1.94528 WP_003899787.1.94564 WP_003899787.1.946 WP_003899787.1.94602 WP_003899787.1.94623 WP_003899787.1.94629 WP_003899787.1.9465 WP_003899787.1.94673 WP_003899787.1.94714 WP_003899787.1.94730 WP_003899787.1.94736 WP_003899787.1.94776 WP_003899787.1.9478 WP_003899787.1.94834 WP_003899787.1.94852 WP_003899787.1.94872 WP_003899787.1.9488 WP_003899787.1.94902 WP_003899787.1.94916 WP_003899787.1.94979 WP_003899787.1.94994 WP_003899787.1.94998 WP_003899787.1.95007 WP_003899787.1.95010 WP_003899787.1.95015 WP_003899787.1.95068 WP_003899787.1.95081 WP_003899787.1.95082 WP_003899787.1.9509 WP_003899787.1.95112 WP_003899787.1.95138 WP_003899787.1.9514 WP_003899787.1.95179 WP_003899787.1.95188 WP_003899787.1.95190 WP_003899787.1.95234 WP_003899787.1.95241 WP_003899787.1.95245 WP_003899787.1.95257 WP_003899787.1.95279 WP_003899787.1.9531 WP_003899787.1.95335 WP_003899787.1.95344 WP_003899787.1.9535 WP_003899787.1.95370 WP_003899787.1.95392 WP_003899787.1.95416 WP_003899787.1.95417 WP_003899787.1.95454 WP_003899787.1.95455 WP_003899787.1.95491 WP_003899787.1.95497 WP_003899787.1.95508 WP_003899787.1.95509 WP_003899787.1.95529 WP_003899787.1.95556 WP_003899787.1.95557 WP_003899787.1.95565 WP_003899787.1.95578 WP_003899787.1.95580 WP_003899787.1.95585 WP_003899787.1.95643 WP_003899787.1.95679 WP_003899787.1.95685 WP_003899787.1.957 WP_003899787.1.95724 WP_003899787.1.95727 WP_003899787.1.95730 WP_003899787.1.95735 WP_003899787.1.95758 WP_003899787.1.95772 WP_003899787.1.95797 WP_003899787.1.95839 WP_003899787.1.9585 WP_003899787.1.9590 WP_003899787.1.95902 WP_003899787.1.95908 WP_003899787.1.95924 WP_003899787.1.95926 WP_003899787.1.95953 WP_003899787.1.95958 WP_003899787.1.95964 WP_003899787.1.95973 WP_003899787.1.96006 WP_003899787.1.9602 WP_003899787.1.96036 WP_003899787.1.96062 WP_003899787.1.96065 WP_003899787.1.96098 WP_003899787.1.96146 WP_003899787.1.96166 WP_003899787.1.96171 WP_003899787.1.96182 WP_003899787.1.96204 WP_003899787.1.96230 WP_003899787.1.96235 WP_003899787.1.96242 WP_003899787.1.96245 WP_003899787.1.96254 WP_003899787.1.96259 WP_003899787.1.96286 WP_003899787.1.96313 WP_003899787.1.96345 WP_003899787.1.96360 WP_003899787.1.96373 WP_003899787.1.96456 WP_003899787.1.96486 WP_003899787.1.96569 WP_003899787.1.96573 WP_003899787.1.96575 WP_003899787.1.96576 WP_003899787.1.96611 WP_003899787.1.96621 WP_003899787.1.9667 WP_003899787.1.96681 WP_003899787.1.96726 WP_003899787.1.96733 WP_003899787.1.96742 WP_003899787.1.96754 WP_003899787.1.9678 WP_003899787.1.96832 WP_003899787.1.9685 WP_003899787.1.97008 WP_003899787.1.97009 WP_003899787.1.97056 WP_003899787.1.97084 WP_003899787.1.97087 WP_003899787.1.97094 WP_003899787.1.97096 WP_003899787.1.97099 WP_003899787.1.97108 WP_003899787.1.97113 WP_003899787.1.97122 WP_003899787.1.97127 WP_003899787.1.97129 WP_003899787.1.97136 WP_003899787.1.9716 WP_003899787.1.97176 WP_003899787.1.97222 WP_003899787.1.97223 WP_003899787.1.97237 WP_003899787.1.97242 WP_003899787.1.97270 WP_003899787.1.97283 WP_003899787.1.97296 WP_003899787.1.97321 WP_003899787.1.97325 WP_003899787.1.97330 WP_003899787.1.97366 WP_003899787.1.97376 WP_003899787.1.97380 WP_003899787.1.9739 WP_003899787.1.97462 WP_003899787.1.97517 WP_003899787.1.97519 WP_003899787.1.97535 WP_003899787.1.97540 WP_003899787.1.97545 WP_003899787.1.97546 WP_003899787.1.97550 WP_003899787.1.97568 WP_003899787.1.97577 WP_003899787.1.97584 WP_003899787.1.9759 WP_003899787.1.97591 WP_003899787.1.97596 WP_003899787.1.97609 WP_003899787.1.97618 WP_003899787.1.9763 WP_003899787.1.97669 WP_003899787.1.97673 WP_003899787.1.97700 WP_003899787.1.97701 WP_003899787.1.9773 WP_003899787.1.97730 WP_003899787.1.97740 WP_003899787.1.97751 WP_003899787.1.97754 WP_003899787.1.97797 WP_003899787.1.9782 WP_003899787.1.9784 WP_003899787.1.97888 WP_003899787.1.9790 WP_003899787.1.9795 WP_003899787.1.97951 WP_003899787.1.97958 WP_003899787.1.97966 WP_003899787.1.97977 WP_003899787.1.97979 WP_003899787.1.97995 WP_003899787.1.98018 WP_003899787.1.98034 WP_003899787.1.98052 WP_003899787.1.98071 WP_003899787.1.98072 WP_003899787.1.98113 WP_003899787.1.98114 WP_003899787.1.98128 WP_003899787.1.98181 WP_003899787.1.98188 WP_003899787.1.98189 WP_003899787.1.98213 WP_003899787.1.98225 WP_003899787.1.98291 WP_003899787.1.98335 WP_003899787.1.98350 WP_003899787.1.98395 WP_003899787.1.98412 WP_003899787.1.98441 WP_003899787.1.98443 WP_003899787.1.98462 WP_003899787.1.9848 WP_003899787.1.98482 WP_003899787.1.98486 WP_003899787.1.98488 WP_003899787.1.98503 WP_003899787.1.98516 WP_003899787.1.98524 WP_003899787.1.98536 WP_003899787.1.98541 WP_003899787.1.98566 WP_003899787.1.98576 WP_003899787.1.98590 WP_003899787.1.98594 WP_003899787.1.98599 WP_003899787.1.98629 WP_003899787.1.98645 WP_003899787.1.98646 WP_003899787.1.98649 WP_003899787.1.98656 WP_003899787.1.9867 WP_003899787.1.98674 WP_003899787.1.98697 WP_003899787.1.98701 WP_003899787.1.98739 WP_003899787.1.98749 WP_003899787.1.98765 WP_003899787.1.98770 WP_003899787.1.98777 WP_003899787.1.98778 WP_003899787.1.98802 WP_003899787.1.98838 WP_003899787.1.98850 WP_003899787.1.98906 WP_003899787.1.98935 WP_003899787.1.98948 WP_003899787.1.98953 WP_003899787.1.98984 WP_003899787.1.99000 WP_003899787.1.99023 WP_003899787.1.99030 WP_003899787.1.99037 WP_003899787.1.99055 WP_003899787.1.99062 WP_003899787.1.99086 WP_003899787.1.99115 WP_003899787.1.99117 WP_003899787.1.99176 WP_003899787.1.99205 WP_003899787.1.99211 WP_003899787.1.99216 WP_003899787.1.99222 WP_003899787.1.99251 WP_003899787.1.99269 WP_003899787.1.99294 WP_003899787.1.99312 WP_003899787.1.99315 WP_003899787.1.99316 WP_003899787.1.99322 WP_003899787.1.99328 WP_003899787.1.99365 WP_003899787.1.99368 WP_003899787.1.99379 WP_003899787.1.99396 WP_003899787.1.99402 WP_003899787.1.99404 WP_003899787.1.99419 WP_003899787.1.99438 WP_003899787.1.99460 WP_003899787.1.99468 WP_003899787.1.99473 WP_003899787.1.99513 WP_003899787.1.99529 WP_003899787.1.99548 WP_003899787.1.99572 WP_003899787.1.99575 WP_003899787.1.99578 WP_003899787.1.99605 WP_003899787.1.99609 WP_003899787.1.99617 WP_003899787.1.99635 WP_003899787.1.99650 WP_003899787.1.99672 WP_003899787.1.99701 WP_003899787.1.99711 WP_003899787.1.99716 WP_003899787.1.99740 WP_003899787.1.99745 WP_003899787.1.99749 WP_003899787.1.9976 WP_003899787.1.99798 WP_003899787.1.99817 WP_003899787.1.99832 WP_003899787.1.99847 WP_003899787.1.99852 WP_003899787.1.99886 WP_003899787.1.99897 WP_003899787.1.99899 WP_003899787.1.99915 WP_003899787.1.9993 WP_003899787.1.99982 WP_003899787.1.99991 233413.Mb0048c 336982.TBFG_10046 410289.BCG_0078c 419947.MRA_0050 478434.TBMG_00046 561275.JTY_0048 83332.Rv0047c gi|479053979|ref|YP_007349785.1| gi|339630130|ref|YP_004721772.1| gi|392384767|ref|YP_005306396.1| gi|392430456|ref|YP_006471500.1| gi|197738033|ref|YP_002159349.1| gi|433633060|ref|YP_007266687.1| gi|506924438|ref|YP_008004888.1| gi|525672920|ref|YP_008224146.1| gi|471335837|ref|YP_007608550.1| gi|148821237|ref|YP_001285991.1| gi|224988430|ref|YP_002643097.1| gi|385989579|ref|YP_005907877.1| gi|386003135|ref|YP_005921414.1| gi|375294247|ref|YP_005098514.1| gi|385996818|ref|YP_005915116.1| gi|479312884|ref|YP_007852936.1| gi|148659807|ref|YP_001281330.1| gi|506924438|ref|YP_008004888.1| gi|378769790|ref|YP_005169523.1| gi|31791224|ref|NP_853717.1| gi|15607189|ref|NP_214561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]