SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197738297|ref|YP_002159612.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197738297|ref|YP_002159612.1|
Domain Number 1 Region: 15-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.01e-23
Family ArsR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197738297|ref|YP_002159612.1|
Sequence length 119
Comment transcriptional regulator ArsR-family [Mycobacterium tuberculosis str. Haarlem]
Sequence
MPKSLPVIDISAPVCCAPVAAGPMSDGDALAVALRLKALADPARVKIMSYLFSSPAGEQV
SGQLAAALSLSDGTVSHHLAQLRKAGLVISDRRGMHVFHRVHPEALQALCTVLNPNCCA
Download sequence
Identical sequences A0A045GWH2 A0A083W135 A0A0H3MD24 A0A109SQU7 A0A109SYZ6 A0A197ISP7 A0A1R3Y1T4 A0A1S1BCG8 A0A246BD90 A5U5Z2 F8M2Z4 G0TQP1 I6Y1A7 L0TCY7 M8D3X7 P71939 R4M0F3
gi|506927180|ref|YP_008007630.1| gi|506927180|ref|YP_008007630.1| gi|433627778|ref|YP_007261407.1| gi|385999422|ref|YP_005917721.1| gi|494693116|ref|YP_007958659.1| gi|383308408|ref|YP_005361219.1| gi|15609777|ref|NP_217156.1| gi|15609777|ref|NP_217156.1| 233413.Mb2673c 336982.TBFG_12658 410289.BCG_2667c 419947.MRA_2669 478434.TBMG_01331 561275.JTY_2661 83331.MT2718 83332.Rv2640c gi|479315595|ref|YP_007855647.1| gi|121638529|ref|YP_978753.1| gi|392387276|ref|YP_005308905.1| gi|253798276|ref|YP_003031277.1| gi|386005533|ref|YP_005923812.1| gi|433635722|ref|YP_007269349.1| gi|148662481|ref|YP_001284004.1| gi|340627661|ref|YP_004746113.1| NP_217156.1.84033 WP_003413665.1.100000 WP_003413665.1.100021 WP_003413665.1.100069 WP_003413665.1.100087 WP_003413665.1.10015 WP_003413665.1.100208 WP_003413665.1.100216 WP_003413665.1.10022 WP_003413665.1.100255 WP_003413665.1.100260 WP_003413665.1.100270 WP_003413665.1.100286 WP_003413665.1.100308 WP_003413665.1.100309 WP_003413665.1.100318 WP_003413665.1.100337 WP_003413665.1.100338 WP_003413665.1.10037 WP_003413665.1.100383 WP_003413665.1.100395 WP_003413665.1.100396 WP_003413665.1.1004 WP_003413665.1.100401 WP_003413665.1.100459 WP_003413665.1.100460 WP_003413665.1.100552 WP_003413665.1.100581 WP_003413665.1.100600 WP_003413665.1.100625 WP_003413665.1.10064 WP_003413665.1.100666 WP_003413665.1.100671 WP_003413665.1.100677 WP_003413665.1.100682 WP_003413665.1.100697 WP_003413665.1.100703 WP_003413665.1.100716 WP_003413665.1.100722 WP_003413665.1.100754 WP_003413665.1.100757 WP_003413665.1.100772 WP_003413665.1.1008 WP_003413665.1.100812 WP_003413665.1.100845 WP_003413665.1.100866 WP_003413665.1.10088 WP_003413665.1.100889 WP_003413665.1.10090 WP_003413665.1.100910 WP_003413665.1.100915 WP_003413665.1.100918 WP_003413665.1.100935 WP_003413665.1.100984 WP_003413665.1.100992 WP_003413665.1.100998 WP_003413665.1.101 WP_003413665.1.101025 WP_003413665.1.101028 WP_003413665.1.10104 WP_003413665.1.101048 WP_003413665.1.101054 WP_003413665.1.101075 WP_003413665.1.101143 WP_003413665.1.101146 WP_003413665.1.10116 WP_003413665.1.10117 WP_003413665.1.101209 WP_003413665.1.10125 WP_003413665.1.101290 WP_003413665.1.101323 WP_003413665.1.101324 WP_003413665.1.101350 WP_003413665.1.101367 WP_003413665.1.101398 WP_003413665.1.101403 WP_003413665.1.101421 WP_003413665.1.10144 WP_003413665.1.101442 WP_003413665.1.10145 WP_003413665.1.101452 WP_003413665.1.101456 WP_003413665.1.101481 WP_003413665.1.101493 WP_003413665.1.101496 WP_003413665.1.101525 WP_003413665.1.101533 WP_003413665.1.101535 WP_003413665.1.101553 WP_003413665.1.101558 WP_003413665.1.10156 WP_003413665.1.101573 WP_003413665.1.101576 WP_003413665.1.10159 WP_003413665.1.101592 WP_003413665.1.101604 WP_003413665.1.101607 WP_003413665.1.101622 WP_003413665.1.101644 WP_003413665.1.101659 WP_003413665.1.101671 WP_003413665.1.101687 WP_003413665.1.101698 WP_003413665.1.10170 WP_003413665.1.101713 WP_003413665.1.101722 WP_003413665.1.101733 WP_003413665.1.101743 WP_003413665.1.101753 WP_003413665.1.101754 WP_003413665.1.101764 WP_003413665.1.101795 WP_003413665.1.101797 WP_003413665.1.101798 WP_003413665.1.101802 WP_003413665.1.101826 WP_003413665.1.101836 WP_003413665.1.101858 WP_003413665.1.101859 WP_003413665.1.101862 WP_003413665.1.101888 WP_003413665.1.101894 WP_003413665.1.101899 WP_003413665.1.1019 WP_003413665.1.101923 WP_003413665.1.101925 WP_003413665.1.10193 WP_003413665.1.101996 WP_003413665.1.102 WP_003413665.1.102008 WP_003413665.1.102017 WP_003413665.1.102053 WP_003413665.1.102055 WP_003413665.1.102063 WP_003413665.1.102099 WP_003413665.1.1021 WP_003413665.1.10211 WP_003413665.1.102119 WP_003413665.1.102121 WP_003413665.1.102143 WP_003413665.1.10216 WP_003413665.1.10224 WP_003413665.1.10253 WP_003413665.1.10262 WP_003413665.1.10272 WP_003413665.1.10277 WP_003413665.1.1033 WP_003413665.1.10350 WP_003413665.1.10362 WP_003413665.1.10366 WP_003413665.1.10376 WP_003413665.1.10396 WP_003413665.1.10410 WP_003413665.1.10414 WP_003413665.1.10421 WP_003413665.1.10430 WP_003413665.1.1044 WP_003413665.1.10440 WP_003413665.1.10445 WP_003413665.1.10471 WP_003413665.1.10472 WP_003413665.1.10489 WP_003413665.1.105 WP_003413665.1.10518 WP_003413665.1.10523 WP_003413665.1.10545 WP_003413665.1.1057 WP_003413665.1.10594 WP_003413665.1.10603 WP_003413665.1.10606 WP_003413665.1.10615 WP_003413665.1.10623 WP_003413665.1.10635 WP_003413665.1.10643 WP_003413665.1.10648 WP_003413665.1.10662 WP_003413665.1.10709 WP_003413665.1.10735 WP_003413665.1.10740 WP_003413665.1.10756 WP_003413665.1.1078 WP_003413665.1.10791 WP_003413665.1.10799 WP_003413665.1.10825 WP_003413665.1.10848 WP_003413665.1.10863 WP_003413665.1.10879 WP_003413665.1.10912 WP_003413665.1.10916 WP_003413665.1.10923 WP_003413665.1.10927 WP_003413665.1.1095 WP_003413665.1.10956 WP_003413665.1.10958 WP_003413665.1.10962 WP_003413665.1.10980 WP_003413665.1.10981 WP_003413665.1.10993 WP_003413665.1.1100 WP_003413665.1.11040 WP_003413665.1.11061 WP_003413665.1.11070 WP_003413665.1.11141 WP_003413665.1.11171 WP_003413665.1.11175 WP_003413665.1.11176 WP_003413665.1.11222 WP_003413665.1.11236 WP_003413665.1.11329 WP_003413665.1.1133 WP_003413665.1.11342 WP_003413665.1.11373 WP_003413665.1.11376 WP_003413665.1.11390 WP_003413665.1.11402 WP_003413665.1.11481 WP_003413665.1.11487 WP_003413665.1.11489 WP_003413665.1.11491 WP_003413665.1.11514 WP_003413665.1.11587 WP_003413665.1.11589 WP_003413665.1.11596 WP_003413665.1.11604 WP_003413665.1.11610 WP_003413665.1.11697 WP_003413665.1.11707 WP_003413665.1.11752 WP_003413665.1.11758 WP_003413665.1.11761 WP_003413665.1.11775 WP_003413665.1.11804 WP_003413665.1.11822 WP_003413665.1.11826 WP_003413665.1.11856 WP_003413665.1.11898 WP_003413665.1.11906 WP_003413665.1.11939 WP_003413665.1.11960 WP_003413665.1.11961 WP_003413665.1.11972 WP_003413665.1.11984 WP_003413665.1.120 WP_003413665.1.12001 WP_003413665.1.12049 WP_003413665.1.12052 WP_003413665.1.12100 WP_003413665.1.12116 WP_003413665.1.12130 WP_003413665.1.12133 WP_003413665.1.12161 WP_003413665.1.12165 WP_003413665.1.12184 WP_003413665.1.12187 WP_003413665.1.12190 WP_003413665.1.12216 WP_003413665.1.12265 WP_003413665.1.12275 WP_003413665.1.12293 WP_003413665.1.12294 WP_003413665.1.123 WP_003413665.1.1231 WP_003413665.1.12314 WP_003413665.1.12327 WP_003413665.1.12338 WP_003413665.1.1236 WP_003413665.1.12371 WP_003413665.1.12372 WP_003413665.1.12389 WP_003413665.1.12406 WP_003413665.1.1241 WP_003413665.1.12421 WP_003413665.1.12424 WP_003413665.1.12446 WP_003413665.1.12464 WP_003413665.1.12479 WP_003413665.1.12519 WP_003413665.1.12523 WP_003413665.1.12526 WP_003413665.1.1255 WP_003413665.1.12550 WP_003413665.1.12551 WP_003413665.1.12563 WP_003413665.1.12611 WP_003413665.1.12669 WP_003413665.1.1267 WP_003413665.1.12672 WP_003413665.1.12692 WP_003413665.1.1271 WP_003413665.1.12710 WP_003413665.1.12768 WP_003413665.1.1279 WP_003413665.1.12794 WP_003413665.1.12801 WP_003413665.1.12804 WP_003413665.1.12821 WP_003413665.1.12841 WP_003413665.1.12854 WP_003413665.1.12871 WP_003413665.1.12901 WP_003413665.1.12941 WP_003413665.1.12947 WP_003413665.1.12957 WP_003413665.1.12972 WP_003413665.1.13028 WP_003413665.1.13043 WP_003413665.1.13086 WP_003413665.1.13087 WP_003413665.1.13090 WP_003413665.1.13096 WP_003413665.1.13163 WP_003413665.1.13175 WP_003413665.1.13183 WP_003413665.1.132 WP_003413665.1.13249 WP_003413665.1.13282 WP_003413665.1.13284 WP_003413665.1.13296 WP_003413665.1.13298 WP_003413665.1.13302 WP_003413665.1.13306 WP_003413665.1.13312 WP_003413665.1.13313 WP_003413665.1.13321 WP_003413665.1.13345 WP_003413665.1.13358 WP_003413665.1.13370 WP_003413665.1.13375 WP_003413665.1.1338 WP_003413665.1.13420 WP_003413665.1.13433 WP_003413665.1.13435 WP_003413665.1.13438 WP_003413665.1.13461 WP_003413665.1.13466 WP_003413665.1.13489 WP_003413665.1.13526 WP_003413665.1.13551 WP_003413665.1.13561 WP_003413665.1.13564 WP_003413665.1.13579 WP_003413665.1.13647 WP_003413665.1.13667 WP_003413665.1.13687 WP_003413665.1.13697 WP_003413665.1.13719 WP_003413665.1.13763 WP_003413665.1.1377 WP_003413665.1.13774 WP_003413665.1.13786 WP_003413665.1.13793 WP_003413665.1.13794 WP_003413665.1.13817 WP_003413665.1.13834 WP_003413665.1.13866 WP_003413665.1.13880 WP_003413665.1.13899 WP_003413665.1.13909 WP_003413665.1.13910 WP_003413665.1.13919 WP_003413665.1.13920 WP_003413665.1.13952 WP_003413665.1.13953 WP_003413665.1.13962 WP_003413665.1.1398 WP_003413665.1.13988 WP_003413665.1.14027 WP_003413665.1.14046 WP_003413665.1.14115 WP_003413665.1.1415 WP_003413665.1.14152 WP_003413665.1.14158 WP_003413665.1.14162 WP_003413665.1.14175 WP_003413665.1.14178 WP_003413665.1.14194 WP_003413665.1.14195 WP_003413665.1.14208 WP_003413665.1.14238 WP_003413665.1.14266 WP_003413665.1.14273 WP_003413665.1.14303 WP_003413665.1.14306 WP_003413665.1.14307 WP_003413665.1.14310 WP_003413665.1.14341 WP_003413665.1.14382 WP_003413665.1.14416 WP_003413665.1.14428 WP_003413665.1.14441 WP_003413665.1.14469 WP_003413665.1.14477 WP_003413665.1.14504 WP_003413665.1.14514 WP_003413665.1.1452 WP_003413665.1.14527 WP_003413665.1.1454 WP_003413665.1.14544 WP_003413665.1.14548 WP_003413665.1.14551 WP_003413665.1.14561 WP_003413665.1.14573 WP_003413665.1.1462 WP_003413665.1.14658 WP_003413665.1.14667 WP_003413665.1.14668 WP_003413665.1.14675 WP_003413665.1.14694 WP_003413665.1.14695 WP_003413665.1.14709 WP_003413665.1.14766 WP_003413665.1.14783 WP_003413665.1.14865 WP_003413665.1.14872 WP_003413665.1.14905 WP_003413665.1.14926 WP_003413665.1.14951 WP_003413665.1.14955 WP_003413665.1.15003 WP_003413665.1.15009 WP_003413665.1.15028 WP_003413665.1.15040 WP_003413665.1.15052 WP_003413665.1.15065 WP_003413665.1.15072 WP_003413665.1.15089 WP_003413665.1.1509 WP_003413665.1.15126 WP_003413665.1.15131 WP_003413665.1.15168 WP_003413665.1.15172 WP_003413665.1.15174 WP_003413665.1.15187 WP_003413665.1.15196 WP_003413665.1.15210 WP_003413665.1.15216 WP_003413665.1.15217 WP_003413665.1.1523 WP_003413665.1.15232 WP_003413665.1.15238 WP_003413665.1.15240 WP_003413665.1.15253 WP_003413665.1.15267 WP_003413665.1.1527 WP_003413665.1.15292 WP_003413665.1.15299 WP_003413665.1.15302 WP_003413665.1.15322 WP_003413665.1.1534 WP_003413665.1.15345 WP_003413665.1.15365 WP_003413665.1.15372 WP_003413665.1.15386 WP_003413665.1.15387 WP_003413665.1.15442 WP_003413665.1.15447 WP_003413665.1.15449 WP_003413665.1.15477 WP_003413665.1.15481 WP_003413665.1.15492 WP_003413665.1.15511 WP_003413665.1.15512 WP_003413665.1.15558 WP_003413665.1.15559 WP_003413665.1.15566 WP_003413665.1.15599 WP_003413665.1.1560 WP_003413665.1.15611 WP_003413665.1.1563 WP_003413665.1.15633 WP_003413665.1.15643 WP_003413665.1.15688 WP_003413665.1.15755 WP_003413665.1.15763 WP_003413665.1.15774 WP_003413665.1.1578 WP_003413665.1.15780 WP_003413665.1.15827 WP_003413665.1.15834 WP_003413665.1.15842 WP_003413665.1.15848 WP_003413665.1.15853 WP_003413665.1.15870 WP_003413665.1.15877 WP_003413665.1.15893 WP_003413665.1.15896 WP_003413665.1.15926 WP_003413665.1.15933 WP_003413665.1.15946 WP_003413665.1.15958 WP_003413665.1.15973 WP_003413665.1.15987 WP_003413665.1.15993 WP_003413665.1.16009 WP_003413665.1.16025 WP_003413665.1.16043 WP_003413665.1.16055 WP_003413665.1.16066 WP_003413665.1.16069 WP_003413665.1.16077 WP_003413665.1.16106 WP_003413665.1.16108 WP_003413665.1.16110 WP_003413665.1.16130 WP_003413665.1.16136 WP_003413665.1.16139 WP_003413665.1.16141 WP_003413665.1.16143 WP_003413665.1.1630 WP_003413665.1.16318 WP_003413665.1.1632 WP_003413665.1.16327 WP_003413665.1.16334 WP_003413665.1.16341 WP_003413665.1.16345 WP_003413665.1.16374 WP_003413665.1.16384 WP_003413665.1.16386 WP_003413665.1.164 WP_003413665.1.1642 WP_003413665.1.16421 WP_003413665.1.16424 WP_003413665.1.16426 WP_003413665.1.16431 WP_003413665.1.16438 WP_003413665.1.1644 WP_003413665.1.16442 WP_003413665.1.16448 WP_003413665.1.16451 WP_003413665.1.16476 WP_003413665.1.16480 WP_003413665.1.16494 WP_003413665.1.1652 WP_003413665.1.16549 WP_003413665.1.16560 WP_003413665.1.16598 WP_003413665.1.16609 WP_003413665.1.16619 WP_003413665.1.16620 WP_003413665.1.16622 WP_003413665.1.16637 WP_003413665.1.1669 WP_003413665.1.16707 WP_003413665.1.16724 WP_003413665.1.16731 WP_003413665.1.16743 WP_003413665.1.1683 WP_003413665.1.16837 WP_003413665.1.16852 WP_003413665.1.16937 WP_003413665.1.16940 WP_003413665.1.16950 WP_003413665.1.16959 WP_003413665.1.16968 WP_003413665.1.1697 WP_003413665.1.16973 WP_003413665.1.16977 WP_003413665.1.16987 WP_003413665.1.17005 WP_003413665.1.17006 WP_003413665.1.17015 WP_003413665.1.17019 WP_003413665.1.17039 WP_003413665.1.17041 WP_003413665.1.17052 WP_003413665.1.17057 WP_003413665.1.17062 WP_003413665.1.1707 WP_003413665.1.17094 WP_003413665.1.17130 WP_003413665.1.17138 WP_003413665.1.17147 WP_003413665.1.17167 WP_003413665.1.17224 WP_003413665.1.17251 WP_003413665.1.17288 WP_003413665.1.17304 WP_003413665.1.17314 WP_003413665.1.17345 WP_003413665.1.17381 WP_003413665.1.17391 WP_003413665.1.17412 WP_003413665.1.1743 WP_003413665.1.17440 WP_003413665.1.17466 WP_003413665.1.17477 WP_003413665.1.17483 WP_003413665.1.17505 WP_003413665.1.17527 WP_003413665.1.17535 WP_003413665.1.17540 WP_003413665.1.17553 WP_003413665.1.17558 WP_003413665.1.17599 WP_003413665.1.17635 WP_003413665.1.17655 WP_003413665.1.17679 WP_003413665.1.1768 WP_003413665.1.17687 WP_003413665.1.17700 WP_003413665.1.17710 WP_003413665.1.17713 WP_003413665.1.17722 WP_003413665.1.17746 WP_003413665.1.17788 WP_003413665.1.17798 WP_003413665.1.17803 WP_003413665.1.17816 WP_003413665.1.17821 WP_003413665.1.17830 WP_003413665.1.17868 WP_003413665.1.17878 WP_003413665.1.1792 WP_003413665.1.17923 WP_003413665.1.1795 WP_003413665.1.17955 WP_003413665.1.17973 WP_003413665.1.18009 WP_003413665.1.18013 WP_003413665.1.18033 WP_003413665.1.18057 WP_003413665.1.18065 WP_003413665.1.18070 WP_003413665.1.18116 WP_003413665.1.18120 WP_003413665.1.18126 WP_003413665.1.1817 WP_003413665.1.18170 WP_003413665.1.18206 WP_003413665.1.18216 WP_003413665.1.18240 WP_003413665.1.18257 WP_003413665.1.18297 WP_003413665.1.18306 WP_003413665.1.18364 WP_003413665.1.18399 WP_003413665.1.18411 WP_003413665.1.18444 WP_003413665.1.18448 WP_003413665.1.18467 WP_003413665.1.18476 WP_003413665.1.18522 WP_003413665.1.18580 WP_003413665.1.18582 WP_003413665.1.18587 WP_003413665.1.186 WP_003413665.1.18601 WP_003413665.1.18639 WP_003413665.1.18646 WP_003413665.1.18647 WP_003413665.1.1868 WP_003413665.1.18694 WP_003413665.1.18710 WP_003413665.1.18751 WP_003413665.1.18781 WP_003413665.1.18793 WP_003413665.1.18804 WP_003413665.1.18816 WP_003413665.1.18823 WP_003413665.1.18827 WP_003413665.1.18838 WP_003413665.1.18849 WP_003413665.1.18856 WP_003413665.1.18945 WP_003413665.1.1898 WP_003413665.1.19005 WP_003413665.1.19056 WP_003413665.1.19063 WP_003413665.1.19066 WP_003413665.1.19071 WP_003413665.1.19085 WP_003413665.1.19094 WP_003413665.1.19144 WP_003413665.1.19159 WP_003413665.1.19193 WP_003413665.1.19231 WP_003413665.1.19243 WP_003413665.1.19264 WP_003413665.1.19295 WP_003413665.1.19307 WP_003413665.1.19326 WP_003413665.1.1933 WP_003413665.1.19364 WP_003413665.1.19382 WP_003413665.1.19400 WP_003413665.1.19426 WP_003413665.1.19429 WP_003413665.1.19464 WP_003413665.1.19480 WP_003413665.1.19512 WP_003413665.1.19553 WP_003413665.1.19562 WP_003413665.1.19564 WP_003413665.1.19568 WP_003413665.1.19572 WP_003413665.1.19595 WP_003413665.1.19596 WP_003413665.1.19600 WP_003413665.1.19630 WP_003413665.1.1967 WP_003413665.1.19694 WP_003413665.1.1970 WP_003413665.1.19707 WP_003413665.1.19742 WP_003413665.1.19785 WP_003413665.1.19820 WP_003413665.1.19868 WP_003413665.1.19874 WP_003413665.1.19890 WP_003413665.1.19900 WP_003413665.1.19922 WP_003413665.1.19936 WP_003413665.1.19946 WP_003413665.1.19949 WP_003413665.1.19960 WP_003413665.1.19964 WP_003413665.1.20007 WP_003413665.1.20016 WP_003413665.1.20028 WP_003413665.1.2003 WP_003413665.1.20037 WP_003413665.1.20039 WP_003413665.1.20082 WP_003413665.1.20085 WP_003413665.1.20097 WP_003413665.1.20116 WP_003413665.1.20130 WP_003413665.1.20140 WP_003413665.1.20141 WP_003413665.1.20142 WP_003413665.1.20158 WP_003413665.1.20239 WP_003413665.1.20243 WP_003413665.1.20259 WP_003413665.1.20262 WP_003413665.1.20268 WP_003413665.1.20272 WP_003413665.1.20273 WP_003413665.1.20280 WP_003413665.1.20294 WP_003413665.1.20300 WP_003413665.1.20309 WP_003413665.1.20322 WP_003413665.1.2037 WP_003413665.1.20372 WP_003413665.1.20381 WP_003413665.1.204 WP_003413665.1.20427 WP_003413665.1.20432 WP_003413665.1.20457 WP_003413665.1.20459 WP_003413665.1.20460 WP_003413665.1.20542 WP_003413665.1.20578 WP_003413665.1.20608 WP_003413665.1.20624 WP_003413665.1.20628 WP_003413665.1.2066 WP_003413665.1.20707 WP_003413665.1.20722 WP_003413665.1.20729 WP_003413665.1.20742 WP_003413665.1.20751 WP_003413665.1.20776 WP_003413665.1.20843 WP_003413665.1.20850 WP_003413665.1.2086 WP_003413665.1.20868 WP_003413665.1.20876 WP_003413665.1.20897 WP_003413665.1.20898 WP_003413665.1.2090 WP_003413665.1.20911 WP_003413665.1.20916 WP_003413665.1.20921 WP_003413665.1.20926 WP_003413665.1.20927 WP_003413665.1.20951 WP_003413665.1.20970 WP_003413665.1.2104 WP_003413665.1.21070 WP_003413665.1.21127 WP_003413665.1.21135 WP_003413665.1.21173 WP_003413665.1.21187 WP_003413665.1.212 WP_003413665.1.2120 WP_003413665.1.21218 WP_003413665.1.21219 WP_003413665.1.2123 WP_003413665.1.21231 WP_003413665.1.21234 WP_003413665.1.2126 WP_003413665.1.21292 WP_003413665.1.21307 WP_003413665.1.2131 WP_003413665.1.21311 WP_003413665.1.21321 WP_003413665.1.21365 WP_003413665.1.2137 WP_003413665.1.21392 WP_003413665.1.21397 WP_003413665.1.21403 WP_003413665.1.21415 WP_003413665.1.21418 WP_003413665.1.21430 WP_003413665.1.21434 WP_003413665.1.21444 WP_003413665.1.21468 WP_003413665.1.21498 WP_003413665.1.21509 WP_003413665.1.21513 WP_003413665.1.21560 WP_003413665.1.21565 WP_003413665.1.21586 WP_003413665.1.21591 WP_003413665.1.21594 WP_003413665.1.21602 WP_003413665.1.21615 WP_003413665.1.21638 WP_003413665.1.21639 WP_003413665.1.21655 WP_003413665.1.21658 WP_003413665.1.2168 WP_003413665.1.2174 WP_003413665.1.21741 WP_003413665.1.21742 WP_003413665.1.21777 WP_003413665.1.21786 WP_003413665.1.21795 WP_003413665.1.218 WP_003413665.1.21826 WP_003413665.1.21829 WP_003413665.1.21840 WP_003413665.1.21843 WP_003413665.1.21872 WP_003413665.1.21873 WP_003413665.1.2188 WP_003413665.1.21882 WP_003413665.1.21906 WP_003413665.1.21912 WP_003413665.1.2194 WP_003413665.1.21941 WP_003413665.1.21956 WP_003413665.1.21958 WP_003413665.1.21960 WP_003413665.1.21971 WP_003413665.1.21973 WP_003413665.1.21983 WP_003413665.1.22003 WP_003413665.1.22013 WP_003413665.1.22025 WP_003413665.1.22075 WP_003413665.1.22092 WP_003413665.1.2212 WP_003413665.1.22127 WP_003413665.1.22140 WP_003413665.1.22233 WP_003413665.1.22255 WP_003413665.1.22277 WP_003413665.1.22305 WP_003413665.1.22348 WP_003413665.1.22356 WP_003413665.1.22366 WP_003413665.1.2238 WP_003413665.1.22380 WP_003413665.1.22437 WP_003413665.1.22438 WP_003413665.1.22445 WP_003413665.1.22490 WP_003413665.1.22511 WP_003413665.1.22524 WP_003413665.1.2253 WP_003413665.1.22585 WP_003413665.1.22589 WP_003413665.1.22606 WP_003413665.1.22608 WP_003413665.1.22609 WP_003413665.1.22618 WP_003413665.1.2262 WP_003413665.1.22624 WP_003413665.1.22629 WP_003413665.1.22647 WP_003413665.1.22664 WP_003413665.1.22665 WP_003413665.1.22670 WP_003413665.1.22674 WP_003413665.1.22680 WP_003413665.1.22725 WP_003413665.1.22728 WP_003413665.1.22733 WP_003413665.1.22737 WP_003413665.1.2275 WP_003413665.1.22754 WP_003413665.1.22797 WP_003413665.1.22800 WP_003413665.1.22804 WP_003413665.1.22829 WP_003413665.1.22840 WP_003413665.1.22844 WP_003413665.1.22963 WP_003413665.1.22970 WP_003413665.1.22996 WP_003413665.1.22997 WP_003413665.1.22999 WP_003413665.1.23015 WP_003413665.1.23032 WP_003413665.1.231 WP_003413665.1.23101 WP_003413665.1.2312 WP_003413665.1.23140 WP_003413665.1.23153 WP_003413665.1.23171 WP_003413665.1.23199 WP_003413665.1.2320 WP_003413665.1.23204 WP_003413665.1.23216 WP_003413665.1.23229 WP_003413665.1.23233 WP_003413665.1.2326 WP_003413665.1.23261 WP_003413665.1.23272 WP_003413665.1.23289 WP_003413665.1.2329 WP_003413665.1.23308 WP_003413665.1.23316 WP_003413665.1.23321 WP_003413665.1.23325 WP_003413665.1.2339 WP_003413665.1.23406 WP_003413665.1.23438 WP_003413665.1.23445 WP_003413665.1.23447 WP_003413665.1.23452 WP_003413665.1.23461 WP_003413665.1.2349 WP_003413665.1.23496 WP_003413665.1.23497 WP_003413665.1.23506 WP_003413665.1.23530 WP_003413665.1.23539 WP_003413665.1.23546 WP_003413665.1.23551 WP_003413665.1.23573 WP_003413665.1.23583 WP_003413665.1.23588 WP_003413665.1.23628 WP_003413665.1.23677 WP_003413665.1.23683 WP_003413665.1.23692 WP_003413665.1.23694 WP_003413665.1.23699 WP_003413665.1.2371 WP_003413665.1.23803 WP_003413665.1.23807 WP_003413665.1.23825 WP_003413665.1.23832 WP_003413665.1.2384 WP_003413665.1.23843 WP_003413665.1.23863 WP_003413665.1.2387 WP_003413665.1.23894 WP_003413665.1.23993 WP_003413665.1.2400 WP_003413665.1.24007 WP_003413665.1.24008 WP_003413665.1.24046 WP_003413665.1.24057 WP_003413665.1.24062 WP_003413665.1.24113 WP_003413665.1.24119 WP_003413665.1.24128 WP_003413665.1.24140 WP_003413665.1.24176 WP_003413665.1.24190 WP_003413665.1.24202 WP_003413665.1.24244 WP_003413665.1.24261 WP_003413665.1.24284 WP_003413665.1.24294 WP_003413665.1.24357 WP_003413665.1.24396 WP_003413665.1.24414 WP_003413665.1.24423 WP_003413665.1.2443 WP_003413665.1.24446 WP_003413665.1.24461 WP_003413665.1.24500 WP_003413665.1.24507 WP_003413665.1.24509 WP_003413665.1.24529 WP_003413665.1.24553 WP_003413665.1.24599 WP_003413665.1.24629 WP_003413665.1.24638 WP_003413665.1.24648 WP_003413665.1.2466 WP_003413665.1.24767 WP_003413665.1.24824 WP_003413665.1.24831 WP_003413665.1.24840 WP_003413665.1.24848 WP_003413665.1.24857 WP_003413665.1.2487 WP_003413665.1.24893 WP_003413665.1.24907 WP_003413665.1.24933 WP_003413665.1.24956 WP_003413665.1.24958 WP_003413665.1.24985 WP_003413665.1.2499 WP_003413665.1.25004 WP_003413665.1.2505 WP_003413665.1.25051 WP_003413665.1.2507 WP_003413665.1.25096 WP_003413665.1.25103 WP_003413665.1.25129 WP_003413665.1.25171 WP_003413665.1.25184 WP_003413665.1.25247 WP_003413665.1.25252 WP_003413665.1.25278 WP_003413665.1.25283 WP_003413665.1.25309 WP_003413665.1.25313 WP_003413665.1.25338 WP_003413665.1.25342 WP_003413665.1.25343 WP_003413665.1.25367 WP_003413665.1.25393 WP_003413665.1.25406 WP_003413665.1.25435 WP_003413665.1.25437 WP_003413665.1.25445 WP_003413665.1.25455 WP_003413665.1.25473 WP_003413665.1.25504 WP_003413665.1.25513 WP_003413665.1.25542 WP_003413665.1.25579 WP_003413665.1.25594 WP_003413665.1.25606 WP_003413665.1.25645 WP_003413665.1.2566 WP_003413665.1.25673 WP_003413665.1.25674 WP_003413665.1.25693 WP_003413665.1.25699 WP_003413665.1.25727 WP_003413665.1.25736 WP_003413665.1.25738 WP_003413665.1.25756 WP_003413665.1.25759 WP_003413665.1.2580 WP_003413665.1.25813 WP_003413665.1.25853 WP_003413665.1.25854 WP_003413665.1.25874 WP_003413665.1.25885 WP_003413665.1.25892 WP_003413665.1.25906 WP_003413665.1.25914 WP_003413665.1.25916 WP_003413665.1.2594 WP_003413665.1.25954 WP_003413665.1.25965 WP_003413665.1.25972 WP_003413665.1.26017 WP_003413665.1.26032 WP_003413665.1.26038 WP_003413665.1.26072 WP_003413665.1.26089 WP_003413665.1.26097 WP_003413665.1.26098 WP_003413665.1.26108 WP_003413665.1.26109 WP_003413665.1.26118 WP_003413665.1.26126 WP_003413665.1.2614 WP_003413665.1.26168 WP_003413665.1.26182 WP_003413665.1.26190 WP_003413665.1.2620 WP_003413665.1.26234 WP_003413665.1.26243 WP_003413665.1.26265 WP_003413665.1.26267 WP_003413665.1.26292 WP_003413665.1.26310 WP_003413665.1.26328 WP_003413665.1.26349 WP_003413665.1.26366 WP_003413665.1.26374 WP_003413665.1.26407 WP_003413665.1.26412 WP_003413665.1.26454 WP_003413665.1.26464 WP_003413665.1.2653 WP_003413665.1.26560 WP_003413665.1.26571 WP_003413665.1.2659 WP_003413665.1.26597 WP_003413665.1.26603 WP_003413665.1.26629 WP_003413665.1.26651 WP_003413665.1.26702 WP_003413665.1.26707 WP_003413665.1.26710 WP_003413665.1.26719 WP_003413665.1.26737 WP_003413665.1.26738 WP_003413665.1.26745 WP_003413665.1.26756 WP_003413665.1.2676 WP_003413665.1.2677 WP_003413665.1.26779 WP_003413665.1.26780 WP_003413665.1.26798 WP_003413665.1.26854 WP_003413665.1.26868 WP_003413665.1.26876 WP_003413665.1.26888 WP_003413665.1.26914 WP_003413665.1.26945 WP_003413665.1.26959 WP_003413665.1.26969 WP_003413665.1.26984 WP_003413665.1.26992 WP_003413665.1.27004 WP_003413665.1.27017 WP_003413665.1.27045 WP_003413665.1.27074 WP_003413665.1.27075 WP_003413665.1.27128 WP_003413665.1.27130 WP_003413665.1.27139 WP_003413665.1.27152 WP_003413665.1.27162 WP_003413665.1.27164 WP_003413665.1.27193 WP_003413665.1.27235 WP_003413665.1.27254 WP_003413665.1.27278 WP_003413665.1.27343 WP_003413665.1.27352 WP_003413665.1.27369 WP_003413665.1.27391 WP_003413665.1.27398 WP_003413665.1.27402 WP_003413665.1.27410 WP_003413665.1.27411 WP_003413665.1.27449 WP_003413665.1.27460 WP_003413665.1.27463 WP_003413665.1.2749 WP_003413665.1.27492 WP_003413665.1.27528 WP_003413665.1.27541 WP_003413665.1.27576 WP_003413665.1.27582 WP_003413665.1.27596 WP_003413665.1.27607 WP_003413665.1.2766 WP_003413665.1.277 WP_003413665.1.27724 WP_003413665.1.27730 WP_003413665.1.27736 WP_003413665.1.27743 WP_003413665.1.27750 WP_003413665.1.27771 WP_003413665.1.27779 WP_003413665.1.27795 WP_003413665.1.27803 WP_003413665.1.27819 WP_003413665.1.27835 WP_003413665.1.27915 WP_003413665.1.27935 WP_003413665.1.27962 WP_003413665.1.28053 WP_003413665.1.28092 WP_003413665.1.28106 WP_003413665.1.28131 WP_003413665.1.28142 WP_003413665.1.28159 WP_003413665.1.2816 WP_003413665.1.28161 WP_003413665.1.28192 WP_003413665.1.28202 WP_003413665.1.28241 WP_003413665.1.28242 WP_003413665.1.28251 WP_003413665.1.28255 WP_003413665.1.28269 WP_003413665.1.28276 WP_003413665.1.28293 WP_003413665.1.28331 WP_003413665.1.28367 WP_003413665.1.28378 WP_003413665.1.28391 WP_003413665.1.2842 WP_003413665.1.28448 WP_003413665.1.2847 WP_003413665.1.28471 WP_003413665.1.28473 WP_003413665.1.28493 WP_003413665.1.28497 WP_003413665.1.28530 WP_003413665.1.28545 WP_003413665.1.28561 WP_003413665.1.28567 WP_003413665.1.28585 WP_003413665.1.286 WP_003413665.1.28610 WP_003413665.1.28617 WP_003413665.1.28634 WP_003413665.1.28642 WP_003413665.1.28671 WP_003413665.1.28682 WP_003413665.1.28698 WP_003413665.1.28703 WP_003413665.1.28739 WP_003413665.1.28758 WP_003413665.1.28781 WP_003413665.1.28787 WP_003413665.1.28827 WP_003413665.1.28839 WP_003413665.1.28847 WP_003413665.1.28850 WP_003413665.1.28851 WP_003413665.1.28865 WP_003413665.1.28897 WP_003413665.1.28914 WP_003413665.1.28935 WP_003413665.1.28936 WP_003413665.1.28939 WP_003413665.1.28943 WP_003413665.1.28952 WP_003413665.1.28975 WP_003413665.1.2899 WP_003413665.1.28993 WP_003413665.1.29000 WP_003413665.1.2901 WP_003413665.1.29028 WP_003413665.1.29033 WP_003413665.1.29058 WP_003413665.1.29078 WP_003413665.1.29102 WP_003413665.1.29115 WP_003413665.1.2916 WP_003413665.1.29217 WP_003413665.1.29223 WP_003413665.1.29234 WP_003413665.1.29264 WP_003413665.1.29275 WP_003413665.1.29306 WP_003413665.1.29339 WP_003413665.1.29348 WP_003413665.1.29364 WP_003413665.1.29367 WP_003413665.1.2938 WP_003413665.1.29399 WP_003413665.1.29426 WP_003413665.1.2944 WP_003413665.1.29449 WP_003413665.1.29450 WP_003413665.1.29452 WP_003413665.1.2949 WP_003413665.1.29510 WP_003413665.1.29515 WP_003413665.1.29525 WP_003413665.1.2953 WP_003413665.1.29559 WP_003413665.1.29587 WP_003413665.1.2959 WP_003413665.1.29592 WP_003413665.1.29599 WP_003413665.1.29611 WP_003413665.1.29632 WP_003413665.1.29649 WP_003413665.1.2965 WP_003413665.1.29659 WP_003413665.1.2969 WP_003413665.1.29696 WP_003413665.1.29698 WP_003413665.1.29718 WP_003413665.1.29742 WP_003413665.1.29745 WP_003413665.1.29747 WP_003413665.1.29769 WP_003413665.1.29825 WP_003413665.1.29830 WP_003413665.1.29847 WP_003413665.1.29861 WP_003413665.1.29869 WP_003413665.1.29883 WP_003413665.1.29890 WP_003413665.1.299 WP_003413665.1.29931 WP_003413665.1.29960 WP_003413665.1.30014 WP_003413665.1.3004 WP_003413665.1.30040 WP_003413665.1.30043 WP_003413665.1.30074 WP_003413665.1.30097 WP_003413665.1.30101 WP_003413665.1.30106 WP_003413665.1.30114 WP_003413665.1.30126 WP_003413665.1.30131 WP_003413665.1.30138 WP_003413665.1.30139 WP_003413665.1.30145 WP_003413665.1.30211 WP_003413665.1.30224 WP_003413665.1.30235 WP_003413665.1.30237 WP_003413665.1.3027 WP_003413665.1.30279 WP_003413665.1.30282 WP_003413665.1.30283 WP_003413665.1.30288 WP_003413665.1.30291 WP_003413665.1.30363 WP_003413665.1.30374 WP_003413665.1.30404 WP_003413665.1.3043 WP_003413665.1.30433 WP_003413665.1.30438 WP_003413665.1.30462 WP_003413665.1.30464 WP_003413665.1.30468 WP_003413665.1.30500 WP_003413665.1.3057 WP_003413665.1.30574 WP_003413665.1.30628 WP_003413665.1.30641 WP_003413665.1.30642 WP_003413665.1.30661 WP_003413665.1.30669 WP_003413665.1.30683 WP_003413665.1.30699 WP_003413665.1.30709 WP_003413665.1.30713 WP_003413665.1.30716 WP_003413665.1.30719 WP_003413665.1.30730 WP_003413665.1.30732 WP_003413665.1.30736 WP_003413665.1.30745 WP_003413665.1.30760 WP_003413665.1.30791 WP_003413665.1.308 WP_003413665.1.30807 WP_003413665.1.30818 WP_003413665.1.30824 WP_003413665.1.30848 WP_003413665.1.30877 WP_003413665.1.30888 WP_003413665.1.30901 WP_003413665.1.30903 WP_003413665.1.30912 WP_003413665.1.30913 WP_003413665.1.30919 WP_003413665.1.30977 WP_003413665.1.3100 WP_003413665.1.31002 WP_003413665.1.3101 WP_003413665.1.31034 WP_003413665.1.31047 WP_003413665.1.31070 WP_003413665.1.31074 WP_003413665.1.31102 WP_003413665.1.31127 WP_003413665.1.31184 WP_003413665.1.31199 WP_003413665.1.31226 WP_003413665.1.31230 WP_003413665.1.31233 WP_003413665.1.31263 WP_003413665.1.31264 WP_003413665.1.31270 WP_003413665.1.31287 WP_003413665.1.31290 WP_003413665.1.31304 WP_003413665.1.31346 WP_003413665.1.31348 WP_003413665.1.31354 WP_003413665.1.31390 WP_003413665.1.31414 WP_003413665.1.31417 WP_003413665.1.31428 WP_003413665.1.3143 WP_003413665.1.31458 WP_003413665.1.31483 WP_003413665.1.3149 WP_003413665.1.31498 WP_003413665.1.31507 WP_003413665.1.31537 WP_003413665.1.31548 WP_003413665.1.31569 WP_003413665.1.31573 WP_003413665.1.316 WP_003413665.1.31629 WP_003413665.1.31666 WP_003413665.1.31693 WP_003413665.1.31703 WP_003413665.1.31744 WP_003413665.1.31745 WP_003413665.1.31770 WP_003413665.1.31776 WP_003413665.1.31783 WP_003413665.1.318 WP_003413665.1.3184 WP_003413665.1.31840 WP_003413665.1.31880 WP_003413665.1.31911 WP_003413665.1.31930 WP_003413665.1.31932 WP_003413665.1.31955 WP_003413665.1.31985 WP_003413665.1.31991 WP_003413665.1.31995 WP_003413665.1.32004 WP_003413665.1.32039 WP_003413665.1.3204 WP_003413665.1.32045 WP_003413665.1.32071 WP_003413665.1.32098 WP_003413665.1.32132 WP_003413665.1.32157 WP_003413665.1.32164 WP_003413665.1.32179 WP_003413665.1.32198 WP_003413665.1.32297 WP_003413665.1.32317 WP_003413665.1.32383 WP_003413665.1.32400 WP_003413665.1.32403 WP_003413665.1.32416 WP_003413665.1.32421 WP_003413665.1.32433 WP_003413665.1.32461 WP_003413665.1.32482 WP_003413665.1.32503 WP_003413665.1.32556 WP_003413665.1.32562 WP_003413665.1.32569 WP_003413665.1.32592 WP_003413665.1.32620 WP_003413665.1.32647 WP_003413665.1.32653 WP_003413665.1.32654 WP_003413665.1.3268 WP_003413665.1.32695 WP_003413665.1.32706 WP_003413665.1.32716 WP_003413665.1.32738 WP_003413665.1.32752 WP_003413665.1.32780 WP_003413665.1.32781 WP_003413665.1.32793 WP_003413665.1.32799 WP_003413665.1.32822 WP_003413665.1.32833 WP_003413665.1.32862 WP_003413665.1.32880 WP_003413665.1.32897 WP_003413665.1.32909 WP_003413665.1.32935 WP_003413665.1.32974 WP_003413665.1.33007 WP_003413665.1.3302 WP_003413665.1.33028 WP_003413665.1.33035 WP_003413665.1.33044 WP_003413665.1.33054 WP_003413665.1.33082 WP_003413665.1.33141 WP_003413665.1.33148 WP_003413665.1.33155 WP_003413665.1.33168 WP_003413665.1.3321 WP_003413665.1.33215 WP_003413665.1.3325 WP_003413665.1.3327 WP_003413665.1.33278 WP_003413665.1.33288 WP_003413665.1.33305 WP_003413665.1.3331 WP_003413665.1.33319 WP_003413665.1.3333 WP_003413665.1.33393 WP_003413665.1.33403 WP_003413665.1.33452 WP_003413665.1.33467 WP_003413665.1.33477 WP_003413665.1.3349 WP_003413665.1.33519 WP_003413665.1.33542 WP_003413665.1.33601 WP_003413665.1.33602 WP_003413665.1.33633 WP_003413665.1.33646 WP_003413665.1.33673 WP_003413665.1.3369 WP_003413665.1.33705 WP_003413665.1.33762 WP_003413665.1.33783 WP_003413665.1.33789 WP_003413665.1.3383 WP_003413665.1.33832 WP_003413665.1.33839 WP_003413665.1.33848 WP_003413665.1.3387 WP_003413665.1.33886 WP_003413665.1.33895 WP_003413665.1.33906 WP_003413665.1.33912 WP_003413665.1.33954 WP_003413665.1.3399 WP_003413665.1.34042 WP_003413665.1.3405 WP_003413665.1.34055 WP_003413665.1.34056 WP_003413665.1.34065 WP_003413665.1.3408 WP_003413665.1.34090 WP_003413665.1.34109 WP_003413665.1.34111 WP_003413665.1.34131 WP_003413665.1.34152 WP_003413665.1.34153 WP_003413665.1.34163 WP_003413665.1.34181 WP_003413665.1.34197 WP_003413665.1.34198 WP_003413665.1.34215 WP_003413665.1.34219 WP_003413665.1.34255 WP_003413665.1.34260 WP_003413665.1.34275 WP_003413665.1.343 WP_003413665.1.34347 WP_003413665.1.34358 WP_003413665.1.34392 WP_003413665.1.344 WP_003413665.1.34428 WP_003413665.1.3443 WP_003413665.1.34435 WP_003413665.1.34446 WP_003413665.1.34499 WP_003413665.1.34505 WP_003413665.1.34516 WP_003413665.1.34529 WP_003413665.1.34563 WP_003413665.1.34576 WP_003413665.1.34581 WP_003413665.1.34588 WP_003413665.1.34596 WP_003413665.1.34599 WP_003413665.1.34639 WP_003413665.1.34673 WP_003413665.1.34724 WP_003413665.1.34740 WP_003413665.1.34755 WP_003413665.1.34777 WP_003413665.1.34783 WP_003413665.1.34841 WP_003413665.1.34908 WP_003413665.1.34919 WP_003413665.1.3492 WP_003413665.1.34933 WP_003413665.1.34945 WP_003413665.1.34946 WP_003413665.1.34954 WP_003413665.1.34960 WP_003413665.1.34961 WP_003413665.1.34963 WP_003413665.1.34965 WP_003413665.1.34968 WP_003413665.1.35023 WP_003413665.1.35069 WP_003413665.1.35072 WP_003413665.1.35078 WP_003413665.1.35100 WP_003413665.1.35146 WP_003413665.1.35156 WP_003413665.1.35160 WP_003413665.1.35162 WP_003413665.1.35173 WP_003413665.1.35176 WP_003413665.1.3520 WP_003413665.1.35213 WP_003413665.1.35221 WP_003413665.1.35246 WP_003413665.1.35278 WP_003413665.1.35301 WP_003413665.1.35311 WP_003413665.1.35312 WP_003413665.1.35317 WP_003413665.1.35319 WP_003413665.1.35347 WP_003413665.1.35363 WP_003413665.1.35382 WP_003413665.1.35385 WP_003413665.1.35396 WP_003413665.1.35397 WP_003413665.1.35426 WP_003413665.1.35439 WP_003413665.1.35455 WP_003413665.1.3548 WP_003413665.1.35484 WP_003413665.1.35492 WP_003413665.1.3553 WP_003413665.1.35553 WP_003413665.1.35555 WP_003413665.1.35561 WP_003413665.1.35602 WP_003413665.1.35610 WP_003413665.1.35635 WP_003413665.1.35657 WP_003413665.1.35680 WP_003413665.1.35687 WP_003413665.1.35689 WP_003413665.1.35707 WP_003413665.1.35732 WP_003413665.1.35754 WP_003413665.1.35767 WP_003413665.1.35770 WP_003413665.1.35771 WP_003413665.1.35780 WP_003413665.1.35805 WP_003413665.1.35811 WP_003413665.1.35821 WP_003413665.1.3584 WP_003413665.1.35848 WP_003413665.1.35864 WP_003413665.1.35874 WP_003413665.1.35876 WP_003413665.1.35897 WP_003413665.1.35899 WP_003413665.1.35923 WP_003413665.1.3593 WP_003413665.1.35954 WP_003413665.1.36005 WP_003413665.1.36014 WP_003413665.1.36023 WP_003413665.1.36051 WP_003413665.1.36053 WP_003413665.1.36075 WP_003413665.1.36089 WP_003413665.1.36097 WP_003413665.1.36098 WP_003413665.1.36116 WP_003413665.1.36145 WP_003413665.1.36156 WP_003413665.1.36205 WP_003413665.1.36228 WP_003413665.1.36246 WP_003413665.1.36252 WP_003413665.1.36260 WP_003413665.1.36270 WP_003413665.1.36271 WP_003413665.1.36303 WP_003413665.1.36309 WP_003413665.1.36315 WP_003413665.1.36319 WP_003413665.1.36321 WP_003413665.1.36326 WP_003413665.1.3634 WP_003413665.1.36356 WP_003413665.1.36357 WP_003413665.1.3636 WP_003413665.1.36385 WP_003413665.1.36399 WP_003413665.1.36436 WP_003413665.1.36465 WP_003413665.1.36469 WP_003413665.1.36473 WP_003413665.1.36485 WP_003413665.1.36508 WP_003413665.1.36540 WP_003413665.1.36561 WP_003413665.1.36571 WP_003413665.1.36573 WP_003413665.1.36578 WP_003413665.1.36585 WP_003413665.1.36597 WP_003413665.1.36614 WP_003413665.1.36657 WP_003413665.1.36674 WP_003413665.1.36720 WP_003413665.1.36727 WP_003413665.1.36733 WP_003413665.1.36785 WP_003413665.1.36810 WP_003413665.1.36844 WP_003413665.1.36851 WP_003413665.1.36862 WP_003413665.1.36893 WP_003413665.1.36901 WP_003413665.1.36921 WP_003413665.1.36935 WP_003413665.1.36941 WP_003413665.1.3695 WP_003413665.1.36951 WP_003413665.1.36968 WP_003413665.1.3700 WP_003413665.1.37004 WP_003413665.1.37012 WP_003413665.1.37071 WP_003413665.1.37088 WP_003413665.1.37131 WP_003413665.1.37157 WP_003413665.1.37175 WP_003413665.1.37188 WP_003413665.1.37213 WP_003413665.1.37229 WP_003413665.1.3724 WP_003413665.1.37277 WP_003413665.1.37305 WP_003413665.1.37330 WP_003413665.1.37389 WP_003413665.1.37400 WP_003413665.1.37440 WP_003413665.1.37459 WP_003413665.1.37468 WP_003413665.1.37475 WP_003413665.1.37484 WP_003413665.1.37601 WP_003413665.1.37612 WP_003413665.1.37632 WP_003413665.1.37643 WP_003413665.1.37655 WP_003413665.1.37660 WP_003413665.1.37674 WP_003413665.1.37700 WP_003413665.1.37701 WP_003413665.1.37709 WP_003413665.1.37711 WP_003413665.1.37721 WP_003413665.1.37722 WP_003413665.1.37747 WP_003413665.1.37765 WP_003413665.1.37772 WP_003413665.1.37804 WP_003413665.1.37809 WP_003413665.1.37859 WP_003413665.1.37877 WP_003413665.1.37912 WP_003413665.1.37913 WP_003413665.1.37943 WP_003413665.1.37950 WP_003413665.1.37973 WP_003413665.1.37975 WP_003413665.1.37983 WP_003413665.1.38 WP_003413665.1.38002 WP_003413665.1.3802 WP_003413665.1.38039 WP_003413665.1.38040 WP_003413665.1.38067 WP_003413665.1.38068 WP_003413665.1.38135 WP_003413665.1.38138 WP_003413665.1.38144 WP_003413665.1.38158 WP_003413665.1.38159 WP_003413665.1.38210 WP_003413665.1.38233 WP_003413665.1.38240 WP_003413665.1.38299 WP_003413665.1.38332 WP_003413665.1.38347 WP_003413665.1.38354 WP_003413665.1.38380 WP_003413665.1.38384 WP_003413665.1.38389 WP_003413665.1.38398 WP_003413665.1.38402 WP_003413665.1.38418 WP_003413665.1.38421 WP_003413665.1.38466 WP_003413665.1.38477 WP_003413665.1.38483 WP_003413665.1.3849 WP_003413665.1.385 WP_003413665.1.38530 WP_003413665.1.38535 WP_003413665.1.38539 WP_003413665.1.38594 WP_003413665.1.38601 WP_003413665.1.38611 WP_003413665.1.38638 WP_003413665.1.38639 WP_003413665.1.38646 WP_003413665.1.38648 WP_003413665.1.38654 WP_003413665.1.38659 WP_003413665.1.38660 WP_003413665.1.38666 WP_003413665.1.38671 WP_003413665.1.38672 WP_003413665.1.38677 WP_003413665.1.38750 WP_003413665.1.38772 WP_003413665.1.38812 WP_003413665.1.38821 WP_003413665.1.38844 WP_003413665.1.38863 WP_003413665.1.38865 WP_003413665.1.38873 WP_003413665.1.3889 WP_003413665.1.38894 WP_003413665.1.38909 WP_003413665.1.38939 WP_003413665.1.38974 WP_003413665.1.38975 WP_003413665.1.38991 WP_003413665.1.39025 WP_003413665.1.39070 WP_003413665.1.39072 WP_003413665.1.39095 WP_003413665.1.39106 WP_003413665.1.39165 WP_003413665.1.39174 WP_003413665.1.39176 WP_003413665.1.39178 WP_003413665.1.39190 WP_003413665.1.39201 WP_003413665.1.39207 WP_003413665.1.39211 WP_003413665.1.39236 WP_003413665.1.39239 WP_003413665.1.39252 WP_003413665.1.39266 WP_003413665.1.39288 WP_003413665.1.39295 WP_003413665.1.39306 WP_003413665.1.39359 WP_003413665.1.39364 WP_003413665.1.39400 WP_003413665.1.39447 WP_003413665.1.3945 WP_003413665.1.39450 WP_003413665.1.39455 WP_003413665.1.3949 WP_003413665.1.39521 WP_003413665.1.39560 WP_003413665.1.39592 WP_003413665.1.39593 WP_003413665.1.396 WP_003413665.1.3960 WP_003413665.1.39616 WP_003413665.1.39654 WP_003413665.1.39657 WP_003413665.1.39661 WP_003413665.1.39674 WP_003413665.1.39678 WP_003413665.1.3968 WP_003413665.1.39694 WP_003413665.1.3971 WP_003413665.1.39718 WP_003413665.1.39728 WP_003413665.1.39739 WP_003413665.1.39748 WP_003413665.1.39751 WP_003413665.1.39759 WP_003413665.1.39801 WP_003413665.1.39804 WP_003413665.1.39848 WP_003413665.1.39877 WP_003413665.1.39925 WP_003413665.1.3994 WP_003413665.1.39959 WP_003413665.1.3996 WP_003413665.1.39960 WP_003413665.1.3997 WP_003413665.1.39980 WP_003413665.1.40000 WP_003413665.1.40028 WP_003413665.1.40029 WP_003413665.1.4003 WP_003413665.1.40094 WP_003413665.1.40096 WP_003413665.1.40150 WP_003413665.1.40156 WP_003413665.1.40174 WP_003413665.1.40186 WP_003413665.1.40276 WP_003413665.1.40277 WP_003413665.1.40323 WP_003413665.1.40336 WP_003413665.1.40353 WP_003413665.1.4036 WP_003413665.1.40372 WP_003413665.1.40402 WP_003413665.1.40413 WP_003413665.1.40440 WP_003413665.1.40446 WP_003413665.1.40451 WP_003413665.1.40455 WP_003413665.1.40523 WP_003413665.1.40543 WP_003413665.1.40641 WP_003413665.1.40646 WP_003413665.1.40651 WP_003413665.1.40653 WP_003413665.1.4067 WP_003413665.1.40705 WP_003413665.1.40723 WP_003413665.1.40731 WP_003413665.1.40735 WP_003413665.1.40795 WP_003413665.1.40799 WP_003413665.1.40852 WP_003413665.1.40876 WP_003413665.1.40881 WP_003413665.1.40922 WP_003413665.1.40948 WP_003413665.1.4095 WP_003413665.1.40956 WP_003413665.1.40957 WP_003413665.1.40964 WP_003413665.1.4097 WP_003413665.1.410 WP_003413665.1.41000 WP_003413665.1.41055 WP_003413665.1.41108 WP_003413665.1.41123 WP_003413665.1.41177 WP_003413665.1.41202 WP_003413665.1.41219 WP_003413665.1.41231 WP_003413665.1.41249 WP_003413665.1.4127 WP_003413665.1.41296 WP_003413665.1.41355 WP_003413665.1.41376 WP_003413665.1.41430 WP_003413665.1.41447 WP_003413665.1.41469 WP_003413665.1.41504 WP_003413665.1.41553 WP_003413665.1.41564 WP_003413665.1.41583 WP_003413665.1.41616 WP_003413665.1.41632 WP_003413665.1.41635 WP_003413665.1.41636 WP_003413665.1.41648 WP_003413665.1.41660 WP_003413665.1.41685 WP_003413665.1.41695 WP_003413665.1.41704 WP_003413665.1.4171 WP_003413665.1.41719 WP_003413665.1.41733 WP_003413665.1.41744 WP_003413665.1.41774 WP_003413665.1.41791 WP_003413665.1.41803 WP_003413665.1.41820 WP_003413665.1.41828 WP_003413665.1.41829 WP_003413665.1.41860 WP_003413665.1.41912 WP_003413665.1.41921 WP_003413665.1.41933 WP_003413665.1.41944 WP_003413665.1.42043 WP_003413665.1.42075 WP_003413665.1.42078 WP_003413665.1.42094 WP_003413665.1.42112 WP_003413665.1.4212 WP_003413665.1.42122 WP_003413665.1.42134 WP_003413665.1.42183 WP_003413665.1.42188 WP_003413665.1.42201 WP_003413665.1.42202 WP_003413665.1.42208 WP_003413665.1.42247 WP_003413665.1.42255 WP_003413665.1.42273 WP_003413665.1.42278 WP_003413665.1.42304 WP_003413665.1.42309 WP_003413665.1.42370 WP_003413665.1.42385 WP_003413665.1.42400 WP_003413665.1.42409 WP_003413665.1.42414 WP_003413665.1.42417 WP_003413665.1.42430 WP_003413665.1.42465 WP_003413665.1.42467 WP_003413665.1.42473 WP_003413665.1.42474 WP_003413665.1.4248 WP_003413665.1.42494 WP_003413665.1.42519 WP_003413665.1.42524 WP_003413665.1.42534 WP_003413665.1.4255 WP_003413665.1.42562 WP_003413665.1.42568 WP_003413665.1.42570 WP_003413665.1.42618 WP_003413665.1.42660 WP_003413665.1.42695 WP_003413665.1.42704 WP_003413665.1.42705 WP_003413665.1.42722 WP_003413665.1.42777 WP_003413665.1.42782 WP_003413665.1.42835 WP_003413665.1.42839 WP_003413665.1.42842 WP_003413665.1.42905 WP_003413665.1.42916 WP_003413665.1.42930 WP_003413665.1.42971 WP_003413665.1.43005 WP_003413665.1.43009 WP_003413665.1.43053 WP_003413665.1.43082 WP_003413665.1.43087 WP_003413665.1.43098 WP_003413665.1.43208 WP_003413665.1.43236 WP_003413665.1.43246 WP_003413665.1.43255 WP_003413665.1.43266 WP_003413665.1.43269 WP_003413665.1.43273 WP_003413665.1.43296 WP_003413665.1.43306 WP_003413665.1.4335 WP_003413665.1.43368 WP_003413665.1.43395 WP_003413665.1.43457 WP_003413665.1.43462 WP_003413665.1.43475 WP_003413665.1.43478 WP_003413665.1.43484 WP_003413665.1.43557 WP_003413665.1.43578 WP_003413665.1.43588 WP_003413665.1.43643 WP_003413665.1.43664 WP_003413665.1.43684 WP_003413665.1.43686 WP_003413665.1.43706 WP_003413665.1.43716 WP_003413665.1.4377 WP_003413665.1.43781 WP_003413665.1.43794 WP_003413665.1.43815 WP_003413665.1.43846 WP_003413665.1.43861 WP_003413665.1.43863 WP_003413665.1.43866 WP_003413665.1.43872 WP_003413665.1.43885 WP_003413665.1.43897 WP_003413665.1.4390 WP_003413665.1.43902 WP_003413665.1.43921 WP_003413665.1.43936 WP_003413665.1.43937 WP_003413665.1.43960 WP_003413665.1.43965 WP_003413665.1.4399 WP_003413665.1.43993 WP_003413665.1.43996 WP_003413665.1.44 WP_003413665.1.44001 WP_003413665.1.44008 WP_003413665.1.44016 WP_003413665.1.44033 WP_003413665.1.44037 WP_003413665.1.44041 WP_003413665.1.44070 WP_003413665.1.44071 WP_003413665.1.44076 WP_003413665.1.44104 WP_003413665.1.44111 WP_003413665.1.44124 WP_003413665.1.44169 WP_003413665.1.44219 WP_003413665.1.44237 WP_003413665.1.44277 WP_003413665.1.44279 WP_003413665.1.44336 WP_003413665.1.44355 WP_003413665.1.44358 WP_003413665.1.4438 WP_003413665.1.44390 WP_003413665.1.44392 WP_003413665.1.4441 WP_003413665.1.44415 WP_003413665.1.44464 WP_003413665.1.44466 WP_003413665.1.44489 WP_003413665.1.44492 WP_003413665.1.44494 WP_003413665.1.44500 WP_003413665.1.44519 WP_003413665.1.44526 WP_003413665.1.44532 WP_003413665.1.44534 WP_003413665.1.44562 WP_003413665.1.44589 WP_003413665.1.44597 WP_003413665.1.44600 WP_003413665.1.44602 WP_003413665.1.44615 WP_003413665.1.4464 WP_003413665.1.44651 WP_003413665.1.44659 WP_003413665.1.44665 WP_003413665.1.44694 WP_003413665.1.44700 WP_003413665.1.44713 WP_003413665.1.44735 WP_003413665.1.44740 WP_003413665.1.44757 WP_003413665.1.4476 WP_003413665.1.44761 WP_003413665.1.44767 WP_003413665.1.44776 WP_003413665.1.44779 WP_003413665.1.44786 WP_003413665.1.44808 WP_003413665.1.44864 WP_003413665.1.44901 WP_003413665.1.44908 WP_003413665.1.44913 WP_003413665.1.4492 WP_003413665.1.44939 WP_003413665.1.44979 WP_003413665.1.44981 WP_003413665.1.45002 WP_003413665.1.45011 WP_003413665.1.4504 WP_003413665.1.45062 WP_003413665.1.45066 WP_003413665.1.45081 WP_003413665.1.45113 WP_003413665.1.45129 WP_003413665.1.45135 WP_003413665.1.45147 WP_003413665.1.45168 WP_003413665.1.4517 WP_003413665.1.45181 WP_003413665.1.45185 WP_003413665.1.45192 WP_003413665.1.45200 WP_003413665.1.45205 WP_003413665.1.45211 WP_003413665.1.45249 WP_003413665.1.4526 WP_003413665.1.45286 WP_003413665.1.45326 WP_003413665.1.45347 WP_003413665.1.45374 WP_003413665.1.45390 WP_003413665.1.454 WP_003413665.1.45407 WP_003413665.1.45451 WP_003413665.1.45453 WP_003413665.1.45460 WP_003413665.1.45463 WP_003413665.1.45470 WP_003413665.1.45474 WP_003413665.1.45491 WP_003413665.1.45510 WP_003413665.1.45563 WP_003413665.1.45584 WP_003413665.1.45590 WP_003413665.1.45619 WP_003413665.1.45626 WP_003413665.1.45631 WP_003413665.1.45666 WP_003413665.1.45697 WP_003413665.1.4571 WP_003413665.1.45731 WP_003413665.1.45743 WP_003413665.1.45765 WP_003413665.1.45776 WP_003413665.1.45783 WP_003413665.1.45805 WP_003413665.1.45815 WP_003413665.1.45849 WP_003413665.1.45867 WP_003413665.1.45884 WP_003413665.1.4590 WP_003413665.1.45923 WP_003413665.1.45926 WP_003413665.1.45963 WP_003413665.1.45989 WP_003413665.1.45992 WP_003413665.1.46025 WP_003413665.1.46083 WP_003413665.1.46090 WP_003413665.1.46092 WP_003413665.1.46100 WP_003413665.1.46101 WP_003413665.1.46103 WP_003413665.1.46107 WP_003413665.1.46127 WP_003413665.1.46128 WP_003413665.1.46129 WP_003413665.1.46141 WP_003413665.1.46150 WP_003413665.1.46201 WP_003413665.1.46226 WP_003413665.1.4624 WP_003413665.1.46253 WP_003413665.1.46268 WP_003413665.1.46285 WP_003413665.1.46300 WP_003413665.1.46313 WP_003413665.1.46336 WP_003413665.1.46365 WP_003413665.1.46381 WP_003413665.1.46402 WP_003413665.1.46411 WP_003413665.1.4644 WP_003413665.1.46453 WP_003413665.1.46463 WP_003413665.1.46478 WP_003413665.1.46492 WP_003413665.1.46521 WP_003413665.1.4653 WP_003413665.1.46532 WP_003413665.1.46539 WP_003413665.1.46568 WP_003413665.1.46585 WP_003413665.1.46609 WP_003413665.1.46613 WP_003413665.1.46625 WP_003413665.1.46642 WP_003413665.1.46647 WP_003413665.1.46674 WP_003413665.1.46724 WP_003413665.1.46758 WP_003413665.1.46773 WP_003413665.1.46777 WP_003413665.1.46786 WP_003413665.1.46792 WP_003413665.1.46847 WP_003413665.1.46851 WP_003413665.1.4687 WP_003413665.1.46897 WP_003413665.1.46936 WP_003413665.1.46980 WP_003413665.1.47011 WP_003413665.1.47012 WP_003413665.1.47066 WP_003413665.1.47077 WP_003413665.1.47083 WP_003413665.1.47106 WP_003413665.1.47142 WP_003413665.1.47147 WP_003413665.1.47166 WP_003413665.1.47178 WP_003413665.1.47179 WP_003413665.1.47194 WP_003413665.1.47207 WP_003413665.1.47210 WP_003413665.1.47261 WP_003413665.1.47262 WP_003413665.1.47402 WP_003413665.1.47423 WP_003413665.1.47467 WP_003413665.1.47502 WP_003413665.1.4751 WP_003413665.1.47511 WP_003413665.1.47537 WP_003413665.1.47540 WP_003413665.1.47568 WP_003413665.1.47572 WP_003413665.1.47588 WP_003413665.1.47636 WP_003413665.1.4764 WP_003413665.1.47653 WP_003413665.1.47679 WP_003413665.1.47681 WP_003413665.1.47690 WP_003413665.1.4771 WP_003413665.1.47717 WP_003413665.1.47743 WP_003413665.1.47754 WP_003413665.1.47773 WP_003413665.1.47776 WP_003413665.1.47780 WP_003413665.1.47805 WP_003413665.1.47832 WP_003413665.1.47847 WP_003413665.1.47858 WP_003413665.1.47861 WP_003413665.1.47868 WP_003413665.1.47893 WP_003413665.1.47899 WP_003413665.1.479 WP_003413665.1.47912 WP_003413665.1.47913 WP_003413665.1.47926 WP_003413665.1.4794 WP_003413665.1.47943 WP_003413665.1.47944 WP_003413665.1.47959 WP_003413665.1.47974 WP_003413665.1.47993 WP_003413665.1.48004 WP_003413665.1.48039 WP_003413665.1.48050 WP_003413665.1.48084 WP_003413665.1.48097 WP_003413665.1.48101 WP_003413665.1.48109 WP_003413665.1.4813 WP_003413665.1.48130 WP_003413665.1.48135 WP_003413665.1.48143 WP_003413665.1.48152 WP_003413665.1.48155 WP_003413665.1.48170 WP_003413665.1.48173 WP_003413665.1.48177 WP_003413665.1.48185 WP_003413665.1.48219 WP_003413665.1.4823 WP_003413665.1.48240 WP_003413665.1.48256 WP_003413665.1.48264 WP_003413665.1.48287 WP_003413665.1.48330 WP_003413665.1.48333 WP_003413665.1.48348 WP_003413665.1.48354 WP_003413665.1.48372 WP_003413665.1.48383 WP_003413665.1.48388 WP_003413665.1.48419 WP_003413665.1.48423 WP_003413665.1.48443 WP_003413665.1.48450 WP_003413665.1.48462 WP_003413665.1.48543 WP_003413665.1.48550 WP_003413665.1.48605 WP_003413665.1.48618 WP_003413665.1.4863 WP_003413665.1.48648 WP_003413665.1.48658 WP_003413665.1.48666 WP_003413665.1.48687 WP_003413665.1.48779 WP_003413665.1.4878 WP_003413665.1.48798 WP_003413665.1.48802 WP_003413665.1.48826 WP_003413665.1.48831 WP_003413665.1.48843 WP_003413665.1.48857 WP_003413665.1.4890 WP_003413665.1.48946 WP_003413665.1.48979 WP_003413665.1.49017 WP_003413665.1.49048 WP_003413665.1.49059 WP_003413665.1.4906 WP_003413665.1.4907 WP_003413665.1.49103 WP_003413665.1.49110 WP_003413665.1.49111 WP_003413665.1.49112 WP_003413665.1.4919 WP_003413665.1.49251 WP_003413665.1.49254 WP_003413665.1.49263 WP_003413665.1.49291 WP_003413665.1.49296 WP_003413665.1.49335 WP_003413665.1.49337 WP_003413665.1.49419 WP_003413665.1.49426 WP_003413665.1.49437 WP_003413665.1.49439 WP_003413665.1.49474 WP_003413665.1.49506 WP_003413665.1.49516 WP_003413665.1.49523 WP_003413665.1.49526 WP_003413665.1.49532 WP_003413665.1.49588 WP_003413665.1.4959 WP_003413665.1.49678 WP_003413665.1.49687 WP_003413665.1.49699 WP_003413665.1.49709 WP_003413665.1.4971 WP_003413665.1.4972 WP_003413665.1.49736 WP_003413665.1.49746 WP_003413665.1.49764 WP_003413665.1.49773 WP_003413665.1.49796 WP_003413665.1.49814 WP_003413665.1.49815 WP_003413665.1.49816 WP_003413665.1.49839 WP_003413665.1.49857 WP_003413665.1.49878 WP_003413665.1.49880 WP_003413665.1.49944 WP_003413665.1.4999 WP_003413665.1.49990 WP_003413665.1.50068 WP_003413665.1.50077 WP_003413665.1.5008 WP_003413665.1.50081 WP_003413665.1.50122 WP_003413665.1.50126 WP_003413665.1.50149 WP_003413665.1.50162 WP_003413665.1.5018 WP_003413665.1.50194 WP_003413665.1.50218 WP_003413665.1.50235 WP_003413665.1.50249 WP_003413665.1.50265 WP_003413665.1.50271 WP_003413665.1.50324 WP_003413665.1.50347 WP_003413665.1.50372 WP_003413665.1.50398 WP_003413665.1.50407 WP_003413665.1.50444 WP_003413665.1.50466 WP_003413665.1.50472 WP_003413665.1.5048 WP_003413665.1.50498 WP_003413665.1.5050 WP_003413665.1.50540 WP_003413665.1.50554 WP_003413665.1.50557 WP_003413665.1.50601 WP_003413665.1.50610 WP_003413665.1.50632 WP_003413665.1.50633 WP_003413665.1.50642 WP_003413665.1.50655 WP_003413665.1.50659 WP_003413665.1.50683 WP_003413665.1.50689 WP_003413665.1.50692 WP_003413665.1.50714 WP_003413665.1.50729 WP_003413665.1.50756 WP_003413665.1.50784 WP_003413665.1.50794 WP_003413665.1.50841 WP_003413665.1.50860 WP_003413665.1.50868 WP_003413665.1.50877 WP_003413665.1.5096 WP_003413665.1.50981 WP_003413665.1.50987 WP_003413665.1.51003 WP_003413665.1.51009 WP_003413665.1.51037 WP_003413665.1.51074 WP_003413665.1.51082 WP_003413665.1.51101 WP_003413665.1.51116 WP_003413665.1.51149 WP_003413665.1.51156 WP_003413665.1.51157 WP_003413665.1.51213 WP_003413665.1.51232 WP_003413665.1.51239 WP_003413665.1.51247 WP_003413665.1.51266 WP_003413665.1.51279 WP_003413665.1.51291 WP_003413665.1.51294 WP_003413665.1.51301 WP_003413665.1.51329 WP_003413665.1.51391 WP_003413665.1.51422 WP_003413665.1.51445 WP_003413665.1.51455 WP_003413665.1.51466 WP_003413665.1.51468 WP_003413665.1.51478 WP_003413665.1.51497 WP_003413665.1.51520 WP_003413665.1.51593 WP_003413665.1.51628 WP_003413665.1.5164 WP_003413665.1.51647 WP_003413665.1.51660 WP_003413665.1.51696 WP_003413665.1.51721 WP_003413665.1.51788 WP_003413665.1.51795 WP_003413665.1.51801 WP_003413665.1.51817 WP_003413665.1.51819 WP_003413665.1.51854 WP_003413665.1.51923 WP_003413665.1.51942 WP_003413665.1.51948 WP_003413665.1.51963 WP_003413665.1.51969 WP_003413665.1.52000 WP_003413665.1.52001 WP_003413665.1.52003 WP_003413665.1.52006 WP_003413665.1.52036 WP_003413665.1.52038 WP_003413665.1.52046 WP_003413665.1.52059 WP_003413665.1.52069 WP_003413665.1.52082 WP_003413665.1.52102 WP_003413665.1.52106 WP_003413665.1.52166 WP_003413665.1.52168 WP_003413665.1.52173 WP_003413665.1.52178 WP_003413665.1.52206 WP_003413665.1.52216 WP_003413665.1.52238 WP_003413665.1.52241 WP_003413665.1.52280 WP_003413665.1.52314 WP_003413665.1.52385 WP_003413665.1.52390 WP_003413665.1.524 WP_003413665.1.52460 WP_003413665.1.52485 WP_003413665.1.52486 WP_003413665.1.52495 WP_003413665.1.52504 WP_003413665.1.52522 WP_003413665.1.52531 WP_003413665.1.52533 WP_003413665.1.52545 WP_003413665.1.52553 WP_003413665.1.52563 WP_003413665.1.52574 WP_003413665.1.52641 WP_003413665.1.52673 WP_003413665.1.52674 WP_003413665.1.52708 WP_003413665.1.52713 WP_003413665.1.52761 WP_003413665.1.52778 WP_003413665.1.52791 WP_003413665.1.52797 WP_003413665.1.52818 WP_003413665.1.52872 WP_003413665.1.52873 WP_003413665.1.52891 WP_003413665.1.52892 WP_003413665.1.52909 WP_003413665.1.52970 WP_003413665.1.52998 WP_003413665.1.53053 WP_003413665.1.53056 WP_003413665.1.5306 WP_003413665.1.53088 WP_003413665.1.5309 WP_003413665.1.531 WP_003413665.1.53117 WP_003413665.1.53118 WP_003413665.1.53142 WP_003413665.1.53143 WP_003413665.1.53157 WP_003413665.1.53167 WP_003413665.1.53200 WP_003413665.1.53204 WP_003413665.1.53213 WP_003413665.1.53217 WP_003413665.1.53226 WP_003413665.1.53229 WP_003413665.1.53230 WP_003413665.1.53237 WP_003413665.1.53254 WP_003413665.1.53257 WP_003413665.1.5327 WP_003413665.1.53276 WP_003413665.1.53278 WP_003413665.1.533 WP_003413665.1.53302 WP_003413665.1.53306 WP_003413665.1.5334 WP_003413665.1.5335 WP_003413665.1.53353 WP_003413665.1.53381 WP_003413665.1.53413 WP_003413665.1.53458 WP_003413665.1.53460 WP_003413665.1.53480 WP_003413665.1.53517 WP_003413665.1.53522 WP_003413665.1.53525 WP_003413665.1.53526 WP_003413665.1.53553 WP_003413665.1.53606 WP_003413665.1.53609 WP_003413665.1.53628 WP_003413665.1.53643 WP_003413665.1.53667 WP_003413665.1.53679 WP_003413665.1.53715 WP_003413665.1.53730 WP_003413665.1.53743 WP_003413665.1.53754 WP_003413665.1.53775 WP_003413665.1.53787 WP_003413665.1.53803 WP_003413665.1.53818 WP_003413665.1.53822 WP_003413665.1.53853 WP_003413665.1.53865 WP_003413665.1.53888 WP_003413665.1.53900 WP_003413665.1.53912 WP_003413665.1.53914 WP_003413665.1.53952 WP_003413665.1.53973 WP_003413665.1.5398 WP_003413665.1.5408 WP_003413665.1.54089 WP_003413665.1.54093 WP_003413665.1.54099 WP_003413665.1.54112 WP_003413665.1.54125 WP_003413665.1.54141 WP_003413665.1.54162 WP_003413665.1.54179 WP_003413665.1.54206 WP_003413665.1.54218 WP_003413665.1.54225 WP_003413665.1.54227 WP_003413665.1.54232 WP_003413665.1.54241 WP_003413665.1.54245 WP_003413665.1.54247 WP_003413665.1.54260 WP_003413665.1.54275 WP_003413665.1.54280 WP_003413665.1.5429 WP_003413665.1.54294 WP_003413665.1.54314 WP_003413665.1.54347 WP_003413665.1.54351 WP_003413665.1.54370 WP_003413665.1.54428 WP_003413665.1.54449 WP_003413665.1.54494 WP_003413665.1.54502 WP_003413665.1.54514 WP_003413665.1.54519 WP_003413665.1.5452 WP_003413665.1.54531 WP_003413665.1.54537 WP_003413665.1.54553 WP_003413665.1.54555 WP_003413665.1.54575 WP_003413665.1.54633 WP_003413665.1.54686 WP_003413665.1.54687 WP_003413665.1.54705 WP_003413665.1.54730 WP_003413665.1.54732 WP_003413665.1.5475 WP_003413665.1.54797 WP_003413665.1.54807 WP_003413665.1.54836 WP_003413665.1.54838 WP_003413665.1.54860 WP_003413665.1.54888 WP_003413665.1.54897 WP_003413665.1.54905 WP_003413665.1.54909 WP_003413665.1.54937 WP_003413665.1.54939 WP_003413665.1.54944 WP_003413665.1.54945 WP_003413665.1.54953 WP_003413665.1.54964 WP_003413665.1.55015 WP_003413665.1.55022 WP_003413665.1.55023 WP_003413665.1.55051 WP_003413665.1.55072 WP_003413665.1.55088 WP_003413665.1.55106 WP_003413665.1.55126 WP_003413665.1.55128 WP_003413665.1.55140 WP_003413665.1.55150 WP_003413665.1.55210 WP_003413665.1.55227 WP_003413665.1.55248 WP_003413665.1.55257 WP_003413665.1.55258 WP_003413665.1.55267 WP_003413665.1.55279 WP_003413665.1.55307 WP_003413665.1.55326 WP_003413665.1.55328 WP_003413665.1.5533 WP_003413665.1.55345 WP_003413665.1.55396 WP_003413665.1.55398 WP_003413665.1.55441 WP_003413665.1.55459 WP_003413665.1.55501 WP_003413665.1.55504 WP_003413665.1.55578 WP_003413665.1.55626 WP_003413665.1.55641 WP_003413665.1.5569 WP_003413665.1.55723 WP_003413665.1.55735 WP_003413665.1.5574 WP_003413665.1.55772 WP_003413665.1.55802 WP_003413665.1.55807 WP_003413665.1.55819 WP_003413665.1.55821 WP_003413665.1.5583 WP_003413665.1.55849 WP_003413665.1.55856 WP_003413665.1.55860 WP_003413665.1.55882 WP_003413665.1.55883 WP_003413665.1.55894 WP_003413665.1.55902 WP_003413665.1.55908 WP_003413665.1.55909 WP_003413665.1.5591 WP_003413665.1.55961 WP_003413665.1.55977 WP_003413665.1.55983 WP_003413665.1.56028 WP_003413665.1.56057 WP_003413665.1.56060 WP_003413665.1.56107 WP_003413665.1.56132 WP_003413665.1.56163 WP_003413665.1.56167 WP_003413665.1.56178 WP_003413665.1.56287 WP_003413665.1.56292 WP_003413665.1.56327 WP_003413665.1.56341 WP_003413665.1.56359 WP_003413665.1.56365 WP_003413665.1.56394 WP_003413665.1.56443 WP_003413665.1.56473 WP_003413665.1.56478 WP_003413665.1.56500 WP_003413665.1.56517 WP_003413665.1.56534 WP_003413665.1.56577 WP_003413665.1.56593 WP_003413665.1.56625 WP_003413665.1.56637 WP_003413665.1.56670 WP_003413665.1.56697 WP_003413665.1.567 WP_003413665.1.56701 WP_003413665.1.56709 WP_003413665.1.56729 WP_003413665.1.56743 WP_003413665.1.56755 WP_003413665.1.56764 WP_003413665.1.56769 WP_003413665.1.56770 WP_003413665.1.56795 WP_003413665.1.5681 WP_003413665.1.56827 WP_003413665.1.56839 WP_003413665.1.56863 WP_003413665.1.56868 WP_003413665.1.56869 WP_003413665.1.56915 WP_003413665.1.56926 WP_003413665.1.56961 WP_003413665.1.56971 WP_003413665.1.56972 WP_003413665.1.57023 WP_003413665.1.57035 WP_003413665.1.57077 WP_003413665.1.57087 WP_003413665.1.57094 WP_003413665.1.57134 WP_003413665.1.57151 WP_003413665.1.57169 WP_003413665.1.57208 WP_003413665.1.57212 WP_003413665.1.57230 WP_003413665.1.5724 WP_003413665.1.5725 WP_003413665.1.5727 WP_003413665.1.57273 WP_003413665.1.573 WP_003413665.1.57314 WP_003413665.1.57326 WP_003413665.1.57328 WP_003413665.1.57331 WP_003413665.1.57340 WP_003413665.1.57351 WP_003413665.1.57352 WP_003413665.1.57380 WP_003413665.1.57430 WP_003413665.1.5744 WP_003413665.1.57440 WP_003413665.1.5745 WP_003413665.1.57461 WP_003413665.1.57469 WP_003413665.1.57489 WP_003413665.1.575 WP_003413665.1.57509 WP_003413665.1.57519 WP_003413665.1.57525 WP_003413665.1.57551 WP_003413665.1.5758 WP_003413665.1.57596 WP_003413665.1.57604 WP_003413665.1.57616 WP_003413665.1.57617 WP_003413665.1.57619 WP_003413665.1.57627 WP_003413665.1.57642 WP_003413665.1.57658 WP_003413665.1.57667 WP_003413665.1.57675 WP_003413665.1.57689 WP_003413665.1.57708 WP_003413665.1.57794 WP_003413665.1.57821 WP_003413665.1.57825 WP_003413665.1.57843 WP_003413665.1.57906 WP_003413665.1.57924 WP_003413665.1.57926 WP_003413665.1.57930 WP_003413665.1.57957 WP_003413665.1.57960 WP_003413665.1.57964 WP_003413665.1.57991 WP_003413665.1.58000 WP_003413665.1.58086 WP_003413665.1.58101 WP_003413665.1.58103 WP_003413665.1.58108 WP_003413665.1.5811 WP_003413665.1.58121 WP_003413665.1.58145 WP_003413665.1.58164 WP_003413665.1.58174 WP_003413665.1.582 WP_003413665.1.58202 WP_003413665.1.58215 WP_003413665.1.5824 WP_003413665.1.58250 WP_003413665.1.58259 WP_003413665.1.58283 WP_003413665.1.58288 WP_003413665.1.5830 WP_003413665.1.58303 WP_003413665.1.58311 WP_003413665.1.58330 WP_003413665.1.58359 WP_003413665.1.58386 WP_003413665.1.58393 WP_003413665.1.58431 WP_003413665.1.5844 WP_003413665.1.58488 WP_003413665.1.58518 WP_003413665.1.58534 WP_003413665.1.58559 WP_003413665.1.58567 WP_003413665.1.58573 WP_003413665.1.58602 WP_003413665.1.58612 WP_003413665.1.58619 WP_003413665.1.58630 WP_003413665.1.5865 WP_003413665.1.58671 WP_003413665.1.58690 WP_003413665.1.58702 WP_003413665.1.58743 WP_003413665.1.58754 WP_003413665.1.5879 WP_003413665.1.5881 WP_003413665.1.58824 WP_003413665.1.58848 WP_003413665.1.58857 WP_003413665.1.58891 WP_003413665.1.58892 WP_003413665.1.5890 WP_003413665.1.58904 WP_003413665.1.58921 WP_003413665.1.58930 WP_003413665.1.58939 WP_003413665.1.58941 WP_003413665.1.58953 WP_003413665.1.58961 WP_003413665.1.5898 WP_003413665.1.59025 WP_003413665.1.59029 WP_003413665.1.59037 WP_003413665.1.59044 WP_003413665.1.59088 WP_003413665.1.59112 WP_003413665.1.59130 WP_003413665.1.5914 WP_003413665.1.59147 WP_003413665.1.59166 WP_003413665.1.59205 WP_003413665.1.59209 WP_003413665.1.59237 WP_003413665.1.59240 WP_003413665.1.59253 WP_003413665.1.59254 WP_003413665.1.59262 WP_003413665.1.59270 WP_003413665.1.5928 WP_003413665.1.59304 WP_003413665.1.59305 WP_003413665.1.59309 WP_003413665.1.59316 WP_003413665.1.59326 WP_003413665.1.59328 WP_003413665.1.59333 WP_003413665.1.59338 WP_003413665.1.59388 WP_003413665.1.59428 WP_003413665.1.59487 WP_003413665.1.59537 WP_003413665.1.59561 WP_003413665.1.59677 WP_003413665.1.59722 WP_003413665.1.59727 WP_003413665.1.59732 WP_003413665.1.59738 WP_003413665.1.59750 WP_003413665.1.59757 WP_003413665.1.59761 WP_003413665.1.59808 WP_003413665.1.59850 WP_003413665.1.59856 WP_003413665.1.59860 WP_003413665.1.59861 WP_003413665.1.5987 WP_003413665.1.59878 WP_003413665.1.59888 WP_003413665.1.59952 WP_003413665.1.5996 WP_003413665.1.59961 WP_003413665.1.59974 WP_003413665.1.6000 WP_003413665.1.60007 WP_003413665.1.60016 WP_003413665.1.6003 WP_003413665.1.60047 WP_003413665.1.6007 WP_003413665.1.60091 WP_003413665.1.60121 WP_003413665.1.60125 WP_003413665.1.60135 WP_003413665.1.60139 WP_003413665.1.60152 WP_003413665.1.60171 WP_003413665.1.60197 WP_003413665.1.6020 WP_003413665.1.60205 WP_003413665.1.60207 WP_003413665.1.60215 WP_003413665.1.60217 WP_003413665.1.60267 WP_003413665.1.60288 WP_003413665.1.60291 WP_003413665.1.60301 WP_003413665.1.60305 WP_003413665.1.60312 WP_003413665.1.60313 WP_003413665.1.60314 WP_003413665.1.60367 WP_003413665.1.60376 WP_003413665.1.60403 WP_003413665.1.60413 WP_003413665.1.60421 WP_003413665.1.60451 WP_003413665.1.60460 WP_003413665.1.60479 WP_003413665.1.60487 WP_003413665.1.60512 WP_003413665.1.60573 WP_003413665.1.60583 WP_003413665.1.60632 WP_003413665.1.60657 WP_003413665.1.60687 WP_003413665.1.60689 WP_003413665.1.60727 WP_003413665.1.60738 WP_003413665.1.60763 WP_003413665.1.6077 WP_003413665.1.60791 WP_003413665.1.60834 WP_003413665.1.60870 WP_003413665.1.60878 WP_003413665.1.60879 WP_003413665.1.60913 WP_003413665.1.60978 WP_003413665.1.61000 WP_003413665.1.61001 WP_003413665.1.61012 WP_003413665.1.61014 WP_003413665.1.61015 WP_003413665.1.61037 WP_003413665.1.61052 WP_003413665.1.61065 WP_003413665.1.61100 WP_003413665.1.61101 WP_003413665.1.61138 WP_003413665.1.61142 WP_003413665.1.61198 WP_003413665.1.612 WP_003413665.1.61234 WP_003413665.1.61256 WP_003413665.1.61281 WP_003413665.1.61314 WP_003413665.1.61321 WP_003413665.1.61326 WP_003413665.1.61328 WP_003413665.1.61368 WP_003413665.1.61391 WP_003413665.1.61406 WP_003413665.1.61409 WP_003413665.1.61420 WP_003413665.1.61422 WP_003413665.1.61425 WP_003413665.1.61428 WP_003413665.1.61469 WP_003413665.1.61494 WP_003413665.1.61522 WP_003413665.1.61552 WP_003413665.1.61557 WP_003413665.1.61567 WP_003413665.1.61571 WP_003413665.1.61573 WP_003413665.1.61584 WP_003413665.1.61586 WP_003413665.1.6159 WP_003413665.1.61592 WP_003413665.1.6160 WP_003413665.1.61614 WP_003413665.1.6163 WP_003413665.1.61655 WP_003413665.1.61665 WP_003413665.1.61669 WP_003413665.1.61682 WP_003413665.1.61692 WP_003413665.1.61719 WP_003413665.1.61728 WP_003413665.1.61750 WP_003413665.1.61754 WP_003413665.1.61755 WP_003413665.1.61757 WP_003413665.1.61778 WP_003413665.1.6179 WP_003413665.1.61793 WP_003413665.1.61816 WP_003413665.1.61842 WP_003413665.1.61850 WP_003413665.1.61862 WP_003413665.1.61865 WP_003413665.1.61868 WP_003413665.1.61911 WP_003413665.1.61925 WP_003413665.1.61941 WP_003413665.1.61953 WP_003413665.1.61979 WP_003413665.1.61986 WP_003413665.1.61987 WP_003413665.1.61998 WP_003413665.1.62021 WP_003413665.1.62087 WP_003413665.1.62089 WP_003413665.1.62101 WP_003413665.1.62104 WP_003413665.1.6211 WP_003413665.1.62132 WP_003413665.1.62162 WP_003413665.1.62225 WP_003413665.1.62230 WP_003413665.1.62238 WP_003413665.1.62249 WP_003413665.1.62270 WP_003413665.1.62281 WP_003413665.1.62307 WP_003413665.1.6231 WP_003413665.1.62359 WP_003413665.1.62360 WP_003413665.1.62371 WP_003413665.1.62379 WP_003413665.1.62395 WP_003413665.1.62408 WP_003413665.1.62449 WP_003413665.1.62468 WP_003413665.1.6248 WP_003413665.1.62508 WP_003413665.1.62565 WP_003413665.1.62594 WP_003413665.1.62606 WP_003413665.1.62616 WP_003413665.1.62666 WP_003413665.1.62687 WP_003413665.1.62715 WP_003413665.1.62730 WP_003413665.1.62738 WP_003413665.1.62761 WP_003413665.1.62766 WP_003413665.1.62786 WP_003413665.1.62813 WP_003413665.1.62839 WP_003413665.1.62841 WP_003413665.1.62936 WP_003413665.1.6294 WP_003413665.1.6295 WP_003413665.1.62962 WP_003413665.1.63007 WP_003413665.1.63019 WP_003413665.1.63032 WP_003413665.1.63037 WP_003413665.1.63064 WP_003413665.1.63066 WP_003413665.1.63072 WP_003413665.1.6308 WP_003413665.1.63081 WP_003413665.1.63096 WP_003413665.1.63106 WP_003413665.1.6314 WP_003413665.1.63144 WP_003413665.1.63154 WP_003413665.1.63160 WP_003413665.1.63161 WP_003413665.1.63166 WP_003413665.1.63175 WP_003413665.1.63194 WP_003413665.1.6322 WP_003413665.1.63222 WP_003413665.1.63247 WP_003413665.1.6328 WP_003413665.1.63291 WP_003413665.1.63312 WP_003413665.1.63317 WP_003413665.1.63331 WP_003413665.1.63373 WP_003413665.1.63384 WP_003413665.1.63403 WP_003413665.1.63424 WP_003413665.1.63428 WP_003413665.1.6345 WP_003413665.1.63464 WP_003413665.1.63483 WP_003413665.1.63502 WP_003413665.1.63504 WP_003413665.1.63522 WP_003413665.1.63530 WP_003413665.1.63538 WP_003413665.1.63564 WP_003413665.1.63567 WP_003413665.1.63596 WP_003413665.1.63600 WP_003413665.1.63623 WP_003413665.1.63624 WP_003413665.1.63625 WP_003413665.1.63627 WP_003413665.1.63654 WP_003413665.1.63662 WP_003413665.1.63711 WP_003413665.1.63734 WP_003413665.1.63807 WP_003413665.1.63819 WP_003413665.1.63844 WP_003413665.1.63888 WP_003413665.1.63913 WP_003413665.1.63915 WP_003413665.1.63918 WP_003413665.1.63961 WP_003413665.1.63970 WP_003413665.1.64000 WP_003413665.1.64027 WP_003413665.1.64058 WP_003413665.1.64065 WP_003413665.1.6407 WP_003413665.1.64082 WP_003413665.1.64091 WP_003413665.1.64102 WP_003413665.1.64104 WP_003413665.1.64119 WP_003413665.1.64169 WP_003413665.1.64219 WP_003413665.1.6422 WP_003413665.1.64222 WP_003413665.1.64223 WP_003413665.1.64228 WP_003413665.1.64235 WP_003413665.1.64249 WP_003413665.1.6427 WP_003413665.1.64278 WP_003413665.1.64287 WP_003413665.1.64414 WP_003413665.1.64419 WP_003413665.1.6443 WP_003413665.1.64463 WP_003413665.1.64480 WP_003413665.1.64497 WP_003413665.1.64511 WP_003413665.1.64513 WP_003413665.1.64514 WP_003413665.1.64515 WP_003413665.1.64522 WP_003413665.1.64526 WP_003413665.1.64543 WP_003413665.1.6456 WP_003413665.1.64567 WP_003413665.1.64588 WP_003413665.1.64589 WP_003413665.1.64594 WP_003413665.1.64595 WP_003413665.1.64608 WP_003413665.1.64619 WP_003413665.1.64629 WP_003413665.1.6464 WP_003413665.1.64664 WP_003413665.1.64669 WP_003413665.1.64672 WP_003413665.1.64680 WP_003413665.1.64682 WP_003413665.1.64727 WP_003413665.1.64729 WP_003413665.1.64774 WP_003413665.1.64776 WP_003413665.1.64802 WP_003413665.1.64832 WP_003413665.1.6486 WP_003413665.1.64870 WP_003413665.1.64898 WP_003413665.1.64922 WP_003413665.1.64924 WP_003413665.1.6493 WP_003413665.1.64937 WP_003413665.1.64941 WP_003413665.1.64966 WP_003413665.1.64973 WP_003413665.1.65001 WP_003413665.1.65026 WP_003413665.1.65053 WP_003413665.1.65070 WP_003413665.1.65079 WP_003413665.1.65102 WP_003413665.1.65157 WP_003413665.1.65181 WP_003413665.1.65212 WP_003413665.1.65229 WP_003413665.1.6523 WP_003413665.1.65253 WP_003413665.1.65289 WP_003413665.1.65291 WP_003413665.1.65315 WP_003413665.1.65329 WP_003413665.1.65359 WP_003413665.1.6536 WP_003413665.1.65374 WP_003413665.1.65386 WP_003413665.1.65414 WP_003413665.1.65416 WP_003413665.1.65433 WP_003413665.1.65455 WP_003413665.1.65467 WP_003413665.1.65488 WP_003413665.1.65529 WP_003413665.1.65539 WP_003413665.1.65583 WP_003413665.1.65612 WP_003413665.1.65623 WP_003413665.1.65635 WP_003413665.1.65637 WP_003413665.1.65648 WP_003413665.1.65683 WP_003413665.1.65686 WP_003413665.1.65688 WP_003413665.1.65707 WP_003413665.1.65733 WP_003413665.1.65746 WP_003413665.1.65747 WP_003413665.1.65759 WP_003413665.1.65816 WP_003413665.1.65830 WP_003413665.1.65858 WP_003413665.1.65862 WP_003413665.1.65869 WP_003413665.1.65893 WP_003413665.1.65929 WP_003413665.1.65932 WP_003413665.1.65958 WP_003413665.1.65974 WP_003413665.1.66004 WP_003413665.1.66013 WP_003413665.1.6606 WP_003413665.1.66089 WP_003413665.1.66149 WP_003413665.1.66151 WP_003413665.1.66229 WP_003413665.1.66276 WP_003413665.1.66293 WP_003413665.1.66297 WP_003413665.1.66323 WP_003413665.1.66325 WP_003413665.1.6633 WP_003413665.1.66334 WP_003413665.1.66355 WP_003413665.1.66367 WP_003413665.1.66394 WP_003413665.1.66396 WP_003413665.1.66451 WP_003413665.1.66455 WP_003413665.1.66457 WP_003413665.1.66460 WP_003413665.1.66464 WP_003413665.1.66466 WP_003413665.1.66487 WP_003413665.1.66504 WP_003413665.1.66544 WP_003413665.1.66558 WP_003413665.1.66580 WP_003413665.1.66582 WP_003413665.1.66612 WP_003413665.1.66615 WP_003413665.1.66617 WP_003413665.1.66635 WP_003413665.1.66656 WP_003413665.1.66663 WP_003413665.1.66675 WP_003413665.1.66715 WP_003413665.1.66718 WP_003413665.1.66762 WP_003413665.1.66776 WP_003413665.1.66808 WP_003413665.1.66817 WP_003413665.1.66819 WP_003413665.1.66826 WP_003413665.1.66830 WP_003413665.1.66868 WP_003413665.1.66878 WP_003413665.1.66880 WP_003413665.1.66893 WP_003413665.1.66961 WP_003413665.1.67005 WP_003413665.1.6704 WP_003413665.1.67044 WP_003413665.1.67061 WP_003413665.1.67089 WP_003413665.1.67098 WP_003413665.1.67146 WP_003413665.1.67170 WP_003413665.1.67197 WP_003413665.1.67198 WP_003413665.1.6720 WP_003413665.1.67207 WP_003413665.1.67218 WP_003413665.1.67220 WP_003413665.1.67225 WP_003413665.1.67231 WP_003413665.1.6724 WP_003413665.1.67257 WP_003413665.1.67298 WP_003413665.1.67307 WP_003413665.1.67324 WP_003413665.1.67332 WP_003413665.1.67346 WP_003413665.1.67354 WP_003413665.1.67360 WP_003413665.1.67381 WP_003413665.1.67396 WP_003413665.1.67417 WP_003413665.1.67422 WP_003413665.1.67453 WP_003413665.1.67459 WP_003413665.1.6746 WP_003413665.1.67473 WP_003413665.1.67481 WP_003413665.1.67482 WP_003413665.1.67496 WP_003413665.1.67499 WP_003413665.1.67516 WP_003413665.1.67523 WP_003413665.1.67536 WP_003413665.1.67575 WP_003413665.1.67587 WP_003413665.1.67598 WP_003413665.1.67600 WP_003413665.1.67602 WP_003413665.1.67630 WP_003413665.1.67679 WP_003413665.1.67692 WP_003413665.1.67744 WP_003413665.1.6775 WP_003413665.1.67750 WP_003413665.1.6777 WP_003413665.1.67809 WP_003413665.1.67816 WP_003413665.1.67844 WP_003413665.1.67848 WP_003413665.1.67870 WP_003413665.1.67888 WP_003413665.1.67915 WP_003413665.1.67945 WP_003413665.1.67949 WP_003413665.1.67980 WP_003413665.1.67982 WP_003413665.1.68022 WP_003413665.1.68029 WP_003413665.1.68037 WP_003413665.1.68038 WP_003413665.1.68045 WP_003413665.1.68057 WP_003413665.1.68083 WP_003413665.1.68088 WP_003413665.1.68106 WP_003413665.1.68110 WP_003413665.1.68153 WP_003413665.1.68164 WP_003413665.1.68169 WP_003413665.1.68193 WP_003413665.1.68212 WP_003413665.1.68227 WP_003413665.1.68243 WP_003413665.1.6825 WP_003413665.1.68297 WP_003413665.1.68309 WP_003413665.1.68325 WP_003413665.1.68329 WP_003413665.1.68340 WP_003413665.1.68384 WP_003413665.1.68388 WP_003413665.1.68429 WP_003413665.1.6843 WP_003413665.1.68433 WP_003413665.1.68444 WP_003413665.1.68465 WP_003413665.1.68484 WP_003413665.1.68518 WP_003413665.1.68569 WP_003413665.1.68576 WP_003413665.1.68580 WP_003413665.1.68586 WP_003413665.1.68623 WP_003413665.1.68624 WP_003413665.1.68637 WP_003413665.1.68646 WP_003413665.1.68667 WP_003413665.1.68669 WP_003413665.1.68672 WP_003413665.1.68684 WP_003413665.1.68704 WP_003413665.1.68708 WP_003413665.1.6872 WP_003413665.1.68730 WP_003413665.1.68734 WP_003413665.1.68748 WP_003413665.1.68754 WP_003413665.1.6876 WP_003413665.1.68761 WP_003413665.1.68763 WP_003413665.1.68766 WP_003413665.1.68774 WP_003413665.1.68796 WP_003413665.1.68824 WP_003413665.1.68832 WP_003413665.1.68833 WP_003413665.1.68841 WP_003413665.1.68859 WP_003413665.1.68876 WP_003413665.1.68906 WP_003413665.1.68916 WP_003413665.1.68923 WP_003413665.1.68945 WP_003413665.1.6896 WP_003413665.1.68981 WP_003413665.1.68984 WP_003413665.1.68997 WP_003413665.1.69008 WP_003413665.1.69076 WP_003413665.1.69079 WP_003413665.1.6908 WP_003413665.1.69082 WP_003413665.1.69178 WP_003413665.1.69181 WP_003413665.1.69208 WP_003413665.1.69231 WP_003413665.1.69256 WP_003413665.1.69311 WP_003413665.1.69315 WP_003413665.1.69322 WP_003413665.1.69342 WP_003413665.1.6935 WP_003413665.1.6936 WP_003413665.1.69369 WP_003413665.1.69374 WP_003413665.1.69398 WP_003413665.1.69401 WP_003413665.1.69426 WP_003413665.1.69427 WP_003413665.1.69429 WP_003413665.1.6949 WP_003413665.1.69511 WP_003413665.1.69526 WP_003413665.1.69528 WP_003413665.1.69547 WP_003413665.1.69573 WP_003413665.1.69581 WP_003413665.1.6960 WP_003413665.1.69617 WP_003413665.1.69634 WP_003413665.1.69647 WP_003413665.1.69659 WP_003413665.1.69673 WP_003413665.1.69682 WP_003413665.1.69684 WP_003413665.1.69686 WP_003413665.1.69707 WP_003413665.1.69709 WP_003413665.1.69723 WP_003413665.1.69736 WP_003413665.1.69778 WP_003413665.1.69800 WP_003413665.1.69802 WP_003413665.1.69845 WP_003413665.1.69870 WP_003413665.1.69873 WP_003413665.1.69913 WP_003413665.1.69925 WP_003413665.1.69931 WP_003413665.1.69938 WP_003413665.1.69955 WP_003413665.1.69957 WP_003413665.1.69981 WP_003413665.1.69990 WP_003413665.1.70 WP_003413665.1.70000 WP_003413665.1.70017 WP_003413665.1.70032 WP_003413665.1.70055 WP_003413665.1.70062 WP_003413665.1.70072 WP_003413665.1.70131 WP_003413665.1.70132 WP_003413665.1.7022 WP_003413665.1.70227 WP_003413665.1.70255 WP_003413665.1.70271 WP_003413665.1.70274 WP_003413665.1.7029 WP_003413665.1.70325 WP_003413665.1.70328 WP_003413665.1.70356 WP_003413665.1.70364 WP_003413665.1.70368 WP_003413665.1.70369 WP_003413665.1.70418 WP_003413665.1.70422 WP_003413665.1.70435 WP_003413665.1.70444 WP_003413665.1.70463 WP_003413665.1.70471 WP_003413665.1.70480 WP_003413665.1.70494 WP_003413665.1.70498 WP_003413665.1.70505 WP_003413665.1.70525 WP_003413665.1.70573 WP_003413665.1.70577 WP_003413665.1.70610 WP_003413665.1.70615 WP_003413665.1.70618 WP_003413665.1.70622 WP_003413665.1.70626 WP_003413665.1.70668 WP_003413665.1.70699 WP_003413665.1.70704 WP_003413665.1.70729 WP_003413665.1.70757 WP_003413665.1.70782 WP_003413665.1.70796 WP_003413665.1.70830 WP_003413665.1.70834 WP_003413665.1.7084 WP_003413665.1.70840 WP_003413665.1.70864 WP_003413665.1.70871 WP_003413665.1.70915 WP_003413665.1.70955 WP_003413665.1.70958 WP_003413665.1.70964 WP_003413665.1.70976 WP_003413665.1.71015 WP_003413665.1.71026 WP_003413665.1.71063 WP_003413665.1.71076 WP_003413665.1.71083 WP_003413665.1.7111 WP_003413665.1.71118 WP_003413665.1.71128 WP_003413665.1.7113 WP_003413665.1.71187 WP_003413665.1.71191 WP_003413665.1.71255 WP_003413665.1.71258 WP_003413665.1.71259 WP_003413665.1.71289 WP_003413665.1.71326 WP_003413665.1.71329 WP_003413665.1.71331 WP_003413665.1.71344 WP_003413665.1.71390 WP_003413665.1.71399 WP_003413665.1.71414 WP_003413665.1.71440 WP_003413665.1.71457 WP_003413665.1.7146 WP_003413665.1.71464 WP_003413665.1.71490 WP_003413665.1.71492 WP_003413665.1.71509 WP_003413665.1.71516 WP_003413665.1.71517 WP_003413665.1.71527 WP_003413665.1.71532 WP_003413665.1.71545 WP_003413665.1.71546 WP_003413665.1.71569 WP_003413665.1.71604 WP_003413665.1.71621 WP_003413665.1.71630 WP_003413665.1.71638 WP_003413665.1.71654 WP_003413665.1.71664 WP_003413665.1.71665 WP_003413665.1.71683 WP_003413665.1.71701 WP_003413665.1.71718 WP_003413665.1.71731 WP_003413665.1.71778 WP_003413665.1.71781 WP_003413665.1.71803 WP_003413665.1.71820 WP_003413665.1.71847 WP_003413665.1.7185 WP_003413665.1.71851 WP_003413665.1.71871 WP_003413665.1.71909 WP_003413665.1.71957 WP_003413665.1.71970 WP_003413665.1.72047 WP_003413665.1.72061 WP_003413665.1.72062 WP_003413665.1.72072 WP_003413665.1.72111 WP_003413665.1.72122 WP_003413665.1.72128 WP_003413665.1.72143 WP_003413665.1.7216 WP_003413665.1.72168 WP_003413665.1.72179 WP_003413665.1.72209 WP_003413665.1.72218 WP_003413665.1.72219 WP_003413665.1.72227 WP_003413665.1.7224 WP_003413665.1.72268 WP_003413665.1.72332 WP_003413665.1.72380 WP_003413665.1.72401 WP_003413665.1.72405 WP_003413665.1.72420 WP_003413665.1.72441 WP_003413665.1.72451 WP_003413665.1.72452 WP_003413665.1.72457 WP_003413665.1.72459 WP_003413665.1.72460 WP_003413665.1.72466 WP_003413665.1.72487 WP_003413665.1.72488 WP_003413665.1.72492 WP_003413665.1.72506 WP_003413665.1.72543 WP_003413665.1.7256 WP_003413665.1.72576 WP_003413665.1.72578 WP_003413665.1.72585 WP_003413665.1.72591 WP_003413665.1.72592 WP_003413665.1.72640 WP_003413665.1.7266 WP_003413665.1.72661 WP_003413665.1.72684 WP_003413665.1.72739 WP_003413665.1.72744 WP_003413665.1.72755 WP_003413665.1.72759 WP_003413665.1.72784 WP_003413665.1.72792 WP_003413665.1.72826 WP_003413665.1.72831 WP_003413665.1.72852 WP_003413665.1.72853 WP_003413665.1.72879 WP_003413665.1.72880 WP_003413665.1.72938 WP_003413665.1.72954 WP_003413665.1.72957 WP_003413665.1.72959 WP_003413665.1.72973 WP_003413665.1.7298 WP_003413665.1.72982 WP_003413665.1.72988 WP_003413665.1.72993 WP_003413665.1.73006 WP_003413665.1.73013 WP_003413665.1.73025 WP_003413665.1.73028 WP_003413665.1.73042 WP_003413665.1.73045 WP_003413665.1.73092 WP_003413665.1.73118 WP_003413665.1.7312 WP_003413665.1.73127 WP_003413665.1.73134 WP_003413665.1.73150 WP_003413665.1.73154 WP_003413665.1.73163 WP_003413665.1.73182 WP_003413665.1.73205 WP_003413665.1.7321 WP_003413665.1.73310 WP_003413665.1.73315 WP_003413665.1.73365 WP_003413665.1.73391 WP_003413665.1.73404 WP_003413665.1.73424 WP_003413665.1.73436 WP_003413665.1.73445 WP_003413665.1.73453 WP_003413665.1.73465 WP_003413665.1.73466 WP_003413665.1.73470 WP_003413665.1.73471 WP_003413665.1.73478 WP_003413665.1.73482 WP_003413665.1.73507 WP_003413665.1.73532 WP_003413665.1.73550 WP_003413665.1.73564 WP_003413665.1.73623 WP_003413665.1.73629 WP_003413665.1.73644 WP_003413665.1.7366 WP_003413665.1.73661 WP_003413665.1.7368 WP_003413665.1.73688 WP_003413665.1.73723 WP_003413665.1.73744 WP_003413665.1.73750 WP_003413665.1.73760 WP_003413665.1.73774 WP_003413665.1.7379 WP_003413665.1.73813 WP_003413665.1.73840 WP_003413665.1.73876 WP_003413665.1.7389 WP_003413665.1.73986 WP_003413665.1.74016 WP_003413665.1.74039 WP_003413665.1.74083 WP_003413665.1.74101 WP_003413665.1.74107 WP_003413665.1.74120 WP_003413665.1.74129 WP_003413665.1.74144 WP_003413665.1.7417 WP_003413665.1.74190 WP_003413665.1.74210 WP_003413665.1.7423 WP_003413665.1.74259 WP_003413665.1.74262 WP_003413665.1.74269 WP_003413665.1.74282 WP_003413665.1.74291 WP_003413665.1.74296 WP_003413665.1.74304 WP_003413665.1.7432 WP_003413665.1.74347 WP_003413665.1.7436 WP_003413665.1.74378 WP_003413665.1.74382 WP_003413665.1.74395 WP_003413665.1.74400 WP_003413665.1.74401 WP_003413665.1.74432 WP_003413665.1.74442 WP_003413665.1.74477 WP_003413665.1.74487 WP_003413665.1.74499 WP_003413665.1.74504 WP_003413665.1.74511 WP_003413665.1.74523 WP_003413665.1.74525 WP_003413665.1.74551 WP_003413665.1.74555 WP_003413665.1.74628 WP_003413665.1.74641 WP_003413665.1.74653 WP_003413665.1.74660 WP_003413665.1.74683 WP_003413665.1.7469 WP_003413665.1.74725 WP_003413665.1.74760 WP_003413665.1.74786 WP_003413665.1.74809 WP_003413665.1.74820 WP_003413665.1.74870 WP_003413665.1.74881 WP_003413665.1.74888 WP_003413665.1.74952 WP_003413665.1.7496 WP_003413665.1.74988 WP_003413665.1.75043 WP_003413665.1.75045 WP_003413665.1.75055 WP_003413665.1.75078 WP_003413665.1.75081 WP_003413665.1.75120 WP_003413665.1.75163 WP_003413665.1.75188 WP_003413665.1.75200 WP_003413665.1.75202 WP_003413665.1.75234 WP_003413665.1.75239 WP_003413665.1.75250 WP_003413665.1.75263 WP_003413665.1.75281 WP_003413665.1.75342 WP_003413665.1.7535 WP_003413665.1.75376 WP_003413665.1.75391 WP_003413665.1.75395 WP_003413665.1.75441 WP_003413665.1.75510 WP_003413665.1.75581 WP_003413665.1.75598 WP_003413665.1.75635 WP_003413665.1.75645 WP_003413665.1.75665 WP_003413665.1.75671 WP_003413665.1.75741 WP_003413665.1.75749 WP_003413665.1.75772 WP_003413665.1.75774 WP_003413665.1.75811 WP_003413665.1.75833 WP_003413665.1.7585 WP_003413665.1.75864 WP_003413665.1.75868 WP_003413665.1.75878 WP_003413665.1.75927 WP_003413665.1.75946 WP_003413665.1.75968 WP_003413665.1.75974 WP_003413665.1.76007 WP_003413665.1.76016 WP_003413665.1.76032 WP_003413665.1.76037 WP_003413665.1.7604 WP_003413665.1.76045 WP_003413665.1.76052 WP_003413665.1.76058 WP_003413665.1.76064 WP_003413665.1.76110 WP_003413665.1.76126 WP_003413665.1.76133 WP_003413665.1.76138 WP_003413665.1.76157 WP_003413665.1.76172 WP_003413665.1.76177 WP_003413665.1.76183 WP_003413665.1.76209 WP_003413665.1.76239 WP_003413665.1.76272 WP_003413665.1.76277 WP_003413665.1.76280 WP_003413665.1.76281 WP_003413665.1.76291 WP_003413665.1.76297 WP_003413665.1.76360 WP_003413665.1.76379 WP_003413665.1.76403 WP_003413665.1.76413 WP_003413665.1.76414 WP_003413665.1.76427 WP_003413665.1.76436 WP_003413665.1.76442 WP_003413665.1.76443 WP_003413665.1.76456 WP_003413665.1.76521 WP_003413665.1.76533 WP_003413665.1.76616 WP_003413665.1.76625 WP_003413665.1.76629 WP_003413665.1.76635 WP_003413665.1.76638 WP_003413665.1.76639 WP_003413665.1.76640 WP_003413665.1.76644 WP_003413665.1.76677 WP_003413665.1.76678 WP_003413665.1.76679 WP_003413665.1.76734 WP_003413665.1.76744 WP_003413665.1.76750 WP_003413665.1.76754 WP_003413665.1.76757 WP_003413665.1.76781 WP_003413665.1.76818 WP_003413665.1.76824 WP_003413665.1.76835 WP_003413665.1.76873 WP_003413665.1.76881 WP_003413665.1.76888 WP_003413665.1.76900 WP_003413665.1.7691 WP_003413665.1.76947 WP_003413665.1.76954 WP_003413665.1.76955 WP_003413665.1.76963 WP_003413665.1.76976 WP_003413665.1.770 WP_003413665.1.77000 WP_003413665.1.77008 WP_003413665.1.77021 WP_003413665.1.77056 WP_003413665.1.77065 WP_003413665.1.77075 WP_003413665.1.77093 WP_003413665.1.77107 WP_003413665.1.77115 WP_003413665.1.77118 WP_003413665.1.77125 WP_003413665.1.77141 WP_003413665.1.77142 WP_003413665.1.77166 WP_003413665.1.77250 WP_003413665.1.77252 WP_003413665.1.77260 WP_003413665.1.77266 WP_003413665.1.77280 WP_003413665.1.77285 WP_003413665.1.77312 WP_003413665.1.77348 WP_003413665.1.77351 WP_003413665.1.77352 WP_003413665.1.77361 WP_003413665.1.774 WP_003413665.1.7740 WP_003413665.1.77404 WP_003413665.1.77425 WP_003413665.1.77463 WP_003413665.1.77474 WP_003413665.1.7748 WP_003413665.1.77484 WP_003413665.1.77491 WP_003413665.1.77499 WP_003413665.1.77510 WP_003413665.1.77530 WP_003413665.1.77554 WP_003413665.1.77559 WP_003413665.1.77599 WP_003413665.1.77605 WP_003413665.1.7762 WP_003413665.1.77627 WP_003413665.1.77649 WP_003413665.1.77654 WP_003413665.1.7766 WP_003413665.1.77667 WP_003413665.1.77704 WP_003413665.1.77706 WP_003413665.1.77726 WP_003413665.1.77774 WP_003413665.1.7778 WP_003413665.1.77790 WP_003413665.1.77809 WP_003413665.1.77820 WP_003413665.1.77843 WP_003413665.1.77855 WP_003413665.1.77865 WP_003413665.1.77868 WP_003413665.1.77879 WP_003413665.1.77890 WP_003413665.1.77909 WP_003413665.1.77911 WP_003413665.1.77931 WP_003413665.1.77984 WP_003413665.1.78020 WP_003413665.1.78024 WP_003413665.1.78075 WP_003413665.1.78084 WP_003413665.1.78086 WP_003413665.1.7809 WP_003413665.1.78098 WP_003413665.1.78105 WP_003413665.1.78113 WP_003413665.1.78136 WP_003413665.1.78162 WP_003413665.1.7817 WP_003413665.1.78200 WP_003413665.1.78216 WP_003413665.1.78236 WP_003413665.1.78238 WP_003413665.1.78322 WP_003413665.1.78338 WP_003413665.1.7836 WP_003413665.1.78360 WP_003413665.1.78386 WP_003413665.1.78429 WP_003413665.1.78435 WP_003413665.1.7844 WP_003413665.1.78459 WP_003413665.1.78488 WP_003413665.1.7849 WP_003413665.1.78499 WP_003413665.1.785 WP_003413665.1.78516 WP_003413665.1.78524 WP_003413665.1.78526 WP_003413665.1.78538 WP_003413665.1.78544 WP_003413665.1.78545 WP_003413665.1.78547 WP_003413665.1.78574 WP_003413665.1.78580 WP_003413665.1.7860 WP_003413665.1.78620 WP_003413665.1.78646 WP_003413665.1.78648 WP_003413665.1.78649 WP_003413665.1.78655 WP_003413665.1.78657 WP_003413665.1.78659 WP_003413665.1.7869 WP_003413665.1.78692 WP_003413665.1.78760 WP_003413665.1.78766 WP_003413665.1.78776 WP_003413665.1.78778 WP_003413665.1.78784 WP_003413665.1.78788 WP_003413665.1.78790 WP_003413665.1.78793 WP_003413665.1.78848 WP_003413665.1.78860 WP_003413665.1.7887 WP_003413665.1.78884 WP_003413665.1.78932 WP_003413665.1.78969 WP_003413665.1.78977 WP_003413665.1.78980 WP_003413665.1.79005 WP_003413665.1.79016 WP_003413665.1.79033 WP_003413665.1.79064 WP_003413665.1.79066 WP_003413665.1.79068 WP_003413665.1.79077 WP_003413665.1.79095 WP_003413665.1.79112 WP_003413665.1.79122 WP_003413665.1.79145 WP_003413665.1.79152 WP_003413665.1.79163 WP_003413665.1.79182 WP_003413665.1.79198 WP_003413665.1.79213 WP_003413665.1.79218 WP_003413665.1.79268 WP_003413665.1.79273 WP_003413665.1.79278 WP_003413665.1.79290 WP_003413665.1.79319 WP_003413665.1.79325 WP_003413665.1.79326 WP_003413665.1.7933 WP_003413665.1.79330 WP_003413665.1.79339 WP_003413665.1.79394 WP_003413665.1.79399 WP_003413665.1.79413 WP_003413665.1.79422 WP_003413665.1.79445 WP_003413665.1.79447 WP_003413665.1.79455 WP_003413665.1.79471 WP_003413665.1.79480 WP_003413665.1.79482 WP_003413665.1.79488 WP_003413665.1.79500 WP_003413665.1.79502 WP_003413665.1.79508 WP_003413665.1.79514 WP_003413665.1.79561 WP_003413665.1.79565 WP_003413665.1.79578 WP_003413665.1.79588 WP_003413665.1.79598 WP_003413665.1.79615 WP_003413665.1.79684 WP_003413665.1.79698 WP_003413665.1.797 WP_003413665.1.79744 WP_003413665.1.79784 WP_003413665.1.79802 WP_003413665.1.79806 WP_003413665.1.79819 WP_003413665.1.79826 WP_003413665.1.79828 WP_003413665.1.79851 WP_003413665.1.79853 WP_003413665.1.79863 WP_003413665.1.79881 WP_003413665.1.79885 WP_003413665.1.79898 WP_003413665.1.7990 WP_003413665.1.79900 WP_003413665.1.79913 WP_003413665.1.79918 WP_003413665.1.79947 WP_003413665.1.79948 WP_003413665.1.7995 WP_003413665.1.7997 WP_003413665.1.80004 WP_003413665.1.80015 WP_003413665.1.80022 WP_003413665.1.80030 WP_003413665.1.80054 WP_003413665.1.80084 WP_003413665.1.80099 WP_003413665.1.80129 WP_003413665.1.80177 WP_003413665.1.80234 WP_003413665.1.8026 WP_003413665.1.80275 WP_003413665.1.8029 WP_003413665.1.80299 WP_003413665.1.80304 WP_003413665.1.80326 WP_003413665.1.80351 WP_003413665.1.8037 WP_003413665.1.80370 WP_003413665.1.80387 WP_003413665.1.80399 WP_003413665.1.8044 WP_003413665.1.80451 WP_003413665.1.80458 WP_003413665.1.80461 WP_003413665.1.80490 WP_003413665.1.80503 WP_003413665.1.80507 WP_003413665.1.80552 WP_003413665.1.80576 WP_003413665.1.80588 WP_003413665.1.80599 WP_003413665.1.8060 WP_003413665.1.80624 WP_003413665.1.80636 WP_003413665.1.80669 WP_003413665.1.80673 WP_003413665.1.80711 WP_003413665.1.80714 WP_003413665.1.80743 WP_003413665.1.80784 WP_003413665.1.80815 WP_003413665.1.80853 WP_003413665.1.80918 WP_003413665.1.8093 WP_003413665.1.80967 WP_003413665.1.8097 WP_003413665.1.80988 WP_003413665.1.81007 WP_003413665.1.81013 WP_003413665.1.8105 WP_003413665.1.81059 WP_003413665.1.81063 WP_003413665.1.81066 WP_003413665.1.81075 WP_003413665.1.81091 WP_003413665.1.81119 WP_003413665.1.81125 WP_003413665.1.81136 WP_003413665.1.8114 WP_003413665.1.81189 WP_003413665.1.81192 WP_003413665.1.812 WP_003413665.1.81230 WP_003413665.1.81249 WP_003413665.1.81250 WP_003413665.1.81264 WP_003413665.1.8128 WP_003413665.1.81287 WP_003413665.1.81297 WP_003413665.1.8138 WP_003413665.1.81407 WP_003413665.1.8143 WP_003413665.1.81439 WP_003413665.1.81465 WP_003413665.1.81505 WP_003413665.1.81529 WP_003413665.1.81538 WP_003413665.1.81541 WP_003413665.1.81560 WP_003413665.1.81561 WP_003413665.1.81567 WP_003413665.1.81583 WP_003413665.1.81686 WP_003413665.1.81712 WP_003413665.1.81720 WP_003413665.1.81731 WP_003413665.1.81774 WP_003413665.1.81788 WP_003413665.1.81809 WP_003413665.1.81820 WP_003413665.1.81826 WP_003413665.1.81850 WP_003413665.1.81883 WP_003413665.1.81891 WP_003413665.1.81911 WP_003413665.1.81918 WP_003413665.1.82011 WP_003413665.1.82048 WP_003413665.1.82069 WP_003413665.1.82071 WP_003413665.1.82108 WP_003413665.1.82136 WP_003413665.1.82142 WP_003413665.1.8215 WP_003413665.1.82158 WP_003413665.1.8217 WP_003413665.1.82209 WP_003413665.1.82210 WP_003413665.1.82228 WP_003413665.1.82236 WP_003413665.1.82251 WP_003413665.1.82271 WP_003413665.1.82305 WP_003413665.1.82307 WP_003413665.1.82309 WP_003413665.1.82317 WP_003413665.1.8232 WP_003413665.1.82346 WP_003413665.1.82374 WP_003413665.1.82385 WP_003413665.1.82429 WP_003413665.1.82460 WP_003413665.1.82462 WP_003413665.1.82483 WP_003413665.1.82494 WP_003413665.1.82531 WP_003413665.1.82546 WP_003413665.1.82547 WP_003413665.1.82549 WP_003413665.1.82577 WP_003413665.1.82592 WP_003413665.1.82597 WP_003413665.1.82598 WP_003413665.1.82625 WP_003413665.1.82642 WP_003413665.1.82651 WP_003413665.1.82653 WP_003413665.1.82681 WP_003413665.1.82685 WP_003413665.1.8271 WP_003413665.1.82712 WP_003413665.1.8273 WP_003413665.1.82743 WP_003413665.1.82757 WP_003413665.1.82774 WP_003413665.1.82803 WP_003413665.1.82836 WP_003413665.1.82860 WP_003413665.1.82871 WP_003413665.1.82892 WP_003413665.1.82935 WP_003413665.1.82957 WP_003413665.1.82973 WP_003413665.1.82981 WP_003413665.1.82983 WP_003413665.1.83004 WP_003413665.1.83009 WP_003413665.1.83044 WP_003413665.1.83065 WP_003413665.1.83074 WP_003413665.1.83110 WP_003413665.1.83146 WP_003413665.1.83149 WP_003413665.1.83159 WP_003413665.1.8317 WP_003413665.1.83173 WP_003413665.1.83181 WP_003413665.1.83182 WP_003413665.1.83191 WP_003413665.1.83197 WP_003413665.1.83212 WP_003413665.1.8326 WP_003413665.1.83262 WP_003413665.1.83268 WP_003413665.1.83273 WP_003413665.1.83309 WP_003413665.1.83332 WP_003413665.1.83334 WP_003413665.1.83341 WP_003413665.1.83349 WP_003413665.1.8335 WP_003413665.1.83353 WP_003413665.1.83367 WP_003413665.1.83380 WP_003413665.1.83381 WP_003413665.1.83389 WP_003413665.1.83408 WP_003413665.1.83409 WP_003413665.1.83435 WP_003413665.1.83470 WP_003413665.1.83524 WP_003413665.1.83526 WP_003413665.1.8358 WP_003413665.1.83589 WP_003413665.1.83601 WP_003413665.1.83611 WP_003413665.1.83638 WP_003413665.1.83648 WP_003413665.1.83656 WP_003413665.1.83667 WP_003413665.1.83689 WP_003413665.1.83692 WP_003413665.1.83704 WP_003413665.1.83705 WP_003413665.1.83766 WP_003413665.1.83793 WP_003413665.1.83794 WP_003413665.1.83802 WP_003413665.1.83805 WP_003413665.1.83839 WP_003413665.1.83842 WP_003413665.1.83850 WP_003413665.1.83861 WP_003413665.1.83884 WP_003413665.1.83920 WP_003413665.1.83929 WP_003413665.1.83930 WP_003413665.1.83975 WP_003413665.1.83991 WP_003413665.1.8400 WP_003413665.1.84027 WP_003413665.1.8404 WP_003413665.1.84057 WP_003413665.1.84070 WP_003413665.1.8409 WP_003413665.1.84112 WP_003413665.1.84146 WP_003413665.1.8415 WP_003413665.1.84176 WP_003413665.1.84186 WP_003413665.1.84192 WP_003413665.1.84228 WP_003413665.1.8424 WP_003413665.1.84244 WP_003413665.1.84259 WP_003413665.1.8426 WP_003413665.1.84277 WP_003413665.1.84287 WP_003413665.1.8434 WP_003413665.1.84388 WP_003413665.1.84408 WP_003413665.1.84409 WP_003413665.1.84438 WP_003413665.1.84460 WP_003413665.1.84488 WP_003413665.1.84504 WP_003413665.1.84525 WP_003413665.1.84620 WP_003413665.1.84623 WP_003413665.1.84641 WP_003413665.1.84655 WP_003413665.1.84666 WP_003413665.1.84670 WP_003413665.1.84739 WP_003413665.1.84748 WP_003413665.1.84766 WP_003413665.1.84772 WP_003413665.1.84774 WP_003413665.1.848 WP_003413665.1.84812 WP_003413665.1.84836 WP_003413665.1.84839 WP_003413665.1.84846 WP_003413665.1.84873 WP_003413665.1.84911 WP_003413665.1.84938 WP_003413665.1.84968 WP_003413665.1.84973 WP_003413665.1.84981 WP_003413665.1.84985 WP_003413665.1.8503 WP_003413665.1.85038 WP_003413665.1.85041 WP_003413665.1.85043 WP_003413665.1.8505 WP_003413665.1.85074 WP_003413665.1.8509 WP_003413665.1.8512 WP_003413665.1.85148 WP_003413665.1.8518 WP_003413665.1.8522 WP_003413665.1.85242 WP_003413665.1.85276 WP_003413665.1.85281 WP_003413665.1.85284 WP_003413665.1.85314 WP_003413665.1.85319 WP_003413665.1.85330 WP_003413665.1.85341 WP_003413665.1.85346 WP_003413665.1.8535 WP_003413665.1.85363 WP_003413665.1.85371 WP_003413665.1.85377 WP_003413665.1.85387 WP_003413665.1.85399 WP_003413665.1.85458 WP_003413665.1.8546 WP_003413665.1.85464 WP_003413665.1.85478 WP_003413665.1.85480 WP_003413665.1.85488 WP_003413665.1.85495 WP_003413665.1.85551 WP_003413665.1.85557 WP_003413665.1.85577 WP_003413665.1.85597 WP_003413665.1.85599 WP_003413665.1.85610 WP_003413665.1.8563 WP_003413665.1.85648 WP_003413665.1.85679 WP_003413665.1.85704 WP_003413665.1.85717 WP_003413665.1.85727 WP_003413665.1.85737 WP_003413665.1.85763 WP_003413665.1.85808 WP_003413665.1.85819 WP_003413665.1.85820 WP_003413665.1.85823 WP_003413665.1.85832 WP_003413665.1.8586 WP_003413665.1.85872 WP_003413665.1.85894 WP_003413665.1.85909 WP_003413665.1.85913 WP_003413665.1.85953 WP_003413665.1.85986 WP_003413665.1.86000 WP_003413665.1.86024 WP_003413665.1.86025 WP_003413665.1.86032 WP_003413665.1.86048 WP_003413665.1.86052 WP_003413665.1.86067 WP_003413665.1.86103 WP_003413665.1.86122 WP_003413665.1.86124 WP_003413665.1.86160 WP_003413665.1.86164 WP_003413665.1.86168 WP_003413665.1.86190 WP_003413665.1.86204 WP_003413665.1.86208 WP_003413665.1.86235 WP_003413665.1.86249 WP_003413665.1.86260 WP_003413665.1.86290 WP_003413665.1.863 WP_003413665.1.86327 WP_003413665.1.86334 WP_003413665.1.86337 WP_003413665.1.86368 WP_003413665.1.86377 WP_003413665.1.86425 WP_003413665.1.86459 WP_003413665.1.8649 WP_003413665.1.86499 WP_003413665.1.86520 WP_003413665.1.86561 WP_003413665.1.86568 WP_003413665.1.86575 WP_003413665.1.86584 WP_003413665.1.86605 WP_003413665.1.86626 WP_003413665.1.86648 WP_003413665.1.8666 WP_003413665.1.86684 WP_003413665.1.86696 WP_003413665.1.86705 WP_003413665.1.86718 WP_003413665.1.86725 WP_003413665.1.86757 WP_003413665.1.86766 WP_003413665.1.86801 WP_003413665.1.86814 WP_003413665.1.86820 WP_003413665.1.86825 WP_003413665.1.86834 WP_003413665.1.8685 WP_003413665.1.86851 WP_003413665.1.86855 WP_003413665.1.86867 WP_003413665.1.86877 WP_003413665.1.86883 WP_003413665.1.8689 WP_003413665.1.86892 WP_003413665.1.86933 WP_003413665.1.86941 WP_003413665.1.86950 WP_003413665.1.86962 WP_003413665.1.86963 WP_003413665.1.86979 WP_003413665.1.8700 WP_003413665.1.87001 WP_003413665.1.87002 WP_003413665.1.87031 WP_003413665.1.87116 WP_003413665.1.87117 WP_003413665.1.8714 WP_003413665.1.87162 WP_003413665.1.87178 WP_003413665.1.87191 WP_003413665.1.87201 WP_003413665.1.87209 WP_003413665.1.87240 WP_003413665.1.87266 WP_003413665.1.87273 WP_003413665.1.87275 WP_003413665.1.8733 WP_003413665.1.87345 WP_003413665.1.87369 WP_003413665.1.8737 WP_003413665.1.87401 WP_003413665.1.87404 WP_003413665.1.87406 WP_003413665.1.87409 WP_003413665.1.87444 WP_003413665.1.87446 WP_003413665.1.87459 WP_003413665.1.87472 WP_003413665.1.87489 WP_003413665.1.87494 WP_003413665.1.87496 WP_003413665.1.87582 WP_003413665.1.87588 WP_003413665.1.87617 WP_003413665.1.87619 WP_003413665.1.87620 WP_003413665.1.87634 WP_003413665.1.87643 WP_003413665.1.8765 WP_003413665.1.87650 WP_003413665.1.87654 WP_003413665.1.87658 WP_003413665.1.87665 WP_003413665.1.87676 WP_003413665.1.87677 WP_003413665.1.87684 WP_003413665.1.87692 WP_003413665.1.87707 WP_003413665.1.87732 WP_003413665.1.87784 WP_003413665.1.87796 WP_003413665.1.87809 WP_003413665.1.87817 WP_003413665.1.87827 WP_003413665.1.87831 WP_003413665.1.87835 WP_003413665.1.87837 WP_003413665.1.87866 WP_003413665.1.8789 WP_003413665.1.87911 WP_003413665.1.87924 WP_003413665.1.87951 WP_003413665.1.87955 WP_003413665.1.87956 WP_003413665.1.87991 WP_003413665.1.88 WP_003413665.1.88002 WP_003413665.1.88037 WP_003413665.1.88039 WP_003413665.1.88072 WP_003413665.1.88077 WP_003413665.1.88121 WP_003413665.1.88180 WP_003413665.1.88191 WP_003413665.1.88205 WP_003413665.1.88217 WP_003413665.1.88219 WP_003413665.1.88245 WP_003413665.1.88253 WP_003413665.1.88294 WP_003413665.1.88315 WP_003413665.1.88316 WP_003413665.1.88320 WP_003413665.1.88338 WP_003413665.1.8840 WP_003413665.1.88437 WP_003413665.1.88453 WP_003413665.1.88469 WP_003413665.1.88489 WP_003413665.1.88507 WP_003413665.1.88521 WP_003413665.1.88530 WP_003413665.1.88537 WP_003413665.1.88541 WP_003413665.1.88592 WP_003413665.1.88616 WP_003413665.1.88618 WP_003413665.1.8862 WP_003413665.1.88625 WP_003413665.1.88632 WP_003413665.1.88634 WP_003413665.1.88649 WP_003413665.1.8870 WP_003413665.1.88737 WP_003413665.1.88756 WP_003413665.1.888 WP_003413665.1.88824 WP_003413665.1.88886 WP_003413665.1.88965 WP_003413665.1.88985 WP_003413665.1.8902 WP_003413665.1.89025 WP_003413665.1.89041 WP_003413665.1.89046 WP_003413665.1.89082 WP_003413665.1.89162 WP_003413665.1.89168 WP_003413665.1.8917 WP_003413665.1.89193 WP_003413665.1.89205 WP_003413665.1.89207 WP_003413665.1.89225 WP_003413665.1.8925 WP_003413665.1.89277 WP_003413665.1.89286 WP_003413665.1.89293 WP_003413665.1.89320 WP_003413665.1.8935 WP_003413665.1.89371 WP_003413665.1.89378 WP_003413665.1.89392 WP_003413665.1.89406 WP_003413665.1.8943 WP_003413665.1.89451 WP_003413665.1.89453 WP_003413665.1.89473 WP_003413665.1.89475 WP_003413665.1.89483 WP_003413665.1.895 WP_003413665.1.89513 WP_003413665.1.89517 WP_003413665.1.89522 WP_003413665.1.8954 WP_003413665.1.89543 WP_003413665.1.89567 WP_003413665.1.8957 WP_003413665.1.89572 WP_003413665.1.89589 WP_003413665.1.89607 WP_003413665.1.89613 WP_003413665.1.89625 WP_003413665.1.89648 WP_003413665.1.8967 WP_003413665.1.89670 WP_003413665.1.89676 WP_003413665.1.89729 WP_003413665.1.89739 WP_003413665.1.89762 WP_003413665.1.8977 WP_003413665.1.89802 WP_003413665.1.89808 WP_003413665.1.8982 WP_003413665.1.89829 WP_003413665.1.89831 WP_003413665.1.89844 WP_003413665.1.89849 WP_003413665.1.8989 WP_003413665.1.89901 WP_003413665.1.89903 WP_003413665.1.89909 WP_003413665.1.8992 WP_003413665.1.89922 WP_003413665.1.89926 WP_003413665.1.89963 WP_003413665.1.89971 WP_003413665.1.8998 WP_003413665.1.89987 WP_003413665.1.900 WP_003413665.1.90048 WP_003413665.1.9007 WP_003413665.1.90080 WP_003413665.1.90130 WP_003413665.1.90134 WP_003413665.1.90137 WP_003413665.1.90157 WP_003413665.1.90184 WP_003413665.1.90199 WP_003413665.1.90231 WP_003413665.1.90245 WP_003413665.1.90308 WP_003413665.1.90322 WP_003413665.1.90328 WP_003413665.1.90372 WP_003413665.1.90439 WP_003413665.1.90481 WP_003413665.1.90499 WP_003413665.1.9050 WP_003413665.1.90527 WP_003413665.1.90550 WP_003413665.1.90560 WP_003413665.1.90612 WP_003413665.1.90640 WP_003413665.1.90672 WP_003413665.1.90687 WP_003413665.1.90691 WP_003413665.1.90711 WP_003413665.1.90722 WP_003413665.1.90744 WP_003413665.1.9075 WP_003413665.1.90756 WP_003413665.1.90767 WP_003413665.1.90771 WP_003413665.1.90785 WP_003413665.1.90788 WP_003413665.1.90800 WP_003413665.1.90810 WP_003413665.1.90816 WP_003413665.1.90819 WP_003413665.1.9082 WP_003413665.1.90831 WP_003413665.1.90884 WP_003413665.1.90899 WP_003413665.1.90906 WP_003413665.1.90958 WP_003413665.1.90976 WP_003413665.1.90977 WP_003413665.1.90987 WP_003413665.1.9102 WP_003413665.1.91026 WP_003413665.1.91032 WP_003413665.1.91043 WP_003413665.1.91053 WP_003413665.1.91082 WP_003413665.1.91106 WP_003413665.1.91112 WP_003413665.1.91144 WP_003413665.1.91151 WP_003413665.1.91157 WP_003413665.1.91167 WP_003413665.1.91169 WP_003413665.1.91192 WP_003413665.1.91201 WP_003413665.1.91207 WP_003413665.1.91208 WP_003413665.1.91211 WP_003413665.1.91214 WP_003413665.1.91230 WP_003413665.1.91244 WP_003413665.1.91251 WP_003413665.1.91260 WP_003413665.1.91265 WP_003413665.1.9128 WP_003413665.1.91284 WP_003413665.1.91294 WP_003413665.1.91303 WP_003413665.1.91322 WP_003413665.1.91352 WP_003413665.1.91386 WP_003413665.1.9139 WP_003413665.1.91398 WP_003413665.1.91411 WP_003413665.1.91430 WP_003413665.1.91436 WP_003413665.1.91483 WP_003413665.1.91496 WP_003413665.1.91507 WP_003413665.1.91508 WP_003413665.1.91576 WP_003413665.1.91589 WP_003413665.1.91694 WP_003413665.1.91695 WP_003413665.1.91713 WP_003413665.1.91716 WP_003413665.1.91717 WP_003413665.1.91728 WP_003413665.1.91743 WP_003413665.1.91759 WP_003413665.1.91784 WP_003413665.1.91785 WP_003413665.1.91786 WP_003413665.1.91802 WP_003413665.1.91822 WP_003413665.1.91828 WP_003413665.1.9189 WP_003413665.1.91896 WP_003413665.1.9190 WP_003413665.1.91915 WP_003413665.1.91931 WP_003413665.1.91937 WP_003413665.1.91944 WP_003413665.1.91953 WP_003413665.1.91957 WP_003413665.1.91976 WP_003413665.1.91978 WP_003413665.1.92021 WP_003413665.1.92083 WP_003413665.1.92127 WP_003413665.1.92144 WP_003413665.1.92150 WP_003413665.1.92153 WP_003413665.1.92190 WP_003413665.1.92192 WP_003413665.1.92200 WP_003413665.1.92220 WP_003413665.1.92221 WP_003413665.1.92222 WP_003413665.1.92273 WP_003413665.1.92289 WP_003413665.1.9229 WP_003413665.1.92294 WP_003413665.1.92300 WP_003413665.1.92317 WP_003413665.1.92334 WP_003413665.1.92338 WP_003413665.1.92345 WP_003413665.1.92356 WP_003413665.1.92364 WP_003413665.1.92380 WP_003413665.1.92416 WP_003413665.1.92428 WP_003413665.1.92447 WP_003413665.1.92456 WP_003413665.1.92467 WP_003413665.1.92471 WP_003413665.1.92490 WP_003413665.1.92508 WP_003413665.1.9251 WP_003413665.1.92511 WP_003413665.1.92523 WP_003413665.1.92527 WP_003413665.1.92536 WP_003413665.1.92592 WP_003413665.1.92597 WP_003413665.1.92603 WP_003413665.1.92606 WP_003413665.1.92610 WP_003413665.1.92613 WP_003413665.1.9263 WP_003413665.1.9265 WP_003413665.1.92650 WP_003413665.1.92660 WP_003413665.1.92677 WP_003413665.1.92685 WP_003413665.1.92689 WP_003413665.1.92690 WP_003413665.1.92706 WP_003413665.1.92714 WP_003413665.1.92736 WP_003413665.1.9274 WP_003413665.1.92752 WP_003413665.1.92760 WP_003413665.1.92777 WP_003413665.1.92803 WP_003413665.1.92833 WP_003413665.1.92856 WP_003413665.1.92881 WP_003413665.1.92892 WP_003413665.1.92907 WP_003413665.1.92908 WP_003413665.1.9291 WP_003413665.1.92917 WP_003413665.1.92996 WP_003413665.1.93006 WP_003413665.1.93008 WP_003413665.1.93009 WP_003413665.1.93015 WP_003413665.1.93043 WP_003413665.1.9307 WP_003413665.1.93083 WP_003413665.1.93097 WP_003413665.1.93137 WP_003413665.1.93192 WP_003413665.1.93199 WP_003413665.1.93203 WP_003413665.1.93212 WP_003413665.1.93234 WP_003413665.1.93245 WP_003413665.1.93257 WP_003413665.1.93265 WP_003413665.1.93297 WP_003413665.1.93320 WP_003413665.1.93328 WP_003413665.1.93337 WP_003413665.1.93343 WP_003413665.1.93349 WP_003413665.1.93363 WP_003413665.1.93377 WP_003413665.1.9338 WP_003413665.1.93407 WP_003413665.1.93417 WP_003413665.1.93419 WP_003413665.1.93426 WP_003413665.1.9344 WP_003413665.1.93443 WP_003413665.1.93447 WP_003413665.1.93470 WP_003413665.1.93483 WP_003413665.1.93487 WP_003413665.1.93495 WP_003413665.1.93499 WP_003413665.1.93516 WP_003413665.1.93536 WP_003413665.1.93544 WP_003413665.1.93555 WP_003413665.1.93560 WP_003413665.1.93564 WP_003413665.1.9357 WP_003413665.1.93573 WP_003413665.1.93576 WP_003413665.1.93588 WP_003413665.1.9363 WP_003413665.1.93645 WP_003413665.1.93649 WP_003413665.1.93659 WP_003413665.1.93677 WP_003413665.1.9368 WP_003413665.1.93689 WP_003413665.1.93693 WP_003413665.1.93698 WP_003413665.1.93706 WP_003413665.1.9371 WP_003413665.1.93792 WP_003413665.1.93823 WP_003413665.1.93871 WP_003413665.1.9388 WP_003413665.1.93894 WP_003413665.1.93903 WP_003413665.1.93907 WP_003413665.1.93913 WP_003413665.1.93946 WP_003413665.1.93950 WP_003413665.1.93953 WP_003413665.1.93954 WP_003413665.1.93988 WP_003413665.1.9407 WP_003413665.1.94143 WP_003413665.1.94154 WP_003413665.1.94184 WP_003413665.1.94204 WP_003413665.1.94205 WP_003413665.1.94226 WP_003413665.1.94231 WP_003413665.1.94256 WP_003413665.1.94261 WP_003413665.1.94281 WP_003413665.1.94292 WP_003413665.1.94297 WP_003413665.1.9431 WP_003413665.1.94326 WP_003413665.1.94339 WP_003413665.1.94392 WP_003413665.1.94416 WP_003413665.1.94421 WP_003413665.1.94456 WP_003413665.1.94470 WP_003413665.1.94480 WP_003413665.1.94495 WP_003413665.1.94511 WP_003413665.1.94512 WP_003413665.1.94525 WP_003413665.1.94528 WP_003413665.1.94564 WP_003413665.1.946 WP_003413665.1.94602 WP_003413665.1.94623 WP_003413665.1.94629 WP_003413665.1.9465 WP_003413665.1.94673 WP_003413665.1.94714 WP_003413665.1.94730 WP_003413665.1.94736 WP_003413665.1.94776 WP_003413665.1.9478 WP_003413665.1.94834 WP_003413665.1.94852 WP_003413665.1.94872 WP_003413665.1.9488 WP_003413665.1.94902 WP_003413665.1.94916 WP_003413665.1.94979 WP_003413665.1.94994 WP_003413665.1.94996 WP_003413665.1.94998 WP_003413665.1.95007 WP_003413665.1.95010 WP_003413665.1.95015 WP_003413665.1.95034 WP_003413665.1.95068 WP_003413665.1.95081 WP_003413665.1.95082 WP_003413665.1.9509 WP_003413665.1.95096 WP_003413665.1.95112 WP_003413665.1.95138 WP_003413665.1.9514 WP_003413665.1.95179 WP_003413665.1.95188 WP_003413665.1.95190 WP_003413665.1.95234 WP_003413665.1.95241 WP_003413665.1.95245 WP_003413665.1.95257 WP_003413665.1.95279 WP_003413665.1.9531 WP_003413665.1.95335 WP_003413665.1.95344 WP_003413665.1.9535 WP_003413665.1.95370 WP_003413665.1.95392 WP_003413665.1.95416 WP_003413665.1.95417 WP_003413665.1.95454 WP_003413665.1.95455 WP_003413665.1.95491 WP_003413665.1.95497 WP_003413665.1.95508 WP_003413665.1.95509 WP_003413665.1.95529 WP_003413665.1.95556 WP_003413665.1.95557 WP_003413665.1.95565 WP_003413665.1.95578 WP_003413665.1.95580 WP_003413665.1.95585 WP_003413665.1.95643 WP_003413665.1.95679 WP_003413665.1.95685 WP_003413665.1.957 WP_003413665.1.95724 WP_003413665.1.95727 WP_003413665.1.95730 WP_003413665.1.95735 WP_003413665.1.95758 WP_003413665.1.95772 WP_003413665.1.95797 WP_003413665.1.95839 WP_003413665.1.9585 WP_003413665.1.9590 WP_003413665.1.95902 WP_003413665.1.95908 WP_003413665.1.95924 WP_003413665.1.95926 WP_003413665.1.95953 WP_003413665.1.95958 WP_003413665.1.95964 WP_003413665.1.95973 WP_003413665.1.96006 WP_003413665.1.9602 WP_003413665.1.96036 WP_003413665.1.96062 WP_003413665.1.96065 WP_003413665.1.96098 WP_003413665.1.96146 WP_003413665.1.96166 WP_003413665.1.96171 WP_003413665.1.96182 WP_003413665.1.96204 WP_003413665.1.96230 WP_003413665.1.96235 WP_003413665.1.96242 WP_003413665.1.96245 WP_003413665.1.96254 WP_003413665.1.96259 WP_003413665.1.96286 WP_003413665.1.96313 WP_003413665.1.96318 WP_003413665.1.96345 WP_003413665.1.96360 WP_003413665.1.96373 WP_003413665.1.96456 WP_003413665.1.96486 WP_003413665.1.96560 WP_003413665.1.96569 WP_003413665.1.96573 WP_003413665.1.96575 WP_003413665.1.96576 WP_003413665.1.96611 WP_003413665.1.96621 WP_003413665.1.9667 WP_003413665.1.96681 WP_003413665.1.96726 WP_003413665.1.96733 WP_003413665.1.96742 WP_003413665.1.96754 WP_003413665.1.9678 WP_003413665.1.96832 WP_003413665.1.9685 WP_003413665.1.97008 WP_003413665.1.97009 WP_003413665.1.97056 WP_003413665.1.97084 WP_003413665.1.97087 WP_003413665.1.97094 WP_003413665.1.97096 WP_003413665.1.97099 WP_003413665.1.97108 WP_003413665.1.97113 WP_003413665.1.97122 WP_003413665.1.97127 WP_003413665.1.97129 WP_003413665.1.97136 WP_003413665.1.9716 WP_003413665.1.97176 WP_003413665.1.97222 WP_003413665.1.97223 WP_003413665.1.97237 WP_003413665.1.97242 WP_003413665.1.97270 WP_003413665.1.97283 WP_003413665.1.97296 WP_003413665.1.97321 WP_003413665.1.97325 WP_003413665.1.97330 WP_003413665.1.97366 WP_003413665.1.97376 WP_003413665.1.97380 WP_003413665.1.9739 WP_003413665.1.97462 WP_003413665.1.97517 WP_003413665.1.97519 WP_003413665.1.97535 WP_003413665.1.97540 WP_003413665.1.97545 WP_003413665.1.97546 WP_003413665.1.97550 WP_003413665.1.97568 WP_003413665.1.97577 WP_003413665.1.97584 WP_003413665.1.9759 WP_003413665.1.97591 WP_003413665.1.97596 WP_003413665.1.97609 WP_003413665.1.97618 WP_003413665.1.9763 WP_003413665.1.97669 WP_003413665.1.97673 WP_003413665.1.97700 WP_003413665.1.97701 WP_003413665.1.9773 WP_003413665.1.97730 WP_003413665.1.97740 WP_003413665.1.97751 WP_003413665.1.97754 WP_003413665.1.97797 WP_003413665.1.9782 WP_003413665.1.9784 WP_003413665.1.97888 WP_003413665.1.9790 WP_003413665.1.9795 WP_003413665.1.97951 WP_003413665.1.97958 WP_003413665.1.97966 WP_003413665.1.97977 WP_003413665.1.97979 WP_003413665.1.97995 WP_003413665.1.98018 WP_003413665.1.98034 WP_003413665.1.98052 WP_003413665.1.98071 WP_003413665.1.98072 WP_003413665.1.98113 WP_003413665.1.98114 WP_003413665.1.98128 WP_003413665.1.98181 WP_003413665.1.98188 WP_003413665.1.98189 WP_003413665.1.98213 WP_003413665.1.98225 WP_003413665.1.98291 WP_003413665.1.98335 WP_003413665.1.98350 WP_003413665.1.98395 WP_003413665.1.98412 WP_003413665.1.98441 WP_003413665.1.98443 WP_003413665.1.98462 WP_003413665.1.9848 WP_003413665.1.98482 WP_003413665.1.98486 WP_003413665.1.98488 WP_003413665.1.98503 WP_003413665.1.98516 WP_003413665.1.98524 WP_003413665.1.98536 WP_003413665.1.98541 WP_003413665.1.98566 WP_003413665.1.98576 WP_003413665.1.98590 WP_003413665.1.98594 WP_003413665.1.98599 WP_003413665.1.98629 WP_003413665.1.98645 WP_003413665.1.98646 WP_003413665.1.98649 WP_003413665.1.98656 WP_003413665.1.9867 WP_003413665.1.98674 WP_003413665.1.98697 WP_003413665.1.98701 WP_003413665.1.98739 WP_003413665.1.98749 WP_003413665.1.98765 WP_003413665.1.98770 WP_003413665.1.98777 WP_003413665.1.98778 WP_003413665.1.98802 WP_003413665.1.98838 WP_003413665.1.98850 WP_003413665.1.98906 WP_003413665.1.98935 WP_003413665.1.98948 WP_003413665.1.98953 WP_003413665.1.98984 WP_003413665.1.99000 WP_003413665.1.99023 WP_003413665.1.99030 WP_003413665.1.99037 WP_003413665.1.99055 WP_003413665.1.99062 WP_003413665.1.99086 WP_003413665.1.99115 WP_003413665.1.99117 WP_003413665.1.99161 WP_003413665.1.99176 WP_003413665.1.99205 WP_003413665.1.99211 WP_003413665.1.99216 WP_003413665.1.99222 WP_003413665.1.99251 WP_003413665.1.99269 WP_003413665.1.99294 WP_003413665.1.99312 WP_003413665.1.99315 WP_003413665.1.99316 WP_003413665.1.99322 WP_003413665.1.99328 WP_003413665.1.99365 WP_003413665.1.99368 WP_003413665.1.99379 WP_003413665.1.99396 WP_003413665.1.99402 WP_003413665.1.99404 WP_003413665.1.99419 WP_003413665.1.99438 WP_003413665.1.99460 WP_003413665.1.99468 WP_003413665.1.99473 WP_003413665.1.99513 WP_003413665.1.99529 WP_003413665.1.99548 WP_003413665.1.99572 WP_003413665.1.99575 WP_003413665.1.99578 WP_003413665.1.99605 WP_003413665.1.99609 WP_003413665.1.99617 WP_003413665.1.99635 WP_003413665.1.99650 WP_003413665.1.99672 WP_003413665.1.99701 WP_003413665.1.99711 WP_003413665.1.99716 WP_003413665.1.99740 WP_003413665.1.99745 WP_003413665.1.99749 WP_003413665.1.9976 WP_003413665.1.99798 WP_003413665.1.99817 WP_003413665.1.99832 WP_003413665.1.99847 WP_003413665.1.99852 WP_003413665.1.99886 WP_003413665.1.99897 WP_003413665.1.99899 WP_003413665.1.99915 WP_003413665.1.9993 WP_003413665.1.99982 WP_003413665.1.99991 gi|339632667|ref|YP_004724309.1| gi|525675188|ref|YP_008226738.1| gi|378772384|ref|YP_005172117.1| gi|375295543|ref|YP_005099810.1| gi|385991939|ref|YP_005910237.1| gi|31793826|ref|NP_856319.1| gi|433642844|ref|YP_007288603.1| gi|197738297|ref|YP_002159612.1| gi|392431751|ref|YP_006472795.1| gi|449064721|ref|YP_007431804.1| gi|224991023|ref|YP_002645710.1| gi|148823833|ref|YP_001288587.1| gi|494701077|ref|YP_007966559.1| gi|15842181|ref|NP_337218.1| gi|479056605|ref|YP_007352411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]