SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197738299|ref|YP_002159614.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197738299|ref|YP_002159614.1|
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.44e-25
Family ArsR-like transcriptional regulators 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197738299|ref|YP_002159614.1|
Sequence length 126
Comment transcriptional regulator ArsR-family [Mycobacterium tuberculosis str. Haarlem]
Sequence
MSNLHPLPEVASCVVAPLVREPLNPPAAAEMAARFKALADPVRLQLLSSVASRAGGEACV
CDISAGVEVSQPTISHHLKVLRDAGLLTSRRRASWVYYAVVPEALTVLSNLLSVHADAAP
ALGAPA
Download sequence
Identical sequences A0A045K0S3 A0A089QQ66 A0A0H3LGH3 A0A0H3MG19 A0A0K2HYV1 A0A120IXS8 A0A120J273 A0A197ISQ1 A0A1A9EA50 A0A1R3Y1T1 A0A1S1BDG3 A5U5Z4 F8M2Z6 G0TQP3 P71941 R4M9P6
gi|525675190|ref|YP_008226740.1| gi|15609779|ref|NP_217158.1| gi|385991941|ref|YP_005910239.1| gi|385999424|ref|YP_005917723.1| gi|506927182|ref|YP_008007632.1| NP_217158.1.84033 WP_003899407.1.100000 WP_003899407.1.100021 WP_003899407.1.100069 WP_003899407.1.100087 WP_003899407.1.10015 WP_003899407.1.100208 WP_003899407.1.100216 WP_003899407.1.10022 WP_003899407.1.100255 WP_003899407.1.100260 WP_003899407.1.100270 WP_003899407.1.100279 WP_003899407.1.100286 WP_003899407.1.100308 WP_003899407.1.100309 WP_003899407.1.100318 WP_003899407.1.100337 WP_003899407.1.100338 WP_003899407.1.10037 WP_003899407.1.100383 WP_003899407.1.100395 WP_003899407.1.100396 WP_003899407.1.1004 WP_003899407.1.100401 WP_003899407.1.100459 WP_003899407.1.100460 WP_003899407.1.100552 WP_003899407.1.100581 WP_003899407.1.100600 WP_003899407.1.100625 WP_003899407.1.10064 WP_003899407.1.100666 WP_003899407.1.100671 WP_003899407.1.100677 WP_003899407.1.100682 WP_003899407.1.100697 WP_003899407.1.100703 WP_003899407.1.100716 WP_003899407.1.100722 WP_003899407.1.100754 WP_003899407.1.100757 WP_003899407.1.100772 WP_003899407.1.1008 WP_003899407.1.100812 WP_003899407.1.100845 WP_003899407.1.100866 WP_003899407.1.10088 WP_003899407.1.100889 WP_003899407.1.10090 WP_003899407.1.100910 WP_003899407.1.100915 WP_003899407.1.100918 WP_003899407.1.100935 WP_003899407.1.100984 WP_003899407.1.100992 WP_003899407.1.100998 WP_003899407.1.101 WP_003899407.1.101025 WP_003899407.1.101028 WP_003899407.1.10104 WP_003899407.1.101048 WP_003899407.1.101054 WP_003899407.1.101075 WP_003899407.1.101143 WP_003899407.1.101146 WP_003899407.1.10116 WP_003899407.1.10117 WP_003899407.1.101209 WP_003899407.1.10125 WP_003899407.1.101290 WP_003899407.1.101323 WP_003899407.1.101324 WP_003899407.1.101350 WP_003899407.1.101367 WP_003899407.1.101398 WP_003899407.1.101403 WP_003899407.1.101421 WP_003899407.1.10144 WP_003899407.1.101442 WP_003899407.1.10145 WP_003899407.1.101452 WP_003899407.1.101456 WP_003899407.1.101481 WP_003899407.1.101493 WP_003899407.1.101496 WP_003899407.1.101525 WP_003899407.1.101533 WP_003899407.1.101535 WP_003899407.1.101553 WP_003899407.1.101558 WP_003899407.1.10156 WP_003899407.1.101573 WP_003899407.1.101576 WP_003899407.1.10159 WP_003899407.1.101592 WP_003899407.1.101604 WP_003899407.1.101607 WP_003899407.1.101622 WP_003899407.1.101644 WP_003899407.1.101659 WP_003899407.1.101671 WP_003899407.1.101687 WP_003899407.1.101698 WP_003899407.1.10170 WP_003899407.1.101713 WP_003899407.1.101722 WP_003899407.1.101733 WP_003899407.1.101743 WP_003899407.1.101753 WP_003899407.1.101754 WP_003899407.1.101764 WP_003899407.1.101795 WP_003899407.1.101797 WP_003899407.1.101798 WP_003899407.1.101802 WP_003899407.1.101826 WP_003899407.1.101836 WP_003899407.1.101858 WP_003899407.1.101859 WP_003899407.1.101862 WP_003899407.1.101888 WP_003899407.1.101894 WP_003899407.1.101899 WP_003899407.1.1019 WP_003899407.1.101923 WP_003899407.1.101925 WP_003899407.1.10193 WP_003899407.1.101996 WP_003899407.1.102 WP_003899407.1.102008 WP_003899407.1.102017 WP_003899407.1.102053 WP_003899407.1.102055 WP_003899407.1.102063 WP_003899407.1.102099 WP_003899407.1.1021 WP_003899407.1.10211 WP_003899407.1.102119 WP_003899407.1.102121 WP_003899407.1.102143 WP_003899407.1.10216 WP_003899407.1.10224 WP_003899407.1.10253 WP_003899407.1.10262 WP_003899407.1.10272 WP_003899407.1.10277 WP_003899407.1.1033 WP_003899407.1.10350 WP_003899407.1.10362 WP_003899407.1.10366 WP_003899407.1.10376 WP_003899407.1.10396 WP_003899407.1.10410 WP_003899407.1.10414 WP_003899407.1.10421 WP_003899407.1.10430 WP_003899407.1.1044 WP_003899407.1.10440 WP_003899407.1.10445 WP_003899407.1.10471 WP_003899407.1.10472 WP_003899407.1.10489 WP_003899407.1.105 WP_003899407.1.10518 WP_003899407.1.10523 WP_003899407.1.10545 WP_003899407.1.1057 WP_003899407.1.10594 WP_003899407.1.10603 WP_003899407.1.10606 WP_003899407.1.10615 WP_003899407.1.10623 WP_003899407.1.10635 WP_003899407.1.10643 WP_003899407.1.10648 WP_003899407.1.10662 WP_003899407.1.10709 WP_003899407.1.10735 WP_003899407.1.10740 WP_003899407.1.10756 WP_003899407.1.1078 WP_003899407.1.10791 WP_003899407.1.10799 WP_003899407.1.10825 WP_003899407.1.10848 WP_003899407.1.10863 WP_003899407.1.10879 WP_003899407.1.10912 WP_003899407.1.10916 WP_003899407.1.10923 WP_003899407.1.10927 WP_003899407.1.1095 WP_003899407.1.10956 WP_003899407.1.10958 WP_003899407.1.10962 WP_003899407.1.10980 WP_003899407.1.10981 WP_003899407.1.10993 WP_003899407.1.1100 WP_003899407.1.11040 WP_003899407.1.11061 WP_003899407.1.11070 WP_003899407.1.11141 WP_003899407.1.11171 WP_003899407.1.11175 WP_003899407.1.11176 WP_003899407.1.11222 WP_003899407.1.11236 WP_003899407.1.11329 WP_003899407.1.1133 WP_003899407.1.11342 WP_003899407.1.11373 WP_003899407.1.11376 WP_003899407.1.11390 WP_003899407.1.11402 WP_003899407.1.11481 WP_003899407.1.11487 WP_003899407.1.11489 WP_003899407.1.11491 WP_003899407.1.11514 WP_003899407.1.11587 WP_003899407.1.11589 WP_003899407.1.11596 WP_003899407.1.11604 WP_003899407.1.11610 WP_003899407.1.11697 WP_003899407.1.11707 WP_003899407.1.11752 WP_003899407.1.11758 WP_003899407.1.11761 WP_003899407.1.11775 WP_003899407.1.11804 WP_003899407.1.11822 WP_003899407.1.11826 WP_003899407.1.11856 WP_003899407.1.11898 WP_003899407.1.11906 WP_003899407.1.11939 WP_003899407.1.11960 WP_003899407.1.11961 WP_003899407.1.11972 WP_003899407.1.11984 WP_003899407.1.120 WP_003899407.1.12001 WP_003899407.1.12049 WP_003899407.1.12052 WP_003899407.1.12100 WP_003899407.1.12116 WP_003899407.1.12130 WP_003899407.1.12133 WP_003899407.1.12161 WP_003899407.1.12165 WP_003899407.1.12184 WP_003899407.1.12187 WP_003899407.1.12190 WP_003899407.1.12216 WP_003899407.1.12265 WP_003899407.1.12275 WP_003899407.1.12293 WP_003899407.1.12294 WP_003899407.1.123 WP_003899407.1.1231 WP_003899407.1.12314 WP_003899407.1.12327 WP_003899407.1.12338 WP_003899407.1.1236 WP_003899407.1.12371 WP_003899407.1.12372 WP_003899407.1.12389 WP_003899407.1.12406 WP_003899407.1.1241 WP_003899407.1.12421 WP_003899407.1.12424 WP_003899407.1.12446 WP_003899407.1.12464 WP_003899407.1.12479 WP_003899407.1.12519 WP_003899407.1.12523 WP_003899407.1.12526 WP_003899407.1.1255 WP_003899407.1.12550 WP_003899407.1.12551 WP_003899407.1.12563 WP_003899407.1.12611 WP_003899407.1.12669 WP_003899407.1.1267 WP_003899407.1.12672 WP_003899407.1.12692 WP_003899407.1.1271 WP_003899407.1.12710 WP_003899407.1.12768 WP_003899407.1.1279 WP_003899407.1.12794 WP_003899407.1.12801 WP_003899407.1.12804 WP_003899407.1.12821 WP_003899407.1.12841 WP_003899407.1.12854 WP_003899407.1.12871 WP_003899407.1.12901 WP_003899407.1.12941 WP_003899407.1.12947 WP_003899407.1.12957 WP_003899407.1.12972 WP_003899407.1.13028 WP_003899407.1.13043 WP_003899407.1.13086 WP_003899407.1.13087 WP_003899407.1.13090 WP_003899407.1.13096 WP_003899407.1.13163 WP_003899407.1.13175 WP_003899407.1.13183 WP_003899407.1.132 WP_003899407.1.13249 WP_003899407.1.13282 WP_003899407.1.13284 WP_003899407.1.13296 WP_003899407.1.13298 WP_003899407.1.13302 WP_003899407.1.13306 WP_003899407.1.13312 WP_003899407.1.13313 WP_003899407.1.13321 WP_003899407.1.13345 WP_003899407.1.13358 WP_003899407.1.13370 WP_003899407.1.13375 WP_003899407.1.1338 WP_003899407.1.13420 WP_003899407.1.13433 WP_003899407.1.13435 WP_003899407.1.13438 WP_003899407.1.13461 WP_003899407.1.13466 WP_003899407.1.13489 WP_003899407.1.13526 WP_003899407.1.13551 WP_003899407.1.13561 WP_003899407.1.13564 WP_003899407.1.13579 WP_003899407.1.13647 WP_003899407.1.13667 WP_003899407.1.13687 WP_003899407.1.13697 WP_003899407.1.13719 WP_003899407.1.13763 WP_003899407.1.1377 WP_003899407.1.13774 WP_003899407.1.13786 WP_003899407.1.13793 WP_003899407.1.13794 WP_003899407.1.13817 WP_003899407.1.13834 WP_003899407.1.13866 WP_003899407.1.13880 WP_003899407.1.13899 WP_003899407.1.13909 WP_003899407.1.13910 WP_003899407.1.13919 WP_003899407.1.13920 WP_003899407.1.13952 WP_003899407.1.13953 WP_003899407.1.13962 WP_003899407.1.1398 WP_003899407.1.13988 WP_003899407.1.14027 WP_003899407.1.14046 WP_003899407.1.14115 WP_003899407.1.1415 WP_003899407.1.14152 WP_003899407.1.14158 WP_003899407.1.14162 WP_003899407.1.14175 WP_003899407.1.14178 WP_003899407.1.14194 WP_003899407.1.14195 WP_003899407.1.14208 WP_003899407.1.14238 WP_003899407.1.14266 WP_003899407.1.14273 WP_003899407.1.14303 WP_003899407.1.14306 WP_003899407.1.14307 WP_003899407.1.14310 WP_003899407.1.14341 WP_003899407.1.14382 WP_003899407.1.14416 WP_003899407.1.14428 WP_003899407.1.14441 WP_003899407.1.14469 WP_003899407.1.14477 WP_003899407.1.14504 WP_003899407.1.14514 WP_003899407.1.1452 WP_003899407.1.14527 WP_003899407.1.1454 WP_003899407.1.14544 WP_003899407.1.14548 WP_003899407.1.14551 WP_003899407.1.14561 WP_003899407.1.14573 WP_003899407.1.1462 WP_003899407.1.14658 WP_003899407.1.14667 WP_003899407.1.14668 WP_003899407.1.14675 WP_003899407.1.14694 WP_003899407.1.14695 WP_003899407.1.14709 WP_003899407.1.14766 WP_003899407.1.14783 WP_003899407.1.14865 WP_003899407.1.14872 WP_003899407.1.14905 WP_003899407.1.14926 WP_003899407.1.14951 WP_003899407.1.14955 WP_003899407.1.15003 WP_003899407.1.15009 WP_003899407.1.15028 WP_003899407.1.15040 WP_003899407.1.15052 WP_003899407.1.15065 WP_003899407.1.15072 WP_003899407.1.15089 WP_003899407.1.1509 WP_003899407.1.15126 WP_003899407.1.15131 WP_003899407.1.15168 WP_003899407.1.15172 WP_003899407.1.15174 WP_003899407.1.15187 WP_003899407.1.15196 WP_003899407.1.15210 WP_003899407.1.15216 WP_003899407.1.15217 WP_003899407.1.1523 WP_003899407.1.15232 WP_003899407.1.15238 WP_003899407.1.15240 WP_003899407.1.15253 WP_003899407.1.15267 WP_003899407.1.1527 WP_003899407.1.15292 WP_003899407.1.15299 WP_003899407.1.15302 WP_003899407.1.15322 WP_003899407.1.1534 WP_003899407.1.15345 WP_003899407.1.15365 WP_003899407.1.15372 WP_003899407.1.15386 WP_003899407.1.15387 WP_003899407.1.15442 WP_003899407.1.15447 WP_003899407.1.15449 WP_003899407.1.15477 WP_003899407.1.15481 WP_003899407.1.15492 WP_003899407.1.15511 WP_003899407.1.15512 WP_003899407.1.15558 WP_003899407.1.15559 WP_003899407.1.15566 WP_003899407.1.15599 WP_003899407.1.1560 WP_003899407.1.15611 WP_003899407.1.1563 WP_003899407.1.15633 WP_003899407.1.15643 WP_003899407.1.15688 WP_003899407.1.15755 WP_003899407.1.15763 WP_003899407.1.15774 WP_003899407.1.1578 WP_003899407.1.15780 WP_003899407.1.15827 WP_003899407.1.15834 WP_003899407.1.15842 WP_003899407.1.15848 WP_003899407.1.15853 WP_003899407.1.15870 WP_003899407.1.15877 WP_003899407.1.15893 WP_003899407.1.15896 WP_003899407.1.15926 WP_003899407.1.15933 WP_003899407.1.15946 WP_003899407.1.15958 WP_003899407.1.15973 WP_003899407.1.15987 WP_003899407.1.15993 WP_003899407.1.16009 WP_003899407.1.16025 WP_003899407.1.16043 WP_003899407.1.16055 WP_003899407.1.16066 WP_003899407.1.16069 WP_003899407.1.16077 WP_003899407.1.16106 WP_003899407.1.16108 WP_003899407.1.16110 WP_003899407.1.16130 WP_003899407.1.16136 WP_003899407.1.16139 WP_003899407.1.16141 WP_003899407.1.16143 WP_003899407.1.1630 WP_003899407.1.16318 WP_003899407.1.1632 WP_003899407.1.16327 WP_003899407.1.16334 WP_003899407.1.16341 WP_003899407.1.16345 WP_003899407.1.16374 WP_003899407.1.16384 WP_003899407.1.16386 WP_003899407.1.164 WP_003899407.1.1642 WP_003899407.1.16424 WP_003899407.1.16426 WP_003899407.1.16431 WP_003899407.1.16438 WP_003899407.1.1644 WP_003899407.1.16442 WP_003899407.1.16448 WP_003899407.1.16451 WP_003899407.1.16476 WP_003899407.1.16480 WP_003899407.1.16494 WP_003899407.1.1652 WP_003899407.1.16549 WP_003899407.1.16560 WP_003899407.1.16598 WP_003899407.1.16609 WP_003899407.1.16619 WP_003899407.1.16620 WP_003899407.1.16622 WP_003899407.1.16637 WP_003899407.1.1669 WP_003899407.1.16707 WP_003899407.1.16724 WP_003899407.1.16731 WP_003899407.1.16743 WP_003899407.1.1683 WP_003899407.1.16837 WP_003899407.1.16852 WP_003899407.1.16937 WP_003899407.1.16940 WP_003899407.1.16950 WP_003899407.1.16959 WP_003899407.1.16968 WP_003899407.1.1697 WP_003899407.1.16973 WP_003899407.1.16977 WP_003899407.1.16987 WP_003899407.1.17005 WP_003899407.1.17006 WP_003899407.1.17010 WP_003899407.1.17015 WP_003899407.1.17019 WP_003899407.1.17039 WP_003899407.1.17041 WP_003899407.1.17052 WP_003899407.1.17057 WP_003899407.1.17062 WP_003899407.1.1707 WP_003899407.1.17094 WP_003899407.1.17130 WP_003899407.1.17138 WP_003899407.1.17147 WP_003899407.1.17167 WP_003899407.1.17224 WP_003899407.1.17251 WP_003899407.1.17288 WP_003899407.1.17304 WP_003899407.1.17314 WP_003899407.1.17345 WP_003899407.1.17381 WP_003899407.1.17391 WP_003899407.1.17412 WP_003899407.1.1743 WP_003899407.1.17440 WP_003899407.1.17466 WP_003899407.1.17477 WP_003899407.1.17483 WP_003899407.1.17505 WP_003899407.1.17527 WP_003899407.1.17535 WP_003899407.1.17540 WP_003899407.1.17553 WP_003899407.1.17558 WP_003899407.1.17599 WP_003899407.1.17635 WP_003899407.1.17655 WP_003899407.1.17679 WP_003899407.1.1768 WP_003899407.1.17687 WP_003899407.1.17700 WP_003899407.1.17710 WP_003899407.1.17713 WP_003899407.1.17722 WP_003899407.1.17746 WP_003899407.1.17788 WP_003899407.1.17798 WP_003899407.1.17803 WP_003899407.1.17816 WP_003899407.1.17821 WP_003899407.1.17830 WP_003899407.1.17868 WP_003899407.1.17878 WP_003899407.1.1792 WP_003899407.1.17923 WP_003899407.1.1795 WP_003899407.1.17955 WP_003899407.1.17973 WP_003899407.1.18009 WP_003899407.1.18013 WP_003899407.1.18033 WP_003899407.1.18057 WP_003899407.1.18065 WP_003899407.1.18070 WP_003899407.1.18116 WP_003899407.1.18120 WP_003899407.1.18126 WP_003899407.1.1817 WP_003899407.1.18170 WP_003899407.1.18206 WP_003899407.1.18216 WP_003899407.1.18240 WP_003899407.1.18257 WP_003899407.1.18297 WP_003899407.1.18306 WP_003899407.1.18364 WP_003899407.1.18399 WP_003899407.1.18411 WP_003899407.1.18444 WP_003899407.1.18467 WP_003899407.1.18476 WP_003899407.1.18522 WP_003899407.1.18580 WP_003899407.1.18582 WP_003899407.1.18587 WP_003899407.1.186 WP_003899407.1.18601 WP_003899407.1.18639 WP_003899407.1.18646 WP_003899407.1.18647 WP_003899407.1.1868 WP_003899407.1.18694 WP_003899407.1.18710 WP_003899407.1.18751 WP_003899407.1.18781 WP_003899407.1.18793 WP_003899407.1.18804 WP_003899407.1.18816 WP_003899407.1.18823 WP_003899407.1.18827 WP_003899407.1.18838 WP_003899407.1.18849 WP_003899407.1.18856 WP_003899407.1.18945 WP_003899407.1.1898 WP_003899407.1.19005 WP_003899407.1.19056 WP_003899407.1.19063 WP_003899407.1.19066 WP_003899407.1.19071 WP_003899407.1.19085 WP_003899407.1.19094 WP_003899407.1.19144 WP_003899407.1.19159 WP_003899407.1.19193 WP_003899407.1.19231 WP_003899407.1.19243 WP_003899407.1.19264 WP_003899407.1.19295 WP_003899407.1.19307 WP_003899407.1.19326 WP_003899407.1.1933 WP_003899407.1.19364 WP_003899407.1.19382 WP_003899407.1.19400 WP_003899407.1.19426 WP_003899407.1.19429 WP_003899407.1.19464 WP_003899407.1.19480 WP_003899407.1.19512 WP_003899407.1.19553 WP_003899407.1.19562 WP_003899407.1.19564 WP_003899407.1.19568 WP_003899407.1.19572 WP_003899407.1.19595 WP_003899407.1.19596 WP_003899407.1.19600 WP_003899407.1.19630 WP_003899407.1.1967 WP_003899407.1.19694 WP_003899407.1.1970 WP_003899407.1.19707 WP_003899407.1.19742 WP_003899407.1.19785 WP_003899407.1.19820 WP_003899407.1.19868 WP_003899407.1.19874 WP_003899407.1.19890 WP_003899407.1.19900 WP_003899407.1.19922 WP_003899407.1.19936 WP_003899407.1.19946 WP_003899407.1.19960 WP_003899407.1.19964 WP_003899407.1.20007 WP_003899407.1.20016 WP_003899407.1.20028 WP_003899407.1.2003 WP_003899407.1.20037 WP_003899407.1.20039 WP_003899407.1.20082 WP_003899407.1.20085 WP_003899407.1.20097 WP_003899407.1.20116 WP_003899407.1.20130 WP_003899407.1.20140 WP_003899407.1.20141 WP_003899407.1.20142 WP_003899407.1.20158 WP_003899407.1.20239 WP_003899407.1.20243 WP_003899407.1.20259 WP_003899407.1.20262 WP_003899407.1.20268 WP_003899407.1.20272 WP_003899407.1.20273 WP_003899407.1.20280 WP_003899407.1.20294 WP_003899407.1.20300 WP_003899407.1.20309 WP_003899407.1.20322 WP_003899407.1.2037 WP_003899407.1.20372 WP_003899407.1.20381 WP_003899407.1.204 WP_003899407.1.20427 WP_003899407.1.20432 WP_003899407.1.20457 WP_003899407.1.20459 WP_003899407.1.20460 WP_003899407.1.20542 WP_003899407.1.20578 WP_003899407.1.20608 WP_003899407.1.20624 WP_003899407.1.20628 WP_003899407.1.2066 WP_003899407.1.20707 WP_003899407.1.20722 WP_003899407.1.20729 WP_003899407.1.20742 WP_003899407.1.20751 WP_003899407.1.20776 WP_003899407.1.20843 WP_003899407.1.20850 WP_003899407.1.2086 WP_003899407.1.20868 WP_003899407.1.20876 WP_003899407.1.20897 WP_003899407.1.20898 WP_003899407.1.2090 WP_003899407.1.20911 WP_003899407.1.20916 WP_003899407.1.20921 WP_003899407.1.20926 WP_003899407.1.20927 WP_003899407.1.20951 WP_003899407.1.20970 WP_003899407.1.2104 WP_003899407.1.21070 WP_003899407.1.21127 WP_003899407.1.21135 WP_003899407.1.21173 WP_003899407.1.21187 WP_003899407.1.212 WP_003899407.1.2120 WP_003899407.1.21218 WP_003899407.1.21219 WP_003899407.1.2123 WP_003899407.1.21231 WP_003899407.1.21234 WP_003899407.1.2126 WP_003899407.1.21292 WP_003899407.1.21307 WP_003899407.1.2131 WP_003899407.1.21311 WP_003899407.1.21321 WP_003899407.1.21365 WP_003899407.1.2137 WP_003899407.1.21392 WP_003899407.1.21397 WP_003899407.1.21403 WP_003899407.1.21415 WP_003899407.1.21418 WP_003899407.1.21430 WP_003899407.1.21434 WP_003899407.1.21444 WP_003899407.1.21468 WP_003899407.1.21498 WP_003899407.1.21509 WP_003899407.1.21513 WP_003899407.1.21560 WP_003899407.1.21565 WP_003899407.1.21586 WP_003899407.1.21591 WP_003899407.1.21594 WP_003899407.1.21602 WP_003899407.1.21615 WP_003899407.1.21638 WP_003899407.1.21639 WP_003899407.1.21655 WP_003899407.1.21658 WP_003899407.1.2168 WP_003899407.1.2174 WP_003899407.1.21741 WP_003899407.1.21742 WP_003899407.1.21777 WP_003899407.1.21786 WP_003899407.1.21795 WP_003899407.1.218 WP_003899407.1.21826 WP_003899407.1.21829 WP_003899407.1.21840 WP_003899407.1.21843 WP_003899407.1.21872 WP_003899407.1.21873 WP_003899407.1.2188 WP_003899407.1.21882 WP_003899407.1.21906 WP_003899407.1.21912 WP_003899407.1.2194 WP_003899407.1.21941 WP_003899407.1.21956 WP_003899407.1.21958 WP_003899407.1.21960 WP_003899407.1.21971 WP_003899407.1.21973 WP_003899407.1.21983 WP_003899407.1.22003 WP_003899407.1.22013 WP_003899407.1.22025 WP_003899407.1.22036 WP_003899407.1.22075 WP_003899407.1.22092 WP_003899407.1.2212 WP_003899407.1.22127 WP_003899407.1.22140 WP_003899407.1.22233 WP_003899407.1.22255 WP_003899407.1.22277 WP_003899407.1.22348 WP_003899407.1.22356 WP_003899407.1.22366 WP_003899407.1.2238 WP_003899407.1.22380 WP_003899407.1.22437 WP_003899407.1.22438 WP_003899407.1.22445 WP_003899407.1.22490 WP_003899407.1.22511 WP_003899407.1.22524 WP_003899407.1.2253 WP_003899407.1.22585 WP_003899407.1.22589 WP_003899407.1.22606 WP_003899407.1.22608 WP_003899407.1.22609 WP_003899407.1.22618 WP_003899407.1.2262 WP_003899407.1.22624 WP_003899407.1.22629 WP_003899407.1.22647 WP_003899407.1.22664 WP_003899407.1.22665 WP_003899407.1.22670 WP_003899407.1.22674 WP_003899407.1.22680 WP_003899407.1.22725 WP_003899407.1.22728 WP_003899407.1.22733 WP_003899407.1.22737 WP_003899407.1.22754 WP_003899407.1.22797 WP_003899407.1.22800 WP_003899407.1.22804 WP_003899407.1.22829 WP_003899407.1.22840 WP_003899407.1.22844 WP_003899407.1.22963 WP_003899407.1.22970 WP_003899407.1.22996 WP_003899407.1.22997 WP_003899407.1.22999 WP_003899407.1.23015 WP_003899407.1.23032 WP_003899407.1.231 WP_003899407.1.23101 WP_003899407.1.2312 WP_003899407.1.23140 WP_003899407.1.23153 WP_003899407.1.23171 WP_003899407.1.23199 WP_003899407.1.2320 WP_003899407.1.23204 WP_003899407.1.23216 WP_003899407.1.23229 WP_003899407.1.23233 WP_003899407.1.2326 WP_003899407.1.23261 WP_003899407.1.23272 WP_003899407.1.23289 WP_003899407.1.2329 WP_003899407.1.23308 WP_003899407.1.23316 WP_003899407.1.23321 WP_003899407.1.23325 WP_003899407.1.2339 WP_003899407.1.23406 WP_003899407.1.23438 WP_003899407.1.23445 WP_003899407.1.23447 WP_003899407.1.23452 WP_003899407.1.23461 WP_003899407.1.2349 WP_003899407.1.23496 WP_003899407.1.23497 WP_003899407.1.23506 WP_003899407.1.23530 WP_003899407.1.23539 WP_003899407.1.23546 WP_003899407.1.23551 WP_003899407.1.23573 WP_003899407.1.23583 WP_003899407.1.23588 WP_003899407.1.23628 WP_003899407.1.23677 WP_003899407.1.23683 WP_003899407.1.23692 WP_003899407.1.23694 WP_003899407.1.23699 WP_003899407.1.2371 WP_003899407.1.23803 WP_003899407.1.23807 WP_003899407.1.23825 WP_003899407.1.23832 WP_003899407.1.2384 WP_003899407.1.23843 WP_003899407.1.23863 WP_003899407.1.23894 WP_003899407.1.23993 WP_003899407.1.2400 WP_003899407.1.24007 WP_003899407.1.24008 WP_003899407.1.24046 WP_003899407.1.24057 WP_003899407.1.24062 WP_003899407.1.24113 WP_003899407.1.24119 WP_003899407.1.24128 WP_003899407.1.24140 WP_003899407.1.24176 WP_003899407.1.24190 WP_003899407.1.24202 WP_003899407.1.24244 WP_003899407.1.24261 WP_003899407.1.24284 WP_003899407.1.24294 WP_003899407.1.24357 WP_003899407.1.24396 WP_003899407.1.24414 WP_003899407.1.24423 WP_003899407.1.2443 WP_003899407.1.24446 WP_003899407.1.24461 WP_003899407.1.24500 WP_003899407.1.24507 WP_003899407.1.24509 WP_003899407.1.24529 WP_003899407.1.24553 WP_003899407.1.24599 WP_003899407.1.24629 WP_003899407.1.24638 WP_003899407.1.24648 WP_003899407.1.2466 WP_003899407.1.24767 WP_003899407.1.24824 WP_003899407.1.24831 WP_003899407.1.24840 WP_003899407.1.24848 WP_003899407.1.24857 WP_003899407.1.2487 WP_003899407.1.24893 WP_003899407.1.24907 WP_003899407.1.24933 WP_003899407.1.24956 WP_003899407.1.24958 WP_003899407.1.24985 WP_003899407.1.2499 WP_003899407.1.25004 WP_003899407.1.2505 WP_003899407.1.25051 WP_003899407.1.2507 WP_003899407.1.25096 WP_003899407.1.25103 WP_003899407.1.25129 WP_003899407.1.25171 WP_003899407.1.25184 WP_003899407.1.25247 WP_003899407.1.25252 WP_003899407.1.25278 WP_003899407.1.25283 WP_003899407.1.25309 WP_003899407.1.25313 WP_003899407.1.25338 WP_003899407.1.25342 WP_003899407.1.25343 WP_003899407.1.25367 WP_003899407.1.25393 WP_003899407.1.25406 WP_003899407.1.25435 WP_003899407.1.25437 WP_003899407.1.25445 WP_003899407.1.25455 WP_003899407.1.25473 WP_003899407.1.25504 WP_003899407.1.25513 WP_003899407.1.25542 WP_003899407.1.25579 WP_003899407.1.25594 WP_003899407.1.25606 WP_003899407.1.25645 WP_003899407.1.2566 WP_003899407.1.25673 WP_003899407.1.25674 WP_003899407.1.25693 WP_003899407.1.25699 WP_003899407.1.25727 WP_003899407.1.25736 WP_003899407.1.25738 WP_003899407.1.25756 WP_003899407.1.25759 WP_003899407.1.2580 WP_003899407.1.25813 WP_003899407.1.25853 WP_003899407.1.25854 WP_003899407.1.25874 WP_003899407.1.25885 WP_003899407.1.25892 WP_003899407.1.25906 WP_003899407.1.25914 WP_003899407.1.25916 WP_003899407.1.2594 WP_003899407.1.25954 WP_003899407.1.25965 WP_003899407.1.25972 WP_003899407.1.26017 WP_003899407.1.26032 WP_003899407.1.26038 WP_003899407.1.26072 WP_003899407.1.26089 WP_003899407.1.26097 WP_003899407.1.26098 WP_003899407.1.26108 WP_003899407.1.26109 WP_003899407.1.26118 WP_003899407.1.26126 WP_003899407.1.2614 WP_003899407.1.26168 WP_003899407.1.26182 WP_003899407.1.26190 WP_003899407.1.2620 WP_003899407.1.26234 WP_003899407.1.26243 WP_003899407.1.26265 WP_003899407.1.26267 WP_003899407.1.26292 WP_003899407.1.26310 WP_003899407.1.26328 WP_003899407.1.26349 WP_003899407.1.26366 WP_003899407.1.26374 WP_003899407.1.26407 WP_003899407.1.26412 WP_003899407.1.26454 WP_003899407.1.26464 WP_003899407.1.2653 WP_003899407.1.26571 WP_003899407.1.2659 WP_003899407.1.26597 WP_003899407.1.26603 WP_003899407.1.26629 WP_003899407.1.26651 WP_003899407.1.26702 WP_003899407.1.26707 WP_003899407.1.26710 WP_003899407.1.26737 WP_003899407.1.26738 WP_003899407.1.26745 WP_003899407.1.26756 WP_003899407.1.2676 WP_003899407.1.2677 WP_003899407.1.26779 WP_003899407.1.26780 WP_003899407.1.26798 WP_003899407.1.26854 WP_003899407.1.26868 WP_003899407.1.26876 WP_003899407.1.26888 WP_003899407.1.26914 WP_003899407.1.26945 WP_003899407.1.26959 WP_003899407.1.26969 WP_003899407.1.26984 WP_003899407.1.26992 WP_003899407.1.27004 WP_003899407.1.27017 WP_003899407.1.27045 WP_003899407.1.27074 WP_003899407.1.27075 WP_003899407.1.27128 WP_003899407.1.27130 WP_003899407.1.27139 WP_003899407.1.27152 WP_003899407.1.27162 WP_003899407.1.27164 WP_003899407.1.27193 WP_003899407.1.27235 WP_003899407.1.27254 WP_003899407.1.27278 WP_003899407.1.27343 WP_003899407.1.27352 WP_003899407.1.27369 WP_003899407.1.27391 WP_003899407.1.27398 WP_003899407.1.27402 WP_003899407.1.27410 WP_003899407.1.27411 WP_003899407.1.27449 WP_003899407.1.27460 WP_003899407.1.27463 WP_003899407.1.2749 WP_003899407.1.27492 WP_003899407.1.27528 WP_003899407.1.27541 WP_003899407.1.27576 WP_003899407.1.27582 WP_003899407.1.27596 WP_003899407.1.27607 WP_003899407.1.2766 WP_003899407.1.277 WP_003899407.1.27724 WP_003899407.1.27730 WP_003899407.1.27736 WP_003899407.1.27743 WP_003899407.1.27750 WP_003899407.1.27771 WP_003899407.1.27779 WP_003899407.1.27795 WP_003899407.1.27803 WP_003899407.1.27819 WP_003899407.1.27835 WP_003899407.1.27915 WP_003899407.1.27935 WP_003899407.1.27962 WP_003899407.1.28053 WP_003899407.1.28092 WP_003899407.1.28106 WP_003899407.1.28131 WP_003899407.1.28142 WP_003899407.1.28159 WP_003899407.1.2816 WP_003899407.1.28161 WP_003899407.1.28192 WP_003899407.1.28202 WP_003899407.1.28241 WP_003899407.1.28242 WP_003899407.1.28251 WP_003899407.1.28255 WP_003899407.1.28269 WP_003899407.1.28276 WP_003899407.1.28293 WP_003899407.1.28331 WP_003899407.1.28367 WP_003899407.1.28378 WP_003899407.1.28391 WP_003899407.1.2842 WP_003899407.1.28448 WP_003899407.1.2847 WP_003899407.1.28471 WP_003899407.1.28473 WP_003899407.1.28493 WP_003899407.1.28497 WP_003899407.1.28530 WP_003899407.1.28545 WP_003899407.1.28561 WP_003899407.1.28567 WP_003899407.1.28585 WP_003899407.1.286 WP_003899407.1.28610 WP_003899407.1.28617 WP_003899407.1.28634 WP_003899407.1.28642 WP_003899407.1.28671 WP_003899407.1.28682 WP_003899407.1.28698 WP_003899407.1.28703 WP_003899407.1.28739 WP_003899407.1.28758 WP_003899407.1.28781 WP_003899407.1.28787 WP_003899407.1.28827 WP_003899407.1.28839 WP_003899407.1.28847 WP_003899407.1.28850 WP_003899407.1.28851 WP_003899407.1.28865 WP_003899407.1.28897 WP_003899407.1.28914 WP_003899407.1.28935 WP_003899407.1.28936 WP_003899407.1.28939 WP_003899407.1.28943 WP_003899407.1.28952 WP_003899407.1.28975 WP_003899407.1.2899 WP_003899407.1.28993 WP_003899407.1.29000 WP_003899407.1.2901 WP_003899407.1.29028 WP_003899407.1.29033 WP_003899407.1.29058 WP_003899407.1.29078 WP_003899407.1.29102 WP_003899407.1.29115 WP_003899407.1.2916 WP_003899407.1.29217 WP_003899407.1.29223 WP_003899407.1.29234 WP_003899407.1.29264 WP_003899407.1.29275 WP_003899407.1.29306 WP_003899407.1.29339 WP_003899407.1.29348 WP_003899407.1.29364 WP_003899407.1.29367 WP_003899407.1.2938 WP_003899407.1.29399 WP_003899407.1.29426 WP_003899407.1.2944 WP_003899407.1.29449 WP_003899407.1.29450 WP_003899407.1.29452 WP_003899407.1.2949 WP_003899407.1.29510 WP_003899407.1.29515 WP_003899407.1.29525 WP_003899407.1.2953 WP_003899407.1.29559 WP_003899407.1.29587 WP_003899407.1.2959 WP_003899407.1.29592 WP_003899407.1.29599 WP_003899407.1.29611 WP_003899407.1.29632 WP_003899407.1.29649 WP_003899407.1.2965 WP_003899407.1.29659 WP_003899407.1.2969 WP_003899407.1.29696 WP_003899407.1.29698 WP_003899407.1.29718 WP_003899407.1.29742 WP_003899407.1.29745 WP_003899407.1.29747 WP_003899407.1.29769 WP_003899407.1.29825 WP_003899407.1.29830 WP_003899407.1.29847 WP_003899407.1.29861 WP_003899407.1.29869 WP_003899407.1.29883 WP_003899407.1.29890 WP_003899407.1.299 WP_003899407.1.29931 WP_003899407.1.29960 WP_003899407.1.30014 WP_003899407.1.3004 WP_003899407.1.30040 WP_003899407.1.30074 WP_003899407.1.30097 WP_003899407.1.30101 WP_003899407.1.30106 WP_003899407.1.30114 WP_003899407.1.30126 WP_003899407.1.30131 WP_003899407.1.30138 WP_003899407.1.30139 WP_003899407.1.30145 WP_003899407.1.30211 WP_003899407.1.30224 WP_003899407.1.30235 WP_003899407.1.30237 WP_003899407.1.3027 WP_003899407.1.30279 WP_003899407.1.30282 WP_003899407.1.30283 WP_003899407.1.30288 WP_003899407.1.30291 WP_003899407.1.30363 WP_003899407.1.30374 WP_003899407.1.30404 WP_003899407.1.3043 WP_003899407.1.30433 WP_003899407.1.30438 WP_003899407.1.30462 WP_003899407.1.30464 WP_003899407.1.30468 WP_003899407.1.30500 WP_003899407.1.3057 WP_003899407.1.30574 WP_003899407.1.30628 WP_003899407.1.30641 WP_003899407.1.30642 WP_003899407.1.30661 WP_003899407.1.30669 WP_003899407.1.30683 WP_003899407.1.30699 WP_003899407.1.30709 WP_003899407.1.30713 WP_003899407.1.30716 WP_003899407.1.30719 WP_003899407.1.30730 WP_003899407.1.30732 WP_003899407.1.30736 WP_003899407.1.30745 WP_003899407.1.30760 WP_003899407.1.30791 WP_003899407.1.308 WP_003899407.1.30807 WP_003899407.1.30818 WP_003899407.1.30824 WP_003899407.1.30848 WP_003899407.1.30877 WP_003899407.1.30888 WP_003899407.1.30901 WP_003899407.1.30903 WP_003899407.1.30912 WP_003899407.1.30913 WP_003899407.1.30914 WP_003899407.1.30919 WP_003899407.1.30977 WP_003899407.1.3100 WP_003899407.1.31002 WP_003899407.1.3101 WP_003899407.1.31034 WP_003899407.1.31047 WP_003899407.1.31070 WP_003899407.1.31074 WP_003899407.1.31102 WP_003899407.1.31127 WP_003899407.1.31184 WP_003899407.1.31199 WP_003899407.1.31226 WP_003899407.1.31230 WP_003899407.1.31233 WP_003899407.1.31263 WP_003899407.1.31264 WP_003899407.1.31270 WP_003899407.1.31287 WP_003899407.1.31290 WP_003899407.1.31304 WP_003899407.1.31346 WP_003899407.1.31348 WP_003899407.1.31354 WP_003899407.1.31390 WP_003899407.1.31414 WP_003899407.1.31417 WP_003899407.1.31428 WP_003899407.1.3143 WP_003899407.1.31458 WP_003899407.1.31483 WP_003899407.1.3149 WP_003899407.1.31498 WP_003899407.1.31507 WP_003899407.1.31537 WP_003899407.1.31548 WP_003899407.1.31569 WP_003899407.1.31573 WP_003899407.1.316 WP_003899407.1.31629 WP_003899407.1.31666 WP_003899407.1.31693 WP_003899407.1.31703 WP_003899407.1.31744 WP_003899407.1.31745 WP_003899407.1.31770 WP_003899407.1.31776 WP_003899407.1.31783 WP_003899407.1.318 WP_003899407.1.3184 WP_003899407.1.31840 WP_003899407.1.31880 WP_003899407.1.31911 WP_003899407.1.31930 WP_003899407.1.31932 WP_003899407.1.31955 WP_003899407.1.31985 WP_003899407.1.31991 WP_003899407.1.31995 WP_003899407.1.32004 WP_003899407.1.3204 WP_003899407.1.32045 WP_003899407.1.32071 WP_003899407.1.32098 WP_003899407.1.32132 WP_003899407.1.32157 WP_003899407.1.32164 WP_003899407.1.32179 WP_003899407.1.32198 WP_003899407.1.32297 WP_003899407.1.32317 WP_003899407.1.32383 WP_003899407.1.32400 WP_003899407.1.32403 WP_003899407.1.32416 WP_003899407.1.32421 WP_003899407.1.32433 WP_003899407.1.32461 WP_003899407.1.32482 WP_003899407.1.32503 WP_003899407.1.32556 WP_003899407.1.32562 WP_003899407.1.32569 WP_003899407.1.32592 WP_003899407.1.32620 WP_003899407.1.32647 WP_003899407.1.32653 WP_003899407.1.32654 WP_003899407.1.3268 WP_003899407.1.32695 WP_003899407.1.32706 WP_003899407.1.32716 WP_003899407.1.32738 WP_003899407.1.32752 WP_003899407.1.32780 WP_003899407.1.32781 WP_003899407.1.32793 WP_003899407.1.32799 WP_003899407.1.32822 WP_003899407.1.32833 WP_003899407.1.32862 WP_003899407.1.32880 WP_003899407.1.32897 WP_003899407.1.32909 WP_003899407.1.32935 WP_003899407.1.32974 WP_003899407.1.33007 WP_003899407.1.3302 WP_003899407.1.33028 WP_003899407.1.33035 WP_003899407.1.33044 WP_003899407.1.33054 WP_003899407.1.33082 WP_003899407.1.33141 WP_003899407.1.33148 WP_003899407.1.33155 WP_003899407.1.33168 WP_003899407.1.3321 WP_003899407.1.33215 WP_003899407.1.3325 WP_003899407.1.3327 WP_003899407.1.33278 WP_003899407.1.33288 WP_003899407.1.33305 WP_003899407.1.3331 WP_003899407.1.33319 WP_003899407.1.3333 WP_003899407.1.33393 WP_003899407.1.33403 WP_003899407.1.33452 WP_003899407.1.33467 WP_003899407.1.33477 WP_003899407.1.3349 WP_003899407.1.33519 WP_003899407.1.33542 WP_003899407.1.33601 WP_003899407.1.33602 WP_003899407.1.33633 WP_003899407.1.33646 WP_003899407.1.33673 WP_003899407.1.3369 WP_003899407.1.33705 WP_003899407.1.33762 WP_003899407.1.33783 WP_003899407.1.33789 WP_003899407.1.3383 WP_003899407.1.33832 WP_003899407.1.33839 WP_003899407.1.33848 WP_003899407.1.3387 WP_003899407.1.33886 WP_003899407.1.33895 WP_003899407.1.33906 WP_003899407.1.33912 WP_003899407.1.33954 WP_003899407.1.3399 WP_003899407.1.34042 WP_003899407.1.3405 WP_003899407.1.34055 WP_003899407.1.34056 WP_003899407.1.34065 WP_003899407.1.3408 WP_003899407.1.34090 WP_003899407.1.34109 WP_003899407.1.34111 WP_003899407.1.34131 WP_003899407.1.34152 WP_003899407.1.34153 WP_003899407.1.34163 WP_003899407.1.34181 WP_003899407.1.34197 WP_003899407.1.34198 WP_003899407.1.34215 WP_003899407.1.34219 WP_003899407.1.34255 WP_003899407.1.34260 WP_003899407.1.34275 WP_003899407.1.343 WP_003899407.1.34347 WP_003899407.1.34358 WP_003899407.1.34392 WP_003899407.1.344 WP_003899407.1.34428 WP_003899407.1.3443 WP_003899407.1.34435 WP_003899407.1.34446 WP_003899407.1.34499 WP_003899407.1.34505 WP_003899407.1.34516 WP_003899407.1.34529 WP_003899407.1.34551 WP_003899407.1.34563 WP_003899407.1.34576 WP_003899407.1.34581 WP_003899407.1.34588 WP_003899407.1.34596 WP_003899407.1.34599 WP_003899407.1.34639 WP_003899407.1.34673 WP_003899407.1.34724 WP_003899407.1.34740 WP_003899407.1.34755 WP_003899407.1.34777 WP_003899407.1.34783 WP_003899407.1.34841 WP_003899407.1.34908 WP_003899407.1.34919 WP_003899407.1.3492 WP_003899407.1.34933 WP_003899407.1.34945 WP_003899407.1.34946 WP_003899407.1.34954 WP_003899407.1.34960 WP_003899407.1.34961 WP_003899407.1.34963 WP_003899407.1.34965 WP_003899407.1.34968 WP_003899407.1.35023 WP_003899407.1.35069 WP_003899407.1.35072 WP_003899407.1.35078 WP_003899407.1.35100 WP_003899407.1.35146 WP_003899407.1.35156 WP_003899407.1.35160 WP_003899407.1.35162 WP_003899407.1.35173 WP_003899407.1.35176 WP_003899407.1.3520 WP_003899407.1.35213 WP_003899407.1.35221 WP_003899407.1.35246 WP_003899407.1.35278 WP_003899407.1.35301 WP_003899407.1.35311 WP_003899407.1.35312 WP_003899407.1.35317 WP_003899407.1.35319 WP_003899407.1.35347 WP_003899407.1.35363 WP_003899407.1.35382 WP_003899407.1.35385 WP_003899407.1.35396 WP_003899407.1.35397 WP_003899407.1.35426 WP_003899407.1.35439 WP_003899407.1.35455 WP_003899407.1.3548 WP_003899407.1.35484 WP_003899407.1.35492 WP_003899407.1.3553 WP_003899407.1.35553 WP_003899407.1.35555 WP_003899407.1.35561 WP_003899407.1.35602 WP_003899407.1.35610 WP_003899407.1.35635 WP_003899407.1.35657 WP_003899407.1.35680 WP_003899407.1.35687 WP_003899407.1.35689 WP_003899407.1.35707 WP_003899407.1.35732 WP_003899407.1.35754 WP_003899407.1.35767 WP_003899407.1.35770 WP_003899407.1.35771 WP_003899407.1.35780 WP_003899407.1.35805 WP_003899407.1.35811 WP_003899407.1.35821 WP_003899407.1.3584 WP_003899407.1.35848 WP_003899407.1.35864 WP_003899407.1.35874 WP_003899407.1.35876 WP_003899407.1.35897 WP_003899407.1.35899 WP_003899407.1.35923 WP_003899407.1.3593 WP_003899407.1.35954 WP_003899407.1.36005 WP_003899407.1.36014 WP_003899407.1.36023 WP_003899407.1.36051 WP_003899407.1.36053 WP_003899407.1.36075 WP_003899407.1.36089 WP_003899407.1.36097 WP_003899407.1.36098 WP_003899407.1.36116 WP_003899407.1.36145 WP_003899407.1.36156 WP_003899407.1.36205 WP_003899407.1.36228 WP_003899407.1.36246 WP_003899407.1.36252 WP_003899407.1.36260 WP_003899407.1.36270 WP_003899407.1.36271 WP_003899407.1.36303 WP_003899407.1.36309 WP_003899407.1.36315 WP_003899407.1.36319 WP_003899407.1.36321 WP_003899407.1.36326 WP_003899407.1.3634 WP_003899407.1.36356 WP_003899407.1.36357 WP_003899407.1.3636 WP_003899407.1.36385 WP_003899407.1.36399 WP_003899407.1.36436 WP_003899407.1.36465 WP_003899407.1.36469 WP_003899407.1.36473 WP_003899407.1.36485 WP_003899407.1.36508 WP_003899407.1.36540 WP_003899407.1.36561 WP_003899407.1.36571 WP_003899407.1.36573 WP_003899407.1.36578 WP_003899407.1.36585 WP_003899407.1.36597 WP_003899407.1.36614 WP_003899407.1.36657 WP_003899407.1.36674 WP_003899407.1.36720 WP_003899407.1.36727 WP_003899407.1.36733 WP_003899407.1.36785 WP_003899407.1.36810 WP_003899407.1.36844 WP_003899407.1.36851 WP_003899407.1.36862 WP_003899407.1.36893 WP_003899407.1.36901 WP_003899407.1.36921 WP_003899407.1.36935 WP_003899407.1.36941 WP_003899407.1.3695 WP_003899407.1.36951 WP_003899407.1.36968 WP_003899407.1.3700 WP_003899407.1.37004 WP_003899407.1.37012 WP_003899407.1.37071 WP_003899407.1.37088 WP_003899407.1.37131 WP_003899407.1.37157 WP_003899407.1.37175 WP_003899407.1.37188 WP_003899407.1.37213 WP_003899407.1.37229 WP_003899407.1.3724 WP_003899407.1.37277 WP_003899407.1.37305 WP_003899407.1.37330 WP_003899407.1.37389 WP_003899407.1.37400 WP_003899407.1.37440 WP_003899407.1.37459 WP_003899407.1.37468 WP_003899407.1.37475 WP_003899407.1.37484 WP_003899407.1.37601 WP_003899407.1.37612 WP_003899407.1.37632 WP_003899407.1.37643 WP_003899407.1.37655 WP_003899407.1.37660 WP_003899407.1.37674 WP_003899407.1.37700 WP_003899407.1.37701 WP_003899407.1.37709 WP_003899407.1.37711 WP_003899407.1.37721 WP_003899407.1.37722 WP_003899407.1.37747 WP_003899407.1.37765 WP_003899407.1.37772 WP_003899407.1.37804 WP_003899407.1.37809 WP_003899407.1.37859 WP_003899407.1.37877 WP_003899407.1.37912 WP_003899407.1.37913 WP_003899407.1.37943 WP_003899407.1.37950 WP_003899407.1.37973 WP_003899407.1.37975 WP_003899407.1.37983 WP_003899407.1.38 WP_003899407.1.38002 WP_003899407.1.3802 WP_003899407.1.38039 WP_003899407.1.38040 WP_003899407.1.38067 WP_003899407.1.38068 WP_003899407.1.38135 WP_003899407.1.38138 WP_003899407.1.38144 WP_003899407.1.38158 WP_003899407.1.38159 WP_003899407.1.38210 WP_003899407.1.38233 WP_003899407.1.38240 WP_003899407.1.38299 WP_003899407.1.38332 WP_003899407.1.38347 WP_003899407.1.38354 WP_003899407.1.38380 WP_003899407.1.38384 WP_003899407.1.38389 WP_003899407.1.38398 WP_003899407.1.38402 WP_003899407.1.38418 WP_003899407.1.38421 WP_003899407.1.38466 WP_003899407.1.38477 WP_003899407.1.38483 WP_003899407.1.3849 WP_003899407.1.385 WP_003899407.1.38530 WP_003899407.1.38535 WP_003899407.1.38539 WP_003899407.1.38594 WP_003899407.1.38601 WP_003899407.1.38611 WP_003899407.1.38638 WP_003899407.1.38639 WP_003899407.1.38646 WP_003899407.1.38648 WP_003899407.1.38654 WP_003899407.1.38659 WP_003899407.1.38660 WP_003899407.1.38666 WP_003899407.1.38671 WP_003899407.1.38672 WP_003899407.1.38677 WP_003899407.1.38750 WP_003899407.1.38772 WP_003899407.1.38812 WP_003899407.1.38821 WP_003899407.1.38844 WP_003899407.1.38863 WP_003899407.1.38865 WP_003899407.1.38873 WP_003899407.1.3889 WP_003899407.1.38894 WP_003899407.1.38909 WP_003899407.1.38939 WP_003899407.1.38974 WP_003899407.1.38975 WP_003899407.1.38991 WP_003899407.1.39025 WP_003899407.1.39070 WP_003899407.1.39072 WP_003899407.1.39095 WP_003899407.1.39106 WP_003899407.1.39174 WP_003899407.1.39176 WP_003899407.1.39178 WP_003899407.1.39201 WP_003899407.1.39207 WP_003899407.1.39211 WP_003899407.1.39236 WP_003899407.1.39239 WP_003899407.1.39252 WP_003899407.1.39288 WP_003899407.1.39295 WP_003899407.1.39306 WP_003899407.1.39359 WP_003899407.1.39364 WP_003899407.1.39400 WP_003899407.1.39447 WP_003899407.1.3945 WP_003899407.1.39450 WP_003899407.1.39455 WP_003899407.1.3949 WP_003899407.1.39521 WP_003899407.1.39560 WP_003899407.1.39592 WP_003899407.1.39593 WP_003899407.1.396 WP_003899407.1.3960 WP_003899407.1.39616 WP_003899407.1.39654 WP_003899407.1.39657 WP_003899407.1.39661 WP_003899407.1.39674 WP_003899407.1.39678 WP_003899407.1.3968 WP_003899407.1.39694 WP_003899407.1.3971 WP_003899407.1.39718 WP_003899407.1.39728 WP_003899407.1.39739 WP_003899407.1.39748 WP_003899407.1.39751 WP_003899407.1.39759 WP_003899407.1.39801 WP_003899407.1.39804 WP_003899407.1.39848 WP_003899407.1.39877 WP_003899407.1.39925 WP_003899407.1.3994 WP_003899407.1.39959 WP_003899407.1.3996 WP_003899407.1.39960 WP_003899407.1.3997 WP_003899407.1.39980 WP_003899407.1.40000 WP_003899407.1.40028 WP_003899407.1.40029 WP_003899407.1.4003 WP_003899407.1.40094 WP_003899407.1.40096 WP_003899407.1.40150 WP_003899407.1.40156 WP_003899407.1.40174 WP_003899407.1.40186 WP_003899407.1.40276 WP_003899407.1.40277 WP_003899407.1.40323 WP_003899407.1.40336 WP_003899407.1.40353 WP_003899407.1.4036 WP_003899407.1.40402 WP_003899407.1.40413 WP_003899407.1.40440 WP_003899407.1.40446 WP_003899407.1.40451 WP_003899407.1.40455 WP_003899407.1.40523 WP_003899407.1.40543 WP_003899407.1.40641 WP_003899407.1.40646 WP_003899407.1.40651 WP_003899407.1.40653 WP_003899407.1.4067 WP_003899407.1.40705 WP_003899407.1.40723 WP_003899407.1.40731 WP_003899407.1.40735 WP_003899407.1.40795 WP_003899407.1.40799 WP_003899407.1.40852 WP_003899407.1.40876 WP_003899407.1.40881 WP_003899407.1.40922 WP_003899407.1.40948 WP_003899407.1.4095 WP_003899407.1.40956 WP_003899407.1.40964 WP_003899407.1.4097 WP_003899407.1.410 WP_003899407.1.41000 WP_003899407.1.41055 WP_003899407.1.41108 WP_003899407.1.41123 WP_003899407.1.41177 WP_003899407.1.41202 WP_003899407.1.41219 WP_003899407.1.41231 WP_003899407.1.4127 WP_003899407.1.41296 WP_003899407.1.41355 WP_003899407.1.41376 WP_003899407.1.41430 WP_003899407.1.41447 WP_003899407.1.41469 WP_003899407.1.41504 WP_003899407.1.41553 WP_003899407.1.41564 WP_003899407.1.41583 WP_003899407.1.41616 WP_003899407.1.41632 WP_003899407.1.41635 WP_003899407.1.41636 WP_003899407.1.41648 WP_003899407.1.41660 WP_003899407.1.41685 WP_003899407.1.41695 WP_003899407.1.41704 WP_003899407.1.4171 WP_003899407.1.41719 WP_003899407.1.41733 WP_003899407.1.41744 WP_003899407.1.41774 WP_003899407.1.41791 WP_003899407.1.41803 WP_003899407.1.41820 WP_003899407.1.41828 WP_003899407.1.41829 WP_003899407.1.41860 WP_003899407.1.41912 WP_003899407.1.41921 WP_003899407.1.41933 WP_003899407.1.41944 WP_003899407.1.42043 WP_003899407.1.42075 WP_003899407.1.42078 WP_003899407.1.42094 WP_003899407.1.42112 WP_003899407.1.4212 WP_003899407.1.42122 WP_003899407.1.42134 WP_003899407.1.42183 WP_003899407.1.42188 WP_003899407.1.42201 WP_003899407.1.42202 WP_003899407.1.42208 WP_003899407.1.42247 WP_003899407.1.42255 WP_003899407.1.42273 WP_003899407.1.42278 WP_003899407.1.42304 WP_003899407.1.42309 WP_003899407.1.42370 WP_003899407.1.42385 WP_003899407.1.42400 WP_003899407.1.42409 WP_003899407.1.42414 WP_003899407.1.42417 WP_003899407.1.42430 WP_003899407.1.42461 WP_003899407.1.42465 WP_003899407.1.42467 WP_003899407.1.42473 WP_003899407.1.42474 WP_003899407.1.4248 WP_003899407.1.42494 WP_003899407.1.42519 WP_003899407.1.42524 WP_003899407.1.42534 WP_003899407.1.4255 WP_003899407.1.42562 WP_003899407.1.42568 WP_003899407.1.42570 WP_003899407.1.42618 WP_003899407.1.42660 WP_003899407.1.42695 WP_003899407.1.42704 WP_003899407.1.42705 WP_003899407.1.42722 WP_003899407.1.42777 WP_003899407.1.42782 WP_003899407.1.42835 WP_003899407.1.42839 WP_003899407.1.42842 WP_003899407.1.42905 WP_003899407.1.42916 WP_003899407.1.42930 WP_003899407.1.42971 WP_003899407.1.43005 WP_003899407.1.43009 WP_003899407.1.43053 WP_003899407.1.43082 WP_003899407.1.43087 WP_003899407.1.43098 WP_003899407.1.43208 WP_003899407.1.43236 WP_003899407.1.43246 WP_003899407.1.43255 WP_003899407.1.43266 WP_003899407.1.43269 WP_003899407.1.43273 WP_003899407.1.43296 WP_003899407.1.43306 WP_003899407.1.4335 WP_003899407.1.43368 WP_003899407.1.43395 WP_003899407.1.43457 WP_003899407.1.43462 WP_003899407.1.43475 WP_003899407.1.43478 WP_003899407.1.43484 WP_003899407.1.43557 WP_003899407.1.43578 WP_003899407.1.43588 WP_003899407.1.43643 WP_003899407.1.43664 WP_003899407.1.43684 WP_003899407.1.43686 WP_003899407.1.43706 WP_003899407.1.43716 WP_003899407.1.4377 WP_003899407.1.43781 WP_003899407.1.43794 WP_003899407.1.43815 WP_003899407.1.43846 WP_003899407.1.43861 WP_003899407.1.43863 WP_003899407.1.43866 WP_003899407.1.43872 WP_003899407.1.43885 WP_003899407.1.43897 WP_003899407.1.4390 WP_003899407.1.43902 WP_003899407.1.43921 WP_003899407.1.43936 WP_003899407.1.43937 WP_003899407.1.43960 WP_003899407.1.43965 WP_003899407.1.4399 WP_003899407.1.43993 WP_003899407.1.43996 WP_003899407.1.44 WP_003899407.1.44001 WP_003899407.1.44008 WP_003899407.1.44016 WP_003899407.1.44033 WP_003899407.1.44037 WP_003899407.1.44041 WP_003899407.1.44070 WP_003899407.1.44071 WP_003899407.1.44076 WP_003899407.1.44104 WP_003899407.1.44111 WP_003899407.1.44124 WP_003899407.1.44169 WP_003899407.1.44219 WP_003899407.1.44237 WP_003899407.1.44277 WP_003899407.1.44279 WP_003899407.1.44336 WP_003899407.1.44355 WP_003899407.1.44358 WP_003899407.1.4438 WP_003899407.1.44390 WP_003899407.1.44392 WP_003899407.1.4441 WP_003899407.1.44415 WP_003899407.1.44464 WP_003899407.1.44466 WP_003899407.1.44489 WP_003899407.1.44492 WP_003899407.1.44494 WP_003899407.1.44500 WP_003899407.1.44519 WP_003899407.1.44526 WP_003899407.1.44532 WP_003899407.1.44534 WP_003899407.1.44562 WP_003899407.1.44589 WP_003899407.1.44597 WP_003899407.1.44600 WP_003899407.1.44602 WP_003899407.1.44615 WP_003899407.1.4464 WP_003899407.1.44651 WP_003899407.1.44659 WP_003899407.1.44665 WP_003899407.1.44694 WP_003899407.1.44700 WP_003899407.1.44713 WP_003899407.1.44735 WP_003899407.1.44740 WP_003899407.1.44757 WP_003899407.1.4476 WP_003899407.1.44761 WP_003899407.1.44767 WP_003899407.1.44776 WP_003899407.1.44779 WP_003899407.1.44786 WP_003899407.1.44808 WP_003899407.1.44864 WP_003899407.1.44901 WP_003899407.1.44908 WP_003899407.1.44913 WP_003899407.1.4492 WP_003899407.1.44939 WP_003899407.1.44979 WP_003899407.1.44981 WP_003899407.1.45002 WP_003899407.1.45011 WP_003899407.1.4504 WP_003899407.1.45062 WP_003899407.1.45066 WP_003899407.1.45081 WP_003899407.1.45113 WP_003899407.1.45129 WP_003899407.1.45135 WP_003899407.1.45147 WP_003899407.1.45168 WP_003899407.1.4517 WP_003899407.1.45181 WP_003899407.1.45185 WP_003899407.1.45192 WP_003899407.1.45200 WP_003899407.1.45205 WP_003899407.1.45211 WP_003899407.1.45249 WP_003899407.1.4526 WP_003899407.1.45286 WP_003899407.1.45326 WP_003899407.1.45347 WP_003899407.1.45374 WP_003899407.1.45390 WP_003899407.1.454 WP_003899407.1.45407 WP_003899407.1.45451 WP_003899407.1.45453 WP_003899407.1.45460 WP_003899407.1.45463 WP_003899407.1.45470 WP_003899407.1.45474 WP_003899407.1.45491 WP_003899407.1.45510 WP_003899407.1.45563 WP_003899407.1.45584 WP_003899407.1.45590 WP_003899407.1.45619 WP_003899407.1.45626 WP_003899407.1.45631 WP_003899407.1.45666 WP_003899407.1.45697 WP_003899407.1.4571 WP_003899407.1.45731 WP_003899407.1.45743 WP_003899407.1.45765 WP_003899407.1.45776 WP_003899407.1.45783 WP_003899407.1.45805 WP_003899407.1.45815 WP_003899407.1.45849 WP_003899407.1.45867 WP_003899407.1.45884 WP_003899407.1.4590 WP_003899407.1.45923 WP_003899407.1.45926 WP_003899407.1.45963 WP_003899407.1.45989 WP_003899407.1.45992 WP_003899407.1.46025 WP_003899407.1.46083 WP_003899407.1.46090 WP_003899407.1.46092 WP_003899407.1.46100 WP_003899407.1.46101 WP_003899407.1.46103 WP_003899407.1.46107 WP_003899407.1.46127 WP_003899407.1.46128 WP_003899407.1.46129 WP_003899407.1.46141 WP_003899407.1.46150 WP_003899407.1.46201 WP_003899407.1.46226 WP_003899407.1.4624 WP_003899407.1.46253 WP_003899407.1.46268 WP_003899407.1.46285 WP_003899407.1.46300 WP_003899407.1.46313 WP_003899407.1.46336 WP_003899407.1.46365 WP_003899407.1.46370 WP_003899407.1.46381 WP_003899407.1.46402 WP_003899407.1.46411 WP_003899407.1.4644 WP_003899407.1.46442 WP_003899407.1.46453 WP_003899407.1.46463 WP_003899407.1.46478 WP_003899407.1.46492 WP_003899407.1.46521 WP_003899407.1.4653 WP_003899407.1.46532 WP_003899407.1.46539 WP_003899407.1.46568 WP_003899407.1.46585 WP_003899407.1.46609 WP_003899407.1.46613 WP_003899407.1.46625 WP_003899407.1.46642 WP_003899407.1.46647 WP_003899407.1.46674 WP_003899407.1.46724 WP_003899407.1.46758 WP_003899407.1.46773 WP_003899407.1.46777 WP_003899407.1.46786 WP_003899407.1.46792 WP_003899407.1.46847 WP_003899407.1.46851 WP_003899407.1.4687 WP_003899407.1.46897 WP_003899407.1.46936 WP_003899407.1.46980 WP_003899407.1.47011 WP_003899407.1.47012 WP_003899407.1.47066 WP_003899407.1.47077 WP_003899407.1.47083 WP_003899407.1.47106 WP_003899407.1.47142 WP_003899407.1.47147 WP_003899407.1.47166 WP_003899407.1.47178 WP_003899407.1.47179 WP_003899407.1.47194 WP_003899407.1.47207 WP_003899407.1.47210 WP_003899407.1.47261 WP_003899407.1.47262 WP_003899407.1.47402 WP_003899407.1.47423 WP_003899407.1.47467 WP_003899407.1.47502 WP_003899407.1.4751 WP_003899407.1.47511 WP_003899407.1.47537 WP_003899407.1.47540 WP_003899407.1.47568 WP_003899407.1.47572 WP_003899407.1.47588 WP_003899407.1.47636 WP_003899407.1.4764 WP_003899407.1.47653 WP_003899407.1.47679 WP_003899407.1.47681 WP_003899407.1.47690 WP_003899407.1.4771 WP_003899407.1.47717 WP_003899407.1.47743 WP_003899407.1.47754 WP_003899407.1.47773 WP_003899407.1.47776 WP_003899407.1.47780 WP_003899407.1.47805 WP_003899407.1.47832 WP_003899407.1.47847 WP_003899407.1.47858 WP_003899407.1.47861 WP_003899407.1.47868 WP_003899407.1.47893 WP_003899407.1.47899 WP_003899407.1.479 WP_003899407.1.47912 WP_003899407.1.47913 WP_003899407.1.47926 WP_003899407.1.4794 WP_003899407.1.47943 WP_003899407.1.47944 WP_003899407.1.47959 WP_003899407.1.47974 WP_003899407.1.47993 WP_003899407.1.48004 WP_003899407.1.48039 WP_003899407.1.48050 WP_003899407.1.48084 WP_003899407.1.48097 WP_003899407.1.48101 WP_003899407.1.48109 WP_003899407.1.4813 WP_003899407.1.48130 WP_003899407.1.48135 WP_003899407.1.48143 WP_003899407.1.48152 WP_003899407.1.48155 WP_003899407.1.48170 WP_003899407.1.48173 WP_003899407.1.48177 WP_003899407.1.48185 WP_003899407.1.48219 WP_003899407.1.4823 WP_003899407.1.48240 WP_003899407.1.48256 WP_003899407.1.48264 WP_003899407.1.48287 WP_003899407.1.48330 WP_003899407.1.48333 WP_003899407.1.48348 WP_003899407.1.48354 WP_003899407.1.48372 WP_003899407.1.48383 WP_003899407.1.48388 WP_003899407.1.48419 WP_003899407.1.48423 WP_003899407.1.48443 WP_003899407.1.48450 WP_003899407.1.48462 WP_003899407.1.48543 WP_003899407.1.48550 WP_003899407.1.48605 WP_003899407.1.48618 WP_003899407.1.4863 WP_003899407.1.48648 WP_003899407.1.48658 WP_003899407.1.48666 WP_003899407.1.48687 WP_003899407.1.48779 WP_003899407.1.4878 WP_003899407.1.48798 WP_003899407.1.48802 WP_003899407.1.48826 WP_003899407.1.48831 WP_003899407.1.48843 WP_003899407.1.48857 WP_003899407.1.4890 WP_003899407.1.48946 WP_003899407.1.48979 WP_003899407.1.49017 WP_003899407.1.49048 WP_003899407.1.49059 WP_003899407.1.4906 WP_003899407.1.4907 WP_003899407.1.49103 WP_003899407.1.49110 WP_003899407.1.49111 WP_003899407.1.49112 WP_003899407.1.4919 WP_003899407.1.49251 WP_003899407.1.49254 WP_003899407.1.49263 WP_003899407.1.49291 WP_003899407.1.49296 WP_003899407.1.49335 WP_003899407.1.49337 WP_003899407.1.49419 WP_003899407.1.49426 WP_003899407.1.49437 WP_003899407.1.49439 WP_003899407.1.49474 WP_003899407.1.49506 WP_003899407.1.49516 WP_003899407.1.49523 WP_003899407.1.49526 WP_003899407.1.49532 WP_003899407.1.49588 WP_003899407.1.4959 WP_003899407.1.49687 WP_003899407.1.49699 WP_003899407.1.4971 WP_003899407.1.4972 WP_003899407.1.49736 WP_003899407.1.49746 WP_003899407.1.49764 WP_003899407.1.49773 WP_003899407.1.49796 WP_003899407.1.49814 WP_003899407.1.49815 WP_003899407.1.49816 WP_003899407.1.49839 WP_003899407.1.49857 WP_003899407.1.49878 WP_003899407.1.49880 WP_003899407.1.49944 WP_003899407.1.4999 WP_003899407.1.49990 WP_003899407.1.50068 WP_003899407.1.50077 WP_003899407.1.5008 WP_003899407.1.50081 WP_003899407.1.50122 WP_003899407.1.50126 WP_003899407.1.50149 WP_003899407.1.50162 WP_003899407.1.5018 WP_003899407.1.50194 WP_003899407.1.50218 WP_003899407.1.50235 WP_003899407.1.50249 WP_003899407.1.50265 WP_003899407.1.50271 WP_003899407.1.50324 WP_003899407.1.50347 WP_003899407.1.50372 WP_003899407.1.50398 WP_003899407.1.50407 WP_003899407.1.50444 WP_003899407.1.50466 WP_003899407.1.50472 WP_003899407.1.5048 WP_003899407.1.50498 WP_003899407.1.5050 WP_003899407.1.50540 WP_003899407.1.50554 WP_003899407.1.50557 WP_003899407.1.50601 WP_003899407.1.50610 WP_003899407.1.50632 WP_003899407.1.50633 WP_003899407.1.50642 WP_003899407.1.50655 WP_003899407.1.50659 WP_003899407.1.50683 WP_003899407.1.50689 WP_003899407.1.50692 WP_003899407.1.50714 WP_003899407.1.50729 WP_003899407.1.50756 WP_003899407.1.50784 WP_003899407.1.50794 WP_003899407.1.50841 WP_003899407.1.50860 WP_003899407.1.50868 WP_003899407.1.50877 WP_003899407.1.5096 WP_003899407.1.50981 WP_003899407.1.50987 WP_003899407.1.51003 WP_003899407.1.51009 WP_003899407.1.51037 WP_003899407.1.51074 WP_003899407.1.51082 WP_003899407.1.51101 WP_003899407.1.51116 WP_003899407.1.51149 WP_003899407.1.51156 WP_003899407.1.51157 WP_003899407.1.51213 WP_003899407.1.51232 WP_003899407.1.51239 WP_003899407.1.51247 WP_003899407.1.51266 WP_003899407.1.51279 WP_003899407.1.51291 WP_003899407.1.51294 WP_003899407.1.51301 WP_003899407.1.51329 WP_003899407.1.51391 WP_003899407.1.51422 WP_003899407.1.51445 WP_003899407.1.51455 WP_003899407.1.51466 WP_003899407.1.51468 WP_003899407.1.51478 WP_003899407.1.51497 WP_003899407.1.51520 WP_003899407.1.51593 WP_003899407.1.51628 WP_003899407.1.5164 WP_003899407.1.51647 WP_003899407.1.51660 WP_003899407.1.51696 WP_003899407.1.51721 WP_003899407.1.51788 WP_003899407.1.51795 WP_003899407.1.51801 WP_003899407.1.51817 WP_003899407.1.51819 WP_003899407.1.51854 WP_003899407.1.51923 WP_003899407.1.51942 WP_003899407.1.51948 WP_003899407.1.51963 WP_003899407.1.51969 WP_003899407.1.52000 WP_003899407.1.52001 WP_003899407.1.52003 WP_003899407.1.52006 WP_003899407.1.52036 WP_003899407.1.52038 WP_003899407.1.52046 WP_003899407.1.52059 WP_003899407.1.52069 WP_003899407.1.52082 WP_003899407.1.52102 WP_003899407.1.52106 WP_003899407.1.52166 WP_003899407.1.52168 WP_003899407.1.52173 WP_003899407.1.52178 WP_003899407.1.52206 WP_003899407.1.52216 WP_003899407.1.52238 WP_003899407.1.52241 WP_003899407.1.52280 WP_003899407.1.52314 WP_003899407.1.52385 WP_003899407.1.52390 WP_003899407.1.524 WP_003899407.1.52460 WP_003899407.1.52485 WP_003899407.1.52486 WP_003899407.1.52495 WP_003899407.1.52504 WP_003899407.1.52522 WP_003899407.1.52531 WP_003899407.1.52533 WP_003899407.1.52545 WP_003899407.1.52553 WP_003899407.1.52563 WP_003899407.1.52564 WP_003899407.1.52574 WP_003899407.1.52641 WP_003899407.1.52673 WP_003899407.1.52674 WP_003899407.1.52708 WP_003899407.1.52713 WP_003899407.1.52761 WP_003899407.1.52778 WP_003899407.1.52791 WP_003899407.1.52797 WP_003899407.1.52818 WP_003899407.1.52872 WP_003899407.1.52873 WP_003899407.1.52891 WP_003899407.1.52892 WP_003899407.1.52909 WP_003899407.1.52970 WP_003899407.1.52998 WP_003899407.1.53053 WP_003899407.1.53056 WP_003899407.1.5306 WP_003899407.1.53088 WP_003899407.1.5309 WP_003899407.1.531 WP_003899407.1.53117 WP_003899407.1.53118 WP_003899407.1.53142 WP_003899407.1.53143 WP_003899407.1.53157 WP_003899407.1.53167 WP_003899407.1.53200 WP_003899407.1.53204 WP_003899407.1.53213 WP_003899407.1.53217 WP_003899407.1.53226 WP_003899407.1.53229 WP_003899407.1.53230 WP_003899407.1.53237 WP_003899407.1.53254 WP_003899407.1.53257 WP_003899407.1.5327 WP_003899407.1.53276 WP_003899407.1.53278 WP_003899407.1.533 WP_003899407.1.53302 WP_003899407.1.53306 WP_003899407.1.5334 WP_003899407.1.5335 WP_003899407.1.53353 WP_003899407.1.53381 WP_003899407.1.53413 WP_003899407.1.53458 WP_003899407.1.53460 WP_003899407.1.53480 WP_003899407.1.53517 WP_003899407.1.53522 WP_003899407.1.53525 WP_003899407.1.53526 WP_003899407.1.53553 WP_003899407.1.53606 WP_003899407.1.53609 WP_003899407.1.53628 WP_003899407.1.53643 WP_003899407.1.53667 WP_003899407.1.53679 WP_003899407.1.53715 WP_003899407.1.53730 WP_003899407.1.53742 WP_003899407.1.53743 WP_003899407.1.53754 WP_003899407.1.53775 WP_003899407.1.53787 WP_003899407.1.53803 WP_003899407.1.53818 WP_003899407.1.53822 WP_003899407.1.53853 WP_003899407.1.53865 WP_003899407.1.53888 WP_003899407.1.53900 WP_003899407.1.53912 WP_003899407.1.53914 WP_003899407.1.53952 WP_003899407.1.53973 WP_003899407.1.5398 WP_003899407.1.5408 WP_003899407.1.54089 WP_003899407.1.54093 WP_003899407.1.54099 WP_003899407.1.54112 WP_003899407.1.54125 WP_003899407.1.54141 WP_003899407.1.54162 WP_003899407.1.54179 WP_003899407.1.54206 WP_003899407.1.54218 WP_003899407.1.54225 WP_003899407.1.54227 WP_003899407.1.54232 WP_003899407.1.54241 WP_003899407.1.54245 WP_003899407.1.54247 WP_003899407.1.54260 WP_003899407.1.54275 WP_003899407.1.54280 WP_003899407.1.5429 WP_003899407.1.54294 WP_003899407.1.54314 WP_003899407.1.54347 WP_003899407.1.54351 WP_003899407.1.54370 WP_003899407.1.54428 WP_003899407.1.54449 WP_003899407.1.54494 WP_003899407.1.54502 WP_003899407.1.54514 WP_003899407.1.54519 WP_003899407.1.5452 WP_003899407.1.54531 WP_003899407.1.54537 WP_003899407.1.54553 WP_003899407.1.54555 WP_003899407.1.54575 WP_003899407.1.54633 WP_003899407.1.54686 WP_003899407.1.54687 WP_003899407.1.54705 WP_003899407.1.54730 WP_003899407.1.54732 WP_003899407.1.5475 WP_003899407.1.54797 WP_003899407.1.54807 WP_003899407.1.54836 WP_003899407.1.54838 WP_003899407.1.54860 WP_003899407.1.54888 WP_003899407.1.54897 WP_003899407.1.54905 WP_003899407.1.54909 WP_003899407.1.54937 WP_003899407.1.54939 WP_003899407.1.54944 WP_003899407.1.54945 WP_003899407.1.54953 WP_003899407.1.54964 WP_003899407.1.55015 WP_003899407.1.55022 WP_003899407.1.55023 WP_003899407.1.55051 WP_003899407.1.55072 WP_003899407.1.55088 WP_003899407.1.55106 WP_003899407.1.55126 WP_003899407.1.55128 WP_003899407.1.55140 WP_003899407.1.55150 WP_003899407.1.55210 WP_003899407.1.55227 WP_003899407.1.55248 WP_003899407.1.55257 WP_003899407.1.55258 WP_003899407.1.55267 WP_003899407.1.55279 WP_003899407.1.55307 WP_003899407.1.55326 WP_003899407.1.55328 WP_003899407.1.5533 WP_003899407.1.55345 WP_003899407.1.55396 WP_003899407.1.55398 WP_003899407.1.55441 WP_003899407.1.55459 WP_003899407.1.55501 WP_003899407.1.55504 WP_003899407.1.55578 WP_003899407.1.55626 WP_003899407.1.55641 WP_003899407.1.5569 WP_003899407.1.55723 WP_003899407.1.55735 WP_003899407.1.5574 WP_003899407.1.55772 WP_003899407.1.55802 WP_003899407.1.55807 WP_003899407.1.55819 WP_003899407.1.55821 WP_003899407.1.5583 WP_003899407.1.55849 WP_003899407.1.55856 WP_003899407.1.55860 WP_003899407.1.55882 WP_003899407.1.55883 WP_003899407.1.55894 WP_003899407.1.55902 WP_003899407.1.55908 WP_003899407.1.55909 WP_003899407.1.5591 WP_003899407.1.55961 WP_003899407.1.55977 WP_003899407.1.55983 WP_003899407.1.56028 WP_003899407.1.56057 WP_003899407.1.56060 WP_003899407.1.56107 WP_003899407.1.56132 WP_003899407.1.56163 WP_003899407.1.56167 WP_003899407.1.56178 WP_003899407.1.56287 WP_003899407.1.56292 WP_003899407.1.56327 WP_003899407.1.56341 WP_003899407.1.56359 WP_003899407.1.56365 WP_003899407.1.56394 WP_003899407.1.56443 WP_003899407.1.56473 WP_003899407.1.56478 WP_003899407.1.56500 WP_003899407.1.56517 WP_003899407.1.56534 WP_003899407.1.5656 WP_003899407.1.56577 WP_003899407.1.56593 WP_003899407.1.56625 WP_003899407.1.56637 WP_003899407.1.56670 WP_003899407.1.56697 WP_003899407.1.567 WP_003899407.1.56701 WP_003899407.1.56709 WP_003899407.1.56729 WP_003899407.1.56743 WP_003899407.1.56755 WP_003899407.1.56764 WP_003899407.1.56769 WP_003899407.1.56770 WP_003899407.1.56795 WP_003899407.1.5681 WP_003899407.1.56827 WP_003899407.1.56839 WP_003899407.1.56863 WP_003899407.1.56868 WP_003899407.1.56869 WP_003899407.1.56915 WP_003899407.1.56926 WP_003899407.1.56961 WP_003899407.1.56971 WP_003899407.1.56972 WP_003899407.1.57023 WP_003899407.1.57035 WP_003899407.1.57077 WP_003899407.1.57087 WP_003899407.1.57094 WP_003899407.1.57134 WP_003899407.1.57151 WP_003899407.1.57169 WP_003899407.1.57208 WP_003899407.1.57212 WP_003899407.1.57230 WP_003899407.1.5724 WP_003899407.1.5725 WP_003899407.1.5727 WP_003899407.1.57273 WP_003899407.1.573 WP_003899407.1.57314 WP_003899407.1.57326 WP_003899407.1.57328 WP_003899407.1.57331 WP_003899407.1.57340 WP_003899407.1.57351 WP_003899407.1.57352 WP_003899407.1.57380 WP_003899407.1.57430 WP_003899407.1.5744 WP_003899407.1.57440 WP_003899407.1.5745 WP_003899407.1.57461 WP_003899407.1.57469 WP_003899407.1.57489 WP_003899407.1.575 WP_003899407.1.57509 WP_003899407.1.57519 WP_003899407.1.57525 WP_003899407.1.57551 WP_003899407.1.5758 WP_003899407.1.57596 WP_003899407.1.57604 WP_003899407.1.57616 WP_003899407.1.57617 WP_003899407.1.57619 WP_003899407.1.57627 WP_003899407.1.57642 WP_003899407.1.57658 WP_003899407.1.57667 WP_003899407.1.57675 WP_003899407.1.57689 WP_003899407.1.57708 WP_003899407.1.57794 WP_003899407.1.57821 WP_003899407.1.57825 WP_003899407.1.57843 WP_003899407.1.57906 WP_003899407.1.57924 WP_003899407.1.57926 WP_003899407.1.57930 WP_003899407.1.57957 WP_003899407.1.57960 WP_003899407.1.57964 WP_003899407.1.57991 WP_003899407.1.58000 WP_003899407.1.58086 WP_003899407.1.58101 WP_003899407.1.58103 WP_003899407.1.58108 WP_003899407.1.5811 WP_003899407.1.58121 WP_003899407.1.58145 WP_003899407.1.58164 WP_003899407.1.58174 WP_003899407.1.582 WP_003899407.1.58202 WP_003899407.1.58209 WP_003899407.1.58215 WP_003899407.1.5824 WP_003899407.1.58250 WP_003899407.1.58259 WP_003899407.1.58283 WP_003899407.1.58288 WP_003899407.1.5830 WP_003899407.1.58303 WP_003899407.1.58311 WP_003899407.1.58330 WP_003899407.1.58359 WP_003899407.1.58386 WP_003899407.1.58393 WP_003899407.1.58431 WP_003899407.1.5844 WP_003899407.1.58488 WP_003899407.1.58518 WP_003899407.1.58534 WP_003899407.1.58559 WP_003899407.1.58567 WP_003899407.1.58573 WP_003899407.1.58602 WP_003899407.1.58612 WP_003899407.1.58619 WP_003899407.1.58630 WP_003899407.1.5865 WP_003899407.1.58671 WP_003899407.1.58690 WP_003899407.1.58702 WP_003899407.1.58743 WP_003899407.1.58754 WP_003899407.1.5879 WP_003899407.1.5881 WP_003899407.1.58824 WP_003899407.1.58848 WP_003899407.1.58857 WP_003899407.1.58891 WP_003899407.1.58892 WP_003899407.1.5890 WP_003899407.1.58904 WP_003899407.1.58921 WP_003899407.1.58930 WP_003899407.1.58939 WP_003899407.1.58941 WP_003899407.1.58953 WP_003899407.1.58961 WP_003899407.1.5898 WP_003899407.1.59025 WP_003899407.1.59029 WP_003899407.1.59037 WP_003899407.1.59044 WP_003899407.1.59085 WP_003899407.1.59088 WP_003899407.1.59112 WP_003899407.1.59130 WP_003899407.1.5914 WP_003899407.1.59147 WP_003899407.1.59166 WP_003899407.1.59205 WP_003899407.1.59209 WP_003899407.1.59237 WP_003899407.1.59240 WP_003899407.1.59253 WP_003899407.1.59254 WP_003899407.1.59262 WP_003899407.1.59270 WP_003899407.1.5928 WP_003899407.1.59304 WP_003899407.1.59305 WP_003899407.1.59309 WP_003899407.1.59316 WP_003899407.1.59326 WP_003899407.1.59328 WP_003899407.1.59333 WP_003899407.1.59338 WP_003899407.1.59388 WP_003899407.1.59428 WP_003899407.1.59487 WP_003899407.1.59537 WP_003899407.1.59561 WP_003899407.1.59677 WP_003899407.1.59722 WP_003899407.1.59727 WP_003899407.1.59732 WP_003899407.1.59738 WP_003899407.1.59750 WP_003899407.1.59757 WP_003899407.1.59761 WP_003899407.1.59808 WP_003899407.1.59850 WP_003899407.1.59856 WP_003899407.1.59860 WP_003899407.1.59861 WP_003899407.1.5987 WP_003899407.1.59878 WP_003899407.1.59888 WP_003899407.1.59952 WP_003899407.1.5996 WP_003899407.1.59961 WP_003899407.1.59974 WP_003899407.1.6000 WP_003899407.1.60007 WP_003899407.1.60016 WP_003899407.1.6003 WP_003899407.1.60047 WP_003899407.1.6007 WP_003899407.1.60091 WP_003899407.1.60121 WP_003899407.1.60125 WP_003899407.1.60135 WP_003899407.1.60139 WP_003899407.1.60152 WP_003899407.1.60171 WP_003899407.1.60197 WP_003899407.1.6020 WP_003899407.1.60205 WP_003899407.1.60207 WP_003899407.1.60215 WP_003899407.1.60217 WP_003899407.1.60267 WP_003899407.1.60288 WP_003899407.1.60291 WP_003899407.1.60301 WP_003899407.1.60305 WP_003899407.1.60312 WP_003899407.1.60313 WP_003899407.1.60314 WP_003899407.1.60367 WP_003899407.1.60376 WP_003899407.1.60403 WP_003899407.1.60413 WP_003899407.1.60421 WP_003899407.1.60451 WP_003899407.1.60460 WP_003899407.1.60479 WP_003899407.1.60487 WP_003899407.1.60512 WP_003899407.1.60573 WP_003899407.1.60583 WP_003899407.1.60632 WP_003899407.1.60657 WP_003899407.1.60687 WP_003899407.1.60689 WP_003899407.1.60727 WP_003899407.1.60738 WP_003899407.1.60763 WP_003899407.1.6077 WP_003899407.1.60791 WP_003899407.1.60834 WP_003899407.1.60870 WP_003899407.1.60878 WP_003899407.1.60879 WP_003899407.1.60913 WP_003899407.1.60978 WP_003899407.1.61000 WP_003899407.1.61001 WP_003899407.1.61012 WP_003899407.1.61014 WP_003899407.1.61015 WP_003899407.1.61037 WP_003899407.1.61052 WP_003899407.1.61065 WP_003899407.1.61100 WP_003899407.1.61101 WP_003899407.1.61138 WP_003899407.1.61142 WP_003899407.1.61198 WP_003899407.1.612 WP_003899407.1.61234 WP_003899407.1.61256 WP_003899407.1.61281 WP_003899407.1.61314 WP_003899407.1.61321 WP_003899407.1.61326 WP_003899407.1.61328 WP_003899407.1.61368 WP_003899407.1.61391 WP_003899407.1.61406 WP_003899407.1.61409 WP_003899407.1.61420 WP_003899407.1.61422 WP_003899407.1.61425 WP_003899407.1.61428 WP_003899407.1.61469 WP_003899407.1.61494 WP_003899407.1.61522 WP_003899407.1.61552 WP_003899407.1.61557 WP_003899407.1.61567 WP_003899407.1.61571 WP_003899407.1.61573 WP_003899407.1.61584 WP_003899407.1.61586 WP_003899407.1.6159 WP_003899407.1.61592 WP_003899407.1.6160 WP_003899407.1.61614 WP_003899407.1.6163 WP_003899407.1.61655 WP_003899407.1.61665 WP_003899407.1.61669 WP_003899407.1.61682 WP_003899407.1.61692 WP_003899407.1.61719 WP_003899407.1.61728 WP_003899407.1.61750 WP_003899407.1.61754 WP_003899407.1.61757 WP_003899407.1.61778 WP_003899407.1.6179 WP_003899407.1.61793 WP_003899407.1.61816 WP_003899407.1.61842 WP_003899407.1.61850 WP_003899407.1.61862 WP_003899407.1.61865 WP_003899407.1.61868 WP_003899407.1.61911 WP_003899407.1.61925 WP_003899407.1.61941 WP_003899407.1.61953 WP_003899407.1.61979 WP_003899407.1.61986 WP_003899407.1.61987 WP_003899407.1.61998 WP_003899407.1.62021 WP_003899407.1.62087 WP_003899407.1.62089 WP_003899407.1.62101 WP_003899407.1.62104 WP_003899407.1.6211 WP_003899407.1.62132 WP_003899407.1.62162 WP_003899407.1.62225 WP_003899407.1.62230 WP_003899407.1.62238 WP_003899407.1.62249 WP_003899407.1.62270 WP_003899407.1.62281 WP_003899407.1.62307 WP_003899407.1.6231 WP_003899407.1.62359 WP_003899407.1.62360 WP_003899407.1.62371 WP_003899407.1.62379 WP_003899407.1.62395 WP_003899407.1.62408 WP_003899407.1.62449 WP_003899407.1.62468 WP_003899407.1.6248 WP_003899407.1.62508 WP_003899407.1.62565 WP_003899407.1.62594 WP_003899407.1.62606 WP_003899407.1.62616 WP_003899407.1.62666 WP_003899407.1.62687 WP_003899407.1.62715 WP_003899407.1.62730 WP_003899407.1.62738 WP_003899407.1.62761 WP_003899407.1.62766 WP_003899407.1.62786 WP_003899407.1.62813 WP_003899407.1.62839 WP_003899407.1.62841 WP_003899407.1.62909 WP_003899407.1.62936 WP_003899407.1.6294 WP_003899407.1.6295 WP_003899407.1.62962 WP_003899407.1.63007 WP_003899407.1.63019 WP_003899407.1.63032 WP_003899407.1.63037 WP_003899407.1.63064 WP_003899407.1.63066 WP_003899407.1.63072 WP_003899407.1.6308 WP_003899407.1.63081 WP_003899407.1.63096 WP_003899407.1.63106 WP_003899407.1.6314 WP_003899407.1.63144 WP_003899407.1.63154 WP_003899407.1.63160 WP_003899407.1.63161 WP_003899407.1.63166 WP_003899407.1.63175 WP_003899407.1.63194 WP_003899407.1.6322 WP_003899407.1.63222 WP_003899407.1.63247 WP_003899407.1.6328 WP_003899407.1.63291 WP_003899407.1.63312 WP_003899407.1.63317 WP_003899407.1.63331 WP_003899407.1.63373 WP_003899407.1.63384 WP_003899407.1.63403 WP_003899407.1.63424 WP_003899407.1.63428 WP_003899407.1.6345 WP_003899407.1.63464 WP_003899407.1.63483 WP_003899407.1.63502 WP_003899407.1.63504 WP_003899407.1.63522 WP_003899407.1.63530 WP_003899407.1.63538 WP_003899407.1.63564 WP_003899407.1.63567 WP_003899407.1.63596 WP_003899407.1.63600 WP_003899407.1.63623 WP_003899407.1.63624 WP_003899407.1.63625 WP_003899407.1.63627 WP_003899407.1.63654 WP_003899407.1.63662 WP_003899407.1.63711 WP_003899407.1.63734 WP_003899407.1.63807 WP_003899407.1.63819 WP_003899407.1.63844 WP_003899407.1.63888 WP_003899407.1.63913 WP_003899407.1.63915 WP_003899407.1.63918 WP_003899407.1.63961 WP_003899407.1.63970 WP_003899407.1.64000 WP_003899407.1.64027 WP_003899407.1.64058 WP_003899407.1.64065 WP_003899407.1.6407 WP_003899407.1.64082 WP_003899407.1.64091 WP_003899407.1.64102 WP_003899407.1.64104 WP_003899407.1.64119 WP_003899407.1.64169 WP_003899407.1.64219 WP_003899407.1.6422 WP_003899407.1.64222 WP_003899407.1.64223 WP_003899407.1.64228 WP_003899407.1.64235 WP_003899407.1.64249 WP_003899407.1.6427 WP_003899407.1.64278 WP_003899407.1.64287 WP_003899407.1.64414 WP_003899407.1.64419 WP_003899407.1.6443 WP_003899407.1.64463 WP_003899407.1.64480 WP_003899407.1.64497 WP_003899407.1.64506 WP_003899407.1.64511 WP_003899407.1.64513 WP_003899407.1.64514 WP_003899407.1.64515 WP_003899407.1.64522 WP_003899407.1.64526 WP_003899407.1.64543 WP_003899407.1.6456 WP_003899407.1.64567 WP_003899407.1.64588 WP_003899407.1.64589 WP_003899407.1.64594 WP_003899407.1.64595 WP_003899407.1.64608 WP_003899407.1.64619 WP_003899407.1.64629 WP_003899407.1.6464 WP_003899407.1.64664 WP_003899407.1.64669 WP_003899407.1.64672 WP_003899407.1.64680 WP_003899407.1.64682 WP_003899407.1.64727 WP_003899407.1.64729 WP_003899407.1.64774 WP_003899407.1.64776 WP_003899407.1.64802 WP_003899407.1.64832 WP_003899407.1.6486 WP_003899407.1.64870 WP_003899407.1.64898 WP_003899407.1.64922 WP_003899407.1.64924 WP_003899407.1.6493 WP_003899407.1.64937 WP_003899407.1.64941 WP_003899407.1.64966 WP_003899407.1.64973 WP_003899407.1.65001 WP_003899407.1.65026 WP_003899407.1.65053 WP_003899407.1.65070 WP_003899407.1.65079 WP_003899407.1.65102 WP_003899407.1.65157 WP_003899407.1.65181 WP_003899407.1.65212 WP_003899407.1.65229 WP_003899407.1.6523 WP_003899407.1.65253 WP_003899407.1.65289 WP_003899407.1.65291 WP_003899407.1.65315 WP_003899407.1.65329 WP_003899407.1.65359 WP_003899407.1.6536 WP_003899407.1.65374 WP_003899407.1.65414 WP_003899407.1.65416 WP_003899407.1.65433 WP_003899407.1.65455 WP_003899407.1.65467 WP_003899407.1.65488 WP_003899407.1.65529 WP_003899407.1.65539 WP_003899407.1.65583 WP_003899407.1.65612 WP_003899407.1.65623 WP_003899407.1.65635 WP_003899407.1.65637 WP_003899407.1.65648 WP_003899407.1.65683 WP_003899407.1.65686 WP_003899407.1.65688 WP_003899407.1.65707 WP_003899407.1.65733 WP_003899407.1.65746 WP_003899407.1.65747 WP_003899407.1.65759 WP_003899407.1.65816 WP_003899407.1.65830 WP_003899407.1.65858 WP_003899407.1.65862 WP_003899407.1.65869 WP_003899407.1.65893 WP_003899407.1.65929 WP_003899407.1.65932 WP_003899407.1.65958 WP_003899407.1.65974 WP_003899407.1.66004 WP_003899407.1.66013 WP_003899407.1.6606 WP_003899407.1.66089 WP_003899407.1.66149 WP_003899407.1.66151 WP_003899407.1.66229 WP_003899407.1.66276 WP_003899407.1.66293 WP_003899407.1.66297 WP_003899407.1.66323 WP_003899407.1.66325 WP_003899407.1.6633 WP_003899407.1.66334 WP_003899407.1.66355 WP_003899407.1.66367 WP_003899407.1.66394 WP_003899407.1.66396 WP_003899407.1.66451 WP_003899407.1.66455 WP_003899407.1.66457 WP_003899407.1.66460 WP_003899407.1.66464 WP_003899407.1.66466 WP_003899407.1.66487 WP_003899407.1.66504 WP_003899407.1.66544 WP_003899407.1.66558 WP_003899407.1.66580 WP_003899407.1.66582 WP_003899407.1.66612 WP_003899407.1.66615 WP_003899407.1.66617 WP_003899407.1.66635 WP_003899407.1.66656 WP_003899407.1.66663 WP_003899407.1.66675 WP_003899407.1.66715 WP_003899407.1.66718 WP_003899407.1.66762 WP_003899407.1.66776 WP_003899407.1.66808 WP_003899407.1.66817 WP_003899407.1.66819 WP_003899407.1.66826 WP_003899407.1.66830 WP_003899407.1.66868 WP_003899407.1.66878 WP_003899407.1.66880 WP_003899407.1.66893 WP_003899407.1.66961 WP_003899407.1.67005 WP_003899407.1.6704 WP_003899407.1.67044 WP_003899407.1.67061 WP_003899407.1.67089 WP_003899407.1.67098 WP_003899407.1.67146 WP_003899407.1.67170 WP_003899407.1.67197 WP_003899407.1.67198 WP_003899407.1.6720 WP_003899407.1.67207 WP_003899407.1.67218 WP_003899407.1.67220 WP_003899407.1.67225 WP_003899407.1.67231 WP_003899407.1.6724 WP_003899407.1.67257 WP_003899407.1.67298 WP_003899407.1.67307 WP_003899407.1.67324 WP_003899407.1.67332 WP_003899407.1.67346 WP_003899407.1.67354 WP_003899407.1.67360 WP_003899407.1.67381 WP_003899407.1.67396 WP_003899407.1.67417 WP_003899407.1.67422 WP_003899407.1.67453 WP_003899407.1.67459 WP_003899407.1.6746 WP_003899407.1.67473 WP_003899407.1.67481 WP_003899407.1.67482 WP_003899407.1.67496 WP_003899407.1.67499 WP_003899407.1.67516 WP_003899407.1.67523 WP_003899407.1.67536 WP_003899407.1.67575 WP_003899407.1.67587 WP_003899407.1.67598 WP_003899407.1.67600 WP_003899407.1.67602 WP_003899407.1.67630 WP_003899407.1.67679 WP_003899407.1.67692 WP_003899407.1.67744 WP_003899407.1.6775 WP_003899407.1.67750 WP_003899407.1.6777 WP_003899407.1.67809 WP_003899407.1.67816 WP_003899407.1.67844 WP_003899407.1.67848 WP_003899407.1.67870 WP_003899407.1.67888 WP_003899407.1.67915 WP_003899407.1.67945 WP_003899407.1.67949 WP_003899407.1.67980 WP_003899407.1.67982 WP_003899407.1.68022 WP_003899407.1.68029 WP_003899407.1.68037 WP_003899407.1.68038 WP_003899407.1.68045 WP_003899407.1.68057 WP_003899407.1.68083 WP_003899407.1.68088 WP_003899407.1.68106 WP_003899407.1.68110 WP_003899407.1.68153 WP_003899407.1.68164 WP_003899407.1.68169 WP_003899407.1.68193 WP_003899407.1.68212 WP_003899407.1.68227 WP_003899407.1.68243 WP_003899407.1.6825 WP_003899407.1.68297 WP_003899407.1.68309 WP_003899407.1.68325 WP_003899407.1.68329 WP_003899407.1.68340 WP_003899407.1.68384 WP_003899407.1.68388 WP_003899407.1.68429 WP_003899407.1.6843 WP_003899407.1.68433 WP_003899407.1.68444 WP_003899407.1.68465 WP_003899407.1.68484 WP_003899407.1.68518 WP_003899407.1.68569 WP_003899407.1.68576 WP_003899407.1.68580 WP_003899407.1.68586 WP_003899407.1.68623 WP_003899407.1.68624 WP_003899407.1.68637 WP_003899407.1.68646 WP_003899407.1.68667 WP_003899407.1.68669 WP_003899407.1.68672 WP_003899407.1.68684 WP_003899407.1.68704 WP_003899407.1.68708 WP_003899407.1.6872 WP_003899407.1.68730 WP_003899407.1.68734 WP_003899407.1.68748 WP_003899407.1.68754 WP_003899407.1.6876 WP_003899407.1.68761 WP_003899407.1.68763 WP_003899407.1.68766 WP_003899407.1.68774 WP_003899407.1.68796 WP_003899407.1.68824 WP_003899407.1.68832 WP_003899407.1.68833 WP_003899407.1.68841 WP_003899407.1.68859 WP_003899407.1.68876 WP_003899407.1.68906 WP_003899407.1.68916 WP_003899407.1.68923 WP_003899407.1.68945 WP_003899407.1.6896 WP_003899407.1.68981 WP_003899407.1.68984 WP_003899407.1.68997 WP_003899407.1.69008 WP_003899407.1.69076 WP_003899407.1.69079 WP_003899407.1.6908 WP_003899407.1.69082 WP_003899407.1.69178 WP_003899407.1.69181 WP_003899407.1.69208 WP_003899407.1.69231 WP_003899407.1.69256 WP_003899407.1.69311 WP_003899407.1.69315 WP_003899407.1.69322 WP_003899407.1.69342 WP_003899407.1.6935 WP_003899407.1.6936 WP_003899407.1.69369 WP_003899407.1.69374 WP_003899407.1.69398 WP_003899407.1.69401 WP_003899407.1.69426 WP_003899407.1.69427 WP_003899407.1.69429 WP_003899407.1.6949 WP_003899407.1.6951 WP_003899407.1.69511 WP_003899407.1.69526 WP_003899407.1.69528 WP_003899407.1.69547 WP_003899407.1.69573 WP_003899407.1.69581 WP_003899407.1.6960 WP_003899407.1.69617 WP_003899407.1.69634 WP_003899407.1.69647 WP_003899407.1.69659 WP_003899407.1.69673 WP_003899407.1.69682 WP_003899407.1.69684 WP_003899407.1.69686 WP_003899407.1.69707 WP_003899407.1.69709 WP_003899407.1.69723 WP_003899407.1.69736 WP_003899407.1.69778 WP_003899407.1.69800 WP_003899407.1.69802 WP_003899407.1.69845 WP_003899407.1.69870 WP_003899407.1.69873 WP_003899407.1.69898 WP_003899407.1.69913 WP_003899407.1.69925 WP_003899407.1.69931 WP_003899407.1.69938 WP_003899407.1.69955 WP_003899407.1.69957 WP_003899407.1.69981 WP_003899407.1.69990 WP_003899407.1.70 WP_003899407.1.70000 WP_003899407.1.70017 WP_003899407.1.70032 WP_003899407.1.70055 WP_003899407.1.70062 WP_003899407.1.70072 WP_003899407.1.70131 WP_003899407.1.70132 WP_003899407.1.7022 WP_003899407.1.70227 WP_003899407.1.70255 WP_003899407.1.70271 WP_003899407.1.70274 WP_003899407.1.7029 WP_003899407.1.70325 WP_003899407.1.70328 WP_003899407.1.70356 WP_003899407.1.70364 WP_003899407.1.70368 WP_003899407.1.70369 WP_003899407.1.70418 WP_003899407.1.70422 WP_003899407.1.70435 WP_003899407.1.70444 WP_003899407.1.70463 WP_003899407.1.70471 WP_003899407.1.70480 WP_003899407.1.70494 WP_003899407.1.70498 WP_003899407.1.70505 WP_003899407.1.70525 WP_003899407.1.70573 WP_003899407.1.70577 WP_003899407.1.70610 WP_003899407.1.70615 WP_003899407.1.70618 WP_003899407.1.70622 WP_003899407.1.70626 WP_003899407.1.70668 WP_003899407.1.70699 WP_003899407.1.70704 WP_003899407.1.70729 WP_003899407.1.70757 WP_003899407.1.70782 WP_003899407.1.70796 WP_003899407.1.70830 WP_003899407.1.70834 WP_003899407.1.7084 WP_003899407.1.70840 WP_003899407.1.70864 WP_003899407.1.70871 WP_003899407.1.70915 WP_003899407.1.70955 WP_003899407.1.70958 WP_003899407.1.70964 WP_003899407.1.70976 WP_003899407.1.71015 WP_003899407.1.71026 WP_003899407.1.71063 WP_003899407.1.71076 WP_003899407.1.71083 WP_003899407.1.7111 WP_003899407.1.71118 WP_003899407.1.71128 WP_003899407.1.7113 WP_003899407.1.71187 WP_003899407.1.71191 WP_003899407.1.71255 WP_003899407.1.71258 WP_003899407.1.71259 WP_003899407.1.71289 WP_003899407.1.71326 WP_003899407.1.71329 WP_003899407.1.71331 WP_003899407.1.71344 WP_003899407.1.71390 WP_003899407.1.71399 WP_003899407.1.71414 WP_003899407.1.71440 WP_003899407.1.71457 WP_003899407.1.71464 WP_003899407.1.71490 WP_003899407.1.71492 WP_003899407.1.71509 WP_003899407.1.71516 WP_003899407.1.71517 WP_003899407.1.71527 WP_003899407.1.71532 WP_003899407.1.71545 WP_003899407.1.71546 WP_003899407.1.71569 WP_003899407.1.71604 WP_003899407.1.71621 WP_003899407.1.71630 WP_003899407.1.71638 WP_003899407.1.71654 WP_003899407.1.71664 WP_003899407.1.71665 WP_003899407.1.71683 WP_003899407.1.71701 WP_003899407.1.71718 WP_003899407.1.71731 WP_003899407.1.71778 WP_003899407.1.71781 WP_003899407.1.71803 WP_003899407.1.71820 WP_003899407.1.7185 WP_003899407.1.71851 WP_003899407.1.71871 WP_003899407.1.71909 WP_003899407.1.71957 WP_003899407.1.71970 WP_003899407.1.72047 WP_003899407.1.72061 WP_003899407.1.72062 WP_003899407.1.72072 WP_003899407.1.72111 WP_003899407.1.72122 WP_003899407.1.72128 WP_003899407.1.72143 WP_003899407.1.7216 WP_003899407.1.72168 WP_003899407.1.72179 WP_003899407.1.72209 WP_003899407.1.72218 WP_003899407.1.72219 WP_003899407.1.72227 WP_003899407.1.7224 WP_003899407.1.72268 WP_003899407.1.72332 WP_003899407.1.72380 WP_003899407.1.72401 WP_003899407.1.72405 WP_003899407.1.72420 WP_003899407.1.72441 WP_003899407.1.72451 WP_003899407.1.72452 WP_003899407.1.72457 WP_003899407.1.72459 WP_003899407.1.72460 WP_003899407.1.72466 WP_003899407.1.72487 WP_003899407.1.72488 WP_003899407.1.72492 WP_003899407.1.72506 WP_003899407.1.72543 WP_003899407.1.7256 WP_003899407.1.72576 WP_003899407.1.72578 WP_003899407.1.72585 WP_003899407.1.72591 WP_003899407.1.72592 WP_003899407.1.72640 WP_003899407.1.7266 WP_003899407.1.72661 WP_003899407.1.72684 WP_003899407.1.72739 WP_003899407.1.72744 WP_003899407.1.72755 WP_003899407.1.72759 WP_003899407.1.72784 WP_003899407.1.72792 WP_003899407.1.72826 WP_003899407.1.72831 WP_003899407.1.72852 WP_003899407.1.72853 WP_003899407.1.72879 WP_003899407.1.72880 WP_003899407.1.72938 WP_003899407.1.72954 WP_003899407.1.72957 WP_003899407.1.72959 WP_003899407.1.72973 WP_003899407.1.7298 WP_003899407.1.72982 WP_003899407.1.72988 WP_003899407.1.72993 WP_003899407.1.73006 WP_003899407.1.73013 WP_003899407.1.73025 WP_003899407.1.73028 WP_003899407.1.73042 WP_003899407.1.73045 WP_003899407.1.73092 WP_003899407.1.73118 WP_003899407.1.7312 WP_003899407.1.73127 WP_003899407.1.73134 WP_003899407.1.73150 WP_003899407.1.73154 WP_003899407.1.73163 WP_003899407.1.73182 WP_003899407.1.73205 WP_003899407.1.7321 WP_003899407.1.73310 WP_003899407.1.73315 WP_003899407.1.73365 WP_003899407.1.73391 WP_003899407.1.73404 WP_003899407.1.73424 WP_003899407.1.73436 WP_003899407.1.73445 WP_003899407.1.73453 WP_003899407.1.73465 WP_003899407.1.73466 WP_003899407.1.73470 WP_003899407.1.73471 WP_003899407.1.73478 WP_003899407.1.73482 WP_003899407.1.73507 WP_003899407.1.73532 WP_003899407.1.73550 WP_003899407.1.73564 WP_003899407.1.73623 WP_003899407.1.73629 WP_003899407.1.73644 WP_003899407.1.7366 WP_003899407.1.73661 WP_003899407.1.7368 WP_003899407.1.73688 WP_003899407.1.73723 WP_003899407.1.73744 WP_003899407.1.73750 WP_003899407.1.73760 WP_003899407.1.73774 WP_003899407.1.7379 WP_003899407.1.73813 WP_003899407.1.73840 WP_003899407.1.73876 WP_003899407.1.7389 WP_003899407.1.73986 WP_003899407.1.74016 WP_003899407.1.74039 WP_003899407.1.74083 WP_003899407.1.74101 WP_003899407.1.74107 WP_003899407.1.74120 WP_003899407.1.74129 WP_003899407.1.74144 WP_003899407.1.7417 WP_003899407.1.74190 WP_003899407.1.74210 WP_003899407.1.7423 WP_003899407.1.74259 WP_003899407.1.74262 WP_003899407.1.74269 WP_003899407.1.74282 WP_003899407.1.74291 WP_003899407.1.74296 WP_003899407.1.74304 WP_003899407.1.7432 WP_003899407.1.74347 WP_003899407.1.7436 WP_003899407.1.74378 WP_003899407.1.74382 WP_003899407.1.74395 WP_003899407.1.74400 WP_003899407.1.74401 WP_003899407.1.74432 WP_003899407.1.74442 WP_003899407.1.74477 WP_003899407.1.74487 WP_003899407.1.74499 WP_003899407.1.74504 WP_003899407.1.74511 WP_003899407.1.74523 WP_003899407.1.74525 WP_003899407.1.74551 WP_003899407.1.74555 WP_003899407.1.74628 WP_003899407.1.74641 WP_003899407.1.74653 WP_003899407.1.74660 WP_003899407.1.74683 WP_003899407.1.7469 WP_003899407.1.74725 WP_003899407.1.74760 WP_003899407.1.74786 WP_003899407.1.74809 WP_003899407.1.74820 WP_003899407.1.74870 WP_003899407.1.74881 WP_003899407.1.74888 WP_003899407.1.74952 WP_003899407.1.7496 WP_003899407.1.74988 WP_003899407.1.75043 WP_003899407.1.75045 WP_003899407.1.75055 WP_003899407.1.75078 WP_003899407.1.75081 WP_003899407.1.75120 WP_003899407.1.75163 WP_003899407.1.75188 WP_003899407.1.75200 WP_003899407.1.75202 WP_003899407.1.75234 WP_003899407.1.75239 WP_003899407.1.75250 WP_003899407.1.75263 WP_003899407.1.75281 WP_003899407.1.75342 WP_003899407.1.7535 WP_003899407.1.75376 WP_003899407.1.75391 WP_003899407.1.75395 WP_003899407.1.75441 WP_003899407.1.75510 WP_003899407.1.75581 WP_003899407.1.75598 WP_003899407.1.75635 WP_003899407.1.75645 WP_003899407.1.75665 WP_003899407.1.75671 WP_003899407.1.75741 WP_003899407.1.75749 WP_003899407.1.75772 WP_003899407.1.75774 WP_003899407.1.75811 WP_003899407.1.75833 WP_003899407.1.7585 WP_003899407.1.75864 WP_003899407.1.75868 WP_003899407.1.75878 WP_003899407.1.75927 WP_003899407.1.75946 WP_003899407.1.75968 WP_003899407.1.75974 WP_003899407.1.76007 WP_003899407.1.76016 WP_003899407.1.76032 WP_003899407.1.76037 WP_003899407.1.7604 WP_003899407.1.76045 WP_003899407.1.76052 WP_003899407.1.76058 WP_003899407.1.76064 WP_003899407.1.76110 WP_003899407.1.76126 WP_003899407.1.76133 WP_003899407.1.76138 WP_003899407.1.76157 WP_003899407.1.76172 WP_003899407.1.76177 WP_003899407.1.76183 WP_003899407.1.76209 WP_003899407.1.76239 WP_003899407.1.76272 WP_003899407.1.76277 WP_003899407.1.76280 WP_003899407.1.76281 WP_003899407.1.76291 WP_003899407.1.76297 WP_003899407.1.76360 WP_003899407.1.76379 WP_003899407.1.76403 WP_003899407.1.76413 WP_003899407.1.76414 WP_003899407.1.76427 WP_003899407.1.76436 WP_003899407.1.76442 WP_003899407.1.76443 WP_003899407.1.76456 WP_003899407.1.76521 WP_003899407.1.76533 WP_003899407.1.76616 WP_003899407.1.76625 WP_003899407.1.76629 WP_003899407.1.76635 WP_003899407.1.76638 WP_003899407.1.76639 WP_003899407.1.76640 WP_003899407.1.76644 WP_003899407.1.76677 WP_003899407.1.76678 WP_003899407.1.76679 WP_003899407.1.76734 WP_003899407.1.76744 WP_003899407.1.76750 WP_003899407.1.76754 WP_003899407.1.76757 WP_003899407.1.76781 WP_003899407.1.76818 WP_003899407.1.76824 WP_003899407.1.76835 WP_003899407.1.76873 WP_003899407.1.76881 WP_003899407.1.76888 WP_003899407.1.76900 WP_003899407.1.7691 WP_003899407.1.76947 WP_003899407.1.76954 WP_003899407.1.76955 WP_003899407.1.76963 WP_003899407.1.76976 WP_003899407.1.770 WP_003899407.1.77000 WP_003899407.1.77008 WP_003899407.1.77021 WP_003899407.1.77056 WP_003899407.1.77065 WP_003899407.1.77075 WP_003899407.1.77093 WP_003899407.1.77107 WP_003899407.1.77115 WP_003899407.1.77118 WP_003899407.1.77125 WP_003899407.1.77141 WP_003899407.1.77142 WP_003899407.1.77166 WP_003899407.1.77250 WP_003899407.1.77252 WP_003899407.1.77260 WP_003899407.1.77266 WP_003899407.1.77280 WP_003899407.1.77285 WP_003899407.1.77312 WP_003899407.1.77348 WP_003899407.1.77351 WP_003899407.1.77352 WP_003899407.1.77361 WP_003899407.1.774 WP_003899407.1.7740 WP_003899407.1.77404 WP_003899407.1.77425 WP_003899407.1.77463 WP_003899407.1.77474 WP_003899407.1.7748 WP_003899407.1.77484 WP_003899407.1.77491 WP_003899407.1.77499 WP_003899407.1.77510 WP_003899407.1.77530 WP_003899407.1.77554 WP_003899407.1.77559 WP_003899407.1.77599 WP_003899407.1.77605 WP_003899407.1.7762 WP_003899407.1.77627 WP_003899407.1.77649 WP_003899407.1.77654 WP_003899407.1.7766 WP_003899407.1.77667 WP_003899407.1.77704 WP_003899407.1.77706 WP_003899407.1.77726 WP_003899407.1.77774 WP_003899407.1.7778 WP_003899407.1.77790 WP_003899407.1.77809 WP_003899407.1.77820 WP_003899407.1.77843 WP_003899407.1.77855 WP_003899407.1.77865 WP_003899407.1.77868 WP_003899407.1.77879 WP_003899407.1.77890 WP_003899407.1.77909 WP_003899407.1.77911 WP_003899407.1.77931 WP_003899407.1.77984 WP_003899407.1.78020 WP_003899407.1.78024 WP_003899407.1.78075 WP_003899407.1.78084 WP_003899407.1.78086 WP_003899407.1.7809 WP_003899407.1.78098 WP_003899407.1.78105 WP_003899407.1.78113 WP_003899407.1.78136 WP_003899407.1.78162 WP_003899407.1.7817 WP_003899407.1.78200 WP_003899407.1.78216 WP_003899407.1.78236 WP_003899407.1.78238 WP_003899407.1.78322 WP_003899407.1.78338 WP_003899407.1.7836 WP_003899407.1.78360 WP_003899407.1.78386 WP_003899407.1.78429 WP_003899407.1.78435 WP_003899407.1.7844 WP_003899407.1.78459 WP_003899407.1.78488 WP_003899407.1.7849 WP_003899407.1.78499 WP_003899407.1.785 WP_003899407.1.78516 WP_003899407.1.78524 WP_003899407.1.78526 WP_003899407.1.78538 WP_003899407.1.78544 WP_003899407.1.78545 WP_003899407.1.78547 WP_003899407.1.78574 WP_003899407.1.78580 WP_003899407.1.7860 WP_003899407.1.78620 WP_003899407.1.78646 WP_003899407.1.78648 WP_003899407.1.78649 WP_003899407.1.78655 WP_003899407.1.78657 WP_003899407.1.78659 WP_003899407.1.7869 WP_003899407.1.78692 WP_003899407.1.78760 WP_003899407.1.78766 WP_003899407.1.78776 WP_003899407.1.78778 WP_003899407.1.78784 WP_003899407.1.78788 WP_003899407.1.78790 WP_003899407.1.78793 WP_003899407.1.78848 WP_003899407.1.78860 WP_003899407.1.7887 WP_003899407.1.78884 WP_003899407.1.78932 WP_003899407.1.78969 WP_003899407.1.78977 WP_003899407.1.78980 WP_003899407.1.79005 WP_003899407.1.79016 WP_003899407.1.79033 WP_003899407.1.79064 WP_003899407.1.79066 WP_003899407.1.79068 WP_003899407.1.79077 WP_003899407.1.79095 WP_003899407.1.79112 WP_003899407.1.79122 WP_003899407.1.79145 WP_003899407.1.79152 WP_003899407.1.79163 WP_003899407.1.79182 WP_003899407.1.79198 WP_003899407.1.79213 WP_003899407.1.79218 WP_003899407.1.79268 WP_003899407.1.79273 WP_003899407.1.79278 WP_003899407.1.79290 WP_003899407.1.79319 WP_003899407.1.79325 WP_003899407.1.79326 WP_003899407.1.7933 WP_003899407.1.79330 WP_003899407.1.79339 WP_003899407.1.79394 WP_003899407.1.79399 WP_003899407.1.79413 WP_003899407.1.79422 WP_003899407.1.79445 WP_003899407.1.79447 WP_003899407.1.79455 WP_003899407.1.79471 WP_003899407.1.79480 WP_003899407.1.79482 WP_003899407.1.79488 WP_003899407.1.79500 WP_003899407.1.79502 WP_003899407.1.79508 WP_003899407.1.79514 WP_003899407.1.79561 WP_003899407.1.79565 WP_003899407.1.79578 WP_003899407.1.79588 WP_003899407.1.79598 WP_003899407.1.79615 WP_003899407.1.79684 WP_003899407.1.79698 WP_003899407.1.797 WP_003899407.1.79744 WP_003899407.1.79784 WP_003899407.1.79802 WP_003899407.1.79806 WP_003899407.1.79819 WP_003899407.1.79826 WP_003899407.1.79828 WP_003899407.1.79851 WP_003899407.1.79853 WP_003899407.1.79863 WP_003899407.1.79881 WP_003899407.1.79885 WP_003899407.1.79898 WP_003899407.1.7990 WP_003899407.1.79900 WP_003899407.1.79913 WP_003899407.1.79918 WP_003899407.1.79947 WP_003899407.1.79948 WP_003899407.1.7995 WP_003899407.1.7997 WP_003899407.1.80004 WP_003899407.1.80015 WP_003899407.1.80022 WP_003899407.1.80030 WP_003899407.1.80054 WP_003899407.1.80084 WP_003899407.1.80099 WP_003899407.1.80129 WP_003899407.1.80177 WP_003899407.1.80234 WP_003899407.1.8026 WP_003899407.1.80275 WP_003899407.1.8029 WP_003899407.1.80299 WP_003899407.1.80300 WP_003899407.1.80304 WP_003899407.1.80326 WP_003899407.1.80351 WP_003899407.1.8037 WP_003899407.1.80370 WP_003899407.1.80399 WP_003899407.1.8044 WP_003899407.1.80451 WP_003899407.1.80458 WP_003899407.1.80461 WP_003899407.1.80490 WP_003899407.1.80503 WP_003899407.1.80507 WP_003899407.1.80552 WP_003899407.1.80576 WP_003899407.1.80588 WP_003899407.1.80599 WP_003899407.1.8060 WP_003899407.1.80624 WP_003899407.1.80636 WP_003899407.1.80669 WP_003899407.1.80673 WP_003899407.1.80711 WP_003899407.1.80714 WP_003899407.1.80743 WP_003899407.1.80784 WP_003899407.1.80815 WP_003899407.1.80853 WP_003899407.1.80918 WP_003899407.1.8093 WP_003899407.1.80967 WP_003899407.1.8097 WP_003899407.1.80988 WP_003899407.1.81007 WP_003899407.1.81013 WP_003899407.1.8105 WP_003899407.1.81059 WP_003899407.1.81063 WP_003899407.1.81066 WP_003899407.1.81075 WP_003899407.1.81091 WP_003899407.1.81119 WP_003899407.1.81125 WP_003899407.1.81136 WP_003899407.1.8114 WP_003899407.1.81189 WP_003899407.1.81192 WP_003899407.1.812 WP_003899407.1.81230 WP_003899407.1.81249 WP_003899407.1.81250 WP_003899407.1.81264 WP_003899407.1.8128 WP_003899407.1.81287 WP_003899407.1.81297 WP_003899407.1.8138 WP_003899407.1.81407 WP_003899407.1.8143 WP_003899407.1.81439 WP_003899407.1.81465 WP_003899407.1.81505 WP_003899407.1.81529 WP_003899407.1.81538 WP_003899407.1.81541 WP_003899407.1.81560 WP_003899407.1.81561 WP_003899407.1.81567 WP_003899407.1.81583 WP_003899407.1.81686 WP_003899407.1.81712 WP_003899407.1.81720 WP_003899407.1.81731 WP_003899407.1.81774 WP_003899407.1.81788 WP_003899407.1.81809 WP_003899407.1.81820 WP_003899407.1.81850 WP_003899407.1.81883 WP_003899407.1.81891 WP_003899407.1.81911 WP_003899407.1.81918 WP_003899407.1.82011 WP_003899407.1.82048 WP_003899407.1.82069 WP_003899407.1.82071 WP_003899407.1.82108 WP_003899407.1.82136 WP_003899407.1.82142 WP_003899407.1.8215 WP_003899407.1.82158 WP_003899407.1.8217 WP_003899407.1.82209 WP_003899407.1.82210 WP_003899407.1.82228 WP_003899407.1.82236 WP_003899407.1.82251 WP_003899407.1.82271 WP_003899407.1.82305 WP_003899407.1.82307 WP_003899407.1.82309 WP_003899407.1.82317 WP_003899407.1.8232 WP_003899407.1.82346 WP_003899407.1.82374 WP_003899407.1.82385 WP_003899407.1.82429 WP_003899407.1.82460 WP_003899407.1.82462 WP_003899407.1.82483 WP_003899407.1.82494 WP_003899407.1.82531 WP_003899407.1.82546 WP_003899407.1.82547 WP_003899407.1.82549 WP_003899407.1.82577 WP_003899407.1.82592 WP_003899407.1.82597 WP_003899407.1.82598 WP_003899407.1.82625 WP_003899407.1.82642 WP_003899407.1.82651 WP_003899407.1.82653 WP_003899407.1.82681 WP_003899407.1.82685 WP_003899407.1.8271 WP_003899407.1.82712 WP_003899407.1.8273 WP_003899407.1.82743 WP_003899407.1.82757 WP_003899407.1.82774 WP_003899407.1.82803 WP_003899407.1.82836 WP_003899407.1.82860 WP_003899407.1.82871 WP_003899407.1.82892 WP_003899407.1.82935 WP_003899407.1.82957 WP_003899407.1.82973 WP_003899407.1.82981 WP_003899407.1.82983 WP_003899407.1.83004 WP_003899407.1.83009 WP_003899407.1.83044 WP_003899407.1.83065 WP_003899407.1.83074 WP_003899407.1.83110 WP_003899407.1.83146 WP_003899407.1.83149 WP_003899407.1.83159 WP_003899407.1.8317 WP_003899407.1.83173 WP_003899407.1.83181 WP_003899407.1.83182 WP_003899407.1.83191 WP_003899407.1.83197 WP_003899407.1.83212 WP_003899407.1.8326 WP_003899407.1.83262 WP_003899407.1.83268 WP_003899407.1.83273 WP_003899407.1.83309 WP_003899407.1.83332 WP_003899407.1.83334 WP_003899407.1.83341 WP_003899407.1.83349 WP_003899407.1.8335 WP_003899407.1.83353 WP_003899407.1.83367 WP_003899407.1.83380 WP_003899407.1.83381 WP_003899407.1.83389 WP_003899407.1.83408 WP_003899407.1.83409 WP_003899407.1.83435 WP_003899407.1.83470 WP_003899407.1.83524 WP_003899407.1.83526 WP_003899407.1.8358 WP_003899407.1.83589 WP_003899407.1.83601 WP_003899407.1.83611 WP_003899407.1.83638 WP_003899407.1.83648 WP_003899407.1.83656 WP_003899407.1.83667 WP_003899407.1.83689 WP_003899407.1.83692 WP_003899407.1.83704 WP_003899407.1.83705 WP_003899407.1.83766 WP_003899407.1.83793 WP_003899407.1.83794 WP_003899407.1.83802 WP_003899407.1.83805 WP_003899407.1.83839 WP_003899407.1.83842 WP_003899407.1.83850 WP_003899407.1.83861 WP_003899407.1.83884 WP_003899407.1.83920 WP_003899407.1.83929 WP_003899407.1.83930 WP_003899407.1.83975 WP_003899407.1.83991 WP_003899407.1.8400 WP_003899407.1.84027 WP_003899407.1.8404 WP_003899407.1.84057 WP_003899407.1.84070 WP_003899407.1.8409 WP_003899407.1.84112 WP_003899407.1.84146 WP_003899407.1.8415 WP_003899407.1.84176 WP_003899407.1.84186 WP_003899407.1.84192 WP_003899407.1.84228 WP_003899407.1.8424 WP_003899407.1.84244 WP_003899407.1.84259 WP_003899407.1.8426 WP_003899407.1.84277 WP_003899407.1.84287 WP_003899407.1.8434 WP_003899407.1.84388 WP_003899407.1.84408 WP_003899407.1.84409 WP_003899407.1.84438 WP_003899407.1.84460 WP_003899407.1.84488 WP_003899407.1.84504 WP_003899407.1.84525 WP_003899407.1.84620 WP_003899407.1.84623 WP_003899407.1.84641 WP_003899407.1.84655 WP_003899407.1.84666 WP_003899407.1.84670 WP_003899407.1.84739 WP_003899407.1.84748 WP_003899407.1.84766 WP_003899407.1.84772 WP_003899407.1.84774 WP_003899407.1.848 WP_003899407.1.84812 WP_003899407.1.84836 WP_003899407.1.84839 WP_003899407.1.84846 WP_003899407.1.84873 WP_003899407.1.84911 WP_003899407.1.84938 WP_003899407.1.84968 WP_003899407.1.84973 WP_003899407.1.84981 WP_003899407.1.84985 WP_003899407.1.8503 WP_003899407.1.85038 WP_003899407.1.85041 WP_003899407.1.85043 WP_003899407.1.8505 WP_003899407.1.85074 WP_003899407.1.8509 WP_003899407.1.8512 WP_003899407.1.85148 WP_003899407.1.8518 WP_003899407.1.8522 WP_003899407.1.85242 WP_003899407.1.85276 WP_003899407.1.85281 WP_003899407.1.85284 WP_003899407.1.85314 WP_003899407.1.85319 WP_003899407.1.85330 WP_003899407.1.85341 WP_003899407.1.85346 WP_003899407.1.8535 WP_003899407.1.85363 WP_003899407.1.85371 WP_003899407.1.85377 WP_003899407.1.85387 WP_003899407.1.85399 WP_003899407.1.85458 WP_003899407.1.8546 WP_003899407.1.85464 WP_003899407.1.85478 WP_003899407.1.85480 WP_003899407.1.85488 WP_003899407.1.85495 WP_003899407.1.85551 WP_003899407.1.85557 WP_003899407.1.85577 WP_003899407.1.85597 WP_003899407.1.85599 WP_003899407.1.85610 WP_003899407.1.8563 WP_003899407.1.85648 WP_003899407.1.85679 WP_003899407.1.85704 WP_003899407.1.85717 WP_003899407.1.85727 WP_003899407.1.85737 WP_003899407.1.85763 WP_003899407.1.85808 WP_003899407.1.85819 WP_003899407.1.85820 WP_003899407.1.85823 WP_003899407.1.85832 WP_003899407.1.8586 WP_003899407.1.85872 WP_003899407.1.85894 WP_003899407.1.85909 WP_003899407.1.85913 WP_003899407.1.85953 WP_003899407.1.85986 WP_003899407.1.86000 WP_003899407.1.86024 WP_003899407.1.86025 WP_003899407.1.86032 WP_003899407.1.86048 WP_003899407.1.86052 WP_003899407.1.86067 WP_003899407.1.86103 WP_003899407.1.86122 WP_003899407.1.86124 WP_003899407.1.86160 WP_003899407.1.86164 WP_003899407.1.86168 WP_003899407.1.86190 WP_003899407.1.86204 WP_003899407.1.86235 WP_003899407.1.86249 WP_003899407.1.86260 WP_003899407.1.86290 WP_003899407.1.863 WP_003899407.1.86327 WP_003899407.1.86334 WP_003899407.1.86337 WP_003899407.1.86368 WP_003899407.1.86377 WP_003899407.1.86425 WP_003899407.1.86459 WP_003899407.1.8649 WP_003899407.1.86499 WP_003899407.1.86520 WP_003899407.1.86561 WP_003899407.1.86568 WP_003899407.1.86575 WP_003899407.1.86584 WP_003899407.1.86605 WP_003899407.1.86626 WP_003899407.1.86648 WP_003899407.1.8666 WP_003899407.1.86684 WP_003899407.1.86696 WP_003899407.1.86705 WP_003899407.1.86718 WP_003899407.1.86725 WP_003899407.1.86757 WP_003899407.1.86766 WP_003899407.1.86801 WP_003899407.1.86814 WP_003899407.1.86820 WP_003899407.1.86825 WP_003899407.1.86834 WP_003899407.1.8685 WP_003899407.1.86851 WP_003899407.1.86855 WP_003899407.1.86867 WP_003899407.1.86877 WP_003899407.1.86883 WP_003899407.1.8689 WP_003899407.1.86892 WP_003899407.1.86933 WP_003899407.1.86941 WP_003899407.1.86950 WP_003899407.1.86962 WP_003899407.1.86963 WP_003899407.1.86979 WP_003899407.1.8700 WP_003899407.1.87001 WP_003899407.1.87002 WP_003899407.1.87031 WP_003899407.1.87116 WP_003899407.1.87117 WP_003899407.1.8714 WP_003899407.1.87162 WP_003899407.1.87178 WP_003899407.1.87191 WP_003899407.1.87201 WP_003899407.1.87209 WP_003899407.1.87240 WP_003899407.1.87266 WP_003899407.1.87273 WP_003899407.1.87275 WP_003899407.1.8733 WP_003899407.1.87345 WP_003899407.1.87369 WP_003899407.1.8737 WP_003899407.1.87401 WP_003899407.1.87404 WP_003899407.1.87406 WP_003899407.1.87409 WP_003899407.1.87444 WP_003899407.1.87446 WP_003899407.1.87459 WP_003899407.1.87472 WP_003899407.1.87489 WP_003899407.1.87494 WP_003899407.1.87496 WP_003899407.1.87582 WP_003899407.1.87588 WP_003899407.1.87617 WP_003899407.1.87619 WP_003899407.1.87620 WP_003899407.1.87634 WP_003899407.1.87643 WP_003899407.1.8765 WP_003899407.1.87650 WP_003899407.1.87654 WP_003899407.1.87658 WP_003899407.1.87665 WP_003899407.1.87676 WP_003899407.1.87677 WP_003899407.1.87684 WP_003899407.1.87692 WP_003899407.1.87707 WP_003899407.1.87732 WP_003899407.1.87784 WP_003899407.1.87796 WP_003899407.1.87809 WP_003899407.1.87817 WP_003899407.1.87827 WP_003899407.1.87831 WP_003899407.1.87835 WP_003899407.1.87837 WP_003899407.1.87866 WP_003899407.1.8789 WP_003899407.1.87911 WP_003899407.1.87924 WP_003899407.1.87951 WP_003899407.1.87955 WP_003899407.1.87956 WP_003899407.1.87991 WP_003899407.1.88 WP_003899407.1.88002 WP_003899407.1.88037 WP_003899407.1.88039 WP_003899407.1.88072 WP_003899407.1.88077 WP_003899407.1.88121 WP_003899407.1.88180 WP_003899407.1.88191 WP_003899407.1.88205 WP_003899407.1.88217 WP_003899407.1.88219 WP_003899407.1.88245 WP_003899407.1.88253 WP_003899407.1.88294 WP_003899407.1.88315 WP_003899407.1.88316 WP_003899407.1.88320 WP_003899407.1.88338 WP_003899407.1.8840 WP_003899407.1.88437 WP_003899407.1.88453 WP_003899407.1.88469 WP_003899407.1.88489 WP_003899407.1.88507 WP_003899407.1.88521 WP_003899407.1.88530 WP_003899407.1.88537 WP_003899407.1.88541 WP_003899407.1.88592 WP_003899407.1.88616 WP_003899407.1.88618 WP_003899407.1.8862 WP_003899407.1.88625 WP_003899407.1.88634 WP_003899407.1.88649 WP_003899407.1.8870 WP_003899407.1.88737 WP_003899407.1.88756 WP_003899407.1.888 WP_003899407.1.88824 WP_003899407.1.88886 WP_003899407.1.88965 WP_003899407.1.88985 WP_003899407.1.8902 WP_003899407.1.89025 WP_003899407.1.89041 WP_003899407.1.89046 WP_003899407.1.89082 WP_003899407.1.89162 WP_003899407.1.89168 WP_003899407.1.8917 WP_003899407.1.89193 WP_003899407.1.89205 WP_003899407.1.89207 WP_003899407.1.89225 WP_003899407.1.8925 WP_003899407.1.89277 WP_003899407.1.89286 WP_003899407.1.89293 WP_003899407.1.89320 WP_003899407.1.8935 WP_003899407.1.89371 WP_003899407.1.89378 WP_003899407.1.89392 WP_003899407.1.89406 WP_003899407.1.8943 WP_003899407.1.89451 WP_003899407.1.89453 WP_003899407.1.89473 WP_003899407.1.89475 WP_003899407.1.89483 WP_003899407.1.895 WP_003899407.1.89513 WP_003899407.1.89517 WP_003899407.1.89522 WP_003899407.1.8954 WP_003899407.1.89543 WP_003899407.1.89567 WP_003899407.1.8957 WP_003899407.1.89572 WP_003899407.1.89589 WP_003899407.1.89607 WP_003899407.1.89613 WP_003899407.1.89625 WP_003899407.1.89648 WP_003899407.1.8967 WP_003899407.1.89670 WP_003899407.1.89676 WP_003899407.1.89729 WP_003899407.1.89739 WP_003899407.1.89762 WP_003899407.1.8977 WP_003899407.1.89802 WP_003899407.1.89808 WP_003899407.1.8982 WP_003899407.1.89829 WP_003899407.1.89831 WP_003899407.1.89844 WP_003899407.1.89849 WP_003899407.1.8989 WP_003899407.1.89901 WP_003899407.1.89903 WP_003899407.1.89909 WP_003899407.1.8992 WP_003899407.1.89922 WP_003899407.1.89926 WP_003899407.1.89963 WP_003899407.1.89971 WP_003899407.1.8998 WP_003899407.1.89987 WP_003899407.1.900 WP_003899407.1.90048 WP_003899407.1.9007 WP_003899407.1.90080 WP_003899407.1.90130 WP_003899407.1.90134 WP_003899407.1.90137 WP_003899407.1.90157 WP_003899407.1.90184 WP_003899407.1.90199 WP_003899407.1.90231 WP_003899407.1.90245 WP_003899407.1.90308 WP_003899407.1.90322 WP_003899407.1.90328 WP_003899407.1.90372 WP_003899407.1.90439 WP_003899407.1.90481 WP_003899407.1.90499 WP_003899407.1.9050 WP_003899407.1.90527 WP_003899407.1.90550 WP_003899407.1.90560 WP_003899407.1.90612 WP_003899407.1.90640 WP_003899407.1.90672 WP_003899407.1.90687 WP_003899407.1.90691 WP_003899407.1.90711 WP_003899407.1.90722 WP_003899407.1.90744 WP_003899407.1.9075 WP_003899407.1.90756 WP_003899407.1.90767 WP_003899407.1.90771 WP_003899407.1.90785 WP_003899407.1.90788 WP_003899407.1.90800 WP_003899407.1.90810 WP_003899407.1.90816 WP_003899407.1.90819 WP_003899407.1.9082 WP_003899407.1.90831 WP_003899407.1.90884 WP_003899407.1.90899 WP_003899407.1.90906 WP_003899407.1.90958 WP_003899407.1.90976 WP_003899407.1.90977 WP_003899407.1.90987 WP_003899407.1.9102 WP_003899407.1.91026 WP_003899407.1.91032 WP_003899407.1.91043 WP_003899407.1.91053 WP_003899407.1.91082 WP_003899407.1.91106 WP_003899407.1.91112 WP_003899407.1.91144 WP_003899407.1.91151 WP_003899407.1.91157 WP_003899407.1.91167 WP_003899407.1.91169 WP_003899407.1.91192 WP_003899407.1.91201 WP_003899407.1.91207 WP_003899407.1.91208 WP_003899407.1.91211 WP_003899407.1.91214 WP_003899407.1.91230 WP_003899407.1.91244 WP_003899407.1.91251 WP_003899407.1.91260 WP_003899407.1.91265 WP_003899407.1.9128 WP_003899407.1.91284 WP_003899407.1.91294 WP_003899407.1.91303 WP_003899407.1.91322 WP_003899407.1.91352 WP_003899407.1.91386 WP_003899407.1.9139 WP_003899407.1.91398 WP_003899407.1.91411 WP_003899407.1.91430 WP_003899407.1.91436 WP_003899407.1.91483 WP_003899407.1.91496 WP_003899407.1.91507 WP_003899407.1.91508 WP_003899407.1.91576 WP_003899407.1.91694 WP_003899407.1.91695 WP_003899407.1.91713 WP_003899407.1.91716 WP_003899407.1.91717 WP_003899407.1.91728 WP_003899407.1.91743 WP_003899407.1.91759 WP_003899407.1.91784 WP_003899407.1.91785 WP_003899407.1.91786 WP_003899407.1.91802 WP_003899407.1.91822 WP_003899407.1.91828 WP_003899407.1.9189 WP_003899407.1.91896 WP_003899407.1.9190 WP_003899407.1.91915 WP_003899407.1.91931 WP_003899407.1.91937 WP_003899407.1.91944 WP_003899407.1.91953 WP_003899407.1.91957 WP_003899407.1.91976 WP_003899407.1.91978 WP_003899407.1.92021 WP_003899407.1.92083 WP_003899407.1.92127 WP_003899407.1.92144 WP_003899407.1.92150 WP_003899407.1.92153 WP_003899407.1.92190 WP_003899407.1.92192 WP_003899407.1.92200 WP_003899407.1.92220 WP_003899407.1.92221 WP_003899407.1.92222 WP_003899407.1.92273 WP_003899407.1.92289 WP_003899407.1.9229 WP_003899407.1.92294 WP_003899407.1.92300 WP_003899407.1.92317 WP_003899407.1.92334 WP_003899407.1.92338 WP_003899407.1.92345 WP_003899407.1.92356 WP_003899407.1.92364 WP_003899407.1.92380 WP_003899407.1.92416 WP_003899407.1.92428 WP_003899407.1.92447 WP_003899407.1.92456 WP_003899407.1.92467 WP_003899407.1.92471 WP_003899407.1.92490 WP_003899407.1.92508 WP_003899407.1.9251 WP_003899407.1.92511 WP_003899407.1.92523 WP_003899407.1.92527 WP_003899407.1.92536 WP_003899407.1.92592 WP_003899407.1.92597 WP_003899407.1.92603 WP_003899407.1.92606 WP_003899407.1.92610 WP_003899407.1.92613 WP_003899407.1.9263 WP_003899407.1.9265 WP_003899407.1.92650 WP_003899407.1.92660 WP_003899407.1.92677 WP_003899407.1.92685 WP_003899407.1.92689 WP_003899407.1.92690 WP_003899407.1.92714 WP_003899407.1.92736 WP_003899407.1.9274 WP_003899407.1.92752 WP_003899407.1.92760 WP_003899407.1.92777 WP_003899407.1.92803 WP_003899407.1.92833 WP_003899407.1.92856 WP_003899407.1.92881 WP_003899407.1.92892 WP_003899407.1.92907 WP_003899407.1.92908 WP_003899407.1.9291 WP_003899407.1.92917 WP_003899407.1.92996 WP_003899407.1.93006 WP_003899407.1.93008 WP_003899407.1.93009 WP_003899407.1.93015 WP_003899407.1.93043 WP_003899407.1.9307 WP_003899407.1.93083 WP_003899407.1.93097 WP_003899407.1.93137 WP_003899407.1.93192 WP_003899407.1.93199 WP_003899407.1.93203 WP_003899407.1.93212 WP_003899407.1.93234 WP_003899407.1.93245 WP_003899407.1.93257 WP_003899407.1.93265 WP_003899407.1.93297 WP_003899407.1.93320 WP_003899407.1.93328 WP_003899407.1.93337 WP_003899407.1.93343 WP_003899407.1.93349 WP_003899407.1.93363 WP_003899407.1.93377 WP_003899407.1.9338 WP_003899407.1.93407 WP_003899407.1.93417 WP_003899407.1.93419 WP_003899407.1.93426 WP_003899407.1.9344 WP_003899407.1.93443 WP_003899407.1.93447 WP_003899407.1.93470 WP_003899407.1.93483 WP_003899407.1.93487 WP_003899407.1.93495 WP_003899407.1.93499 WP_003899407.1.93516 WP_003899407.1.93536 WP_003899407.1.93544 WP_003899407.1.93555 WP_003899407.1.93560 WP_003899407.1.93564 WP_003899407.1.9357 WP_003899407.1.93573 WP_003899407.1.93576 WP_003899407.1.93588 WP_003899407.1.9363 WP_003899407.1.93645 WP_003899407.1.93649 WP_003899407.1.93659 WP_003899407.1.93677 WP_003899407.1.9368 WP_003899407.1.93689 WP_003899407.1.93693 WP_003899407.1.93698 WP_003899407.1.93706 WP_003899407.1.9371 WP_003899407.1.93792 WP_003899407.1.93823 WP_003899407.1.93871 WP_003899407.1.9388 WP_003899407.1.93894 WP_003899407.1.93903 WP_003899407.1.93907 WP_003899407.1.93913 WP_003899407.1.93946 WP_003899407.1.93950 WP_003899407.1.93953 WP_003899407.1.93954 WP_003899407.1.93988 WP_003899407.1.9407 WP_003899407.1.94143 WP_003899407.1.94154 WP_003899407.1.94184 WP_003899407.1.94204 WP_003899407.1.94205 WP_003899407.1.94226 WP_003899407.1.94231 WP_003899407.1.94256 WP_003899407.1.94261 WP_003899407.1.94281 WP_003899407.1.94292 WP_003899407.1.94297 WP_003899407.1.9431 WP_003899407.1.94326 WP_003899407.1.94339 WP_003899407.1.94392 WP_003899407.1.94416 WP_003899407.1.94421 WP_003899407.1.94456 WP_003899407.1.94470 WP_003899407.1.94480 WP_003899407.1.94495 WP_003899407.1.94511 WP_003899407.1.94512 WP_003899407.1.94525 WP_003899407.1.94528 WP_003899407.1.94564 WP_003899407.1.946 WP_003899407.1.94602 WP_003899407.1.94623 WP_003899407.1.94629 WP_003899407.1.9465 WP_003899407.1.94673 WP_003899407.1.94714 WP_003899407.1.94730 WP_003899407.1.94736 WP_003899407.1.94776 WP_003899407.1.9478 WP_003899407.1.94834 WP_003899407.1.94852 WP_003899407.1.94872 WP_003899407.1.9488 WP_003899407.1.94902 WP_003899407.1.94916 WP_003899407.1.94979 WP_003899407.1.94994 WP_003899407.1.94996 WP_003899407.1.94998 WP_003899407.1.95007 WP_003899407.1.95010 WP_003899407.1.95015 WP_003899407.1.95034 WP_003899407.1.95068 WP_003899407.1.95081 WP_003899407.1.95082 WP_003899407.1.9509 WP_003899407.1.95096 WP_003899407.1.95112 WP_003899407.1.95138 WP_003899407.1.9514 WP_003899407.1.95179 WP_003899407.1.95188 WP_003899407.1.95190 WP_003899407.1.95234 WP_003899407.1.95241 WP_003899407.1.95245 WP_003899407.1.95257 WP_003899407.1.95279 WP_003899407.1.9531 WP_003899407.1.95335 WP_003899407.1.95344 WP_003899407.1.9535 WP_003899407.1.95370 WP_003899407.1.95392 WP_003899407.1.95416 WP_003899407.1.95417 WP_003899407.1.95454 WP_003899407.1.95455 WP_003899407.1.95491 WP_003899407.1.95497 WP_003899407.1.95508 WP_003899407.1.95509 WP_003899407.1.95529 WP_003899407.1.95556 WP_003899407.1.95557 WP_003899407.1.95565 WP_003899407.1.95578 WP_003899407.1.95580 WP_003899407.1.95585 WP_003899407.1.95643 WP_003899407.1.95679 WP_003899407.1.95685 WP_003899407.1.957 WP_003899407.1.95724 WP_003899407.1.95727 WP_003899407.1.95730 WP_003899407.1.95735 WP_003899407.1.95758 WP_003899407.1.95772 WP_003899407.1.95797 WP_003899407.1.95839 WP_003899407.1.9585 WP_003899407.1.9590 WP_003899407.1.95902 WP_003899407.1.95908 WP_003899407.1.95924 WP_003899407.1.95926 WP_003899407.1.95953 WP_003899407.1.95958 WP_003899407.1.95964 WP_003899407.1.95973 WP_003899407.1.96006 WP_003899407.1.9602 WP_003899407.1.96036 WP_003899407.1.96062 WP_003899407.1.96065 WP_003899407.1.96098 WP_003899407.1.96146 WP_003899407.1.96166 WP_003899407.1.96171 WP_003899407.1.96182 WP_003899407.1.96204 WP_003899407.1.96230 WP_003899407.1.96235 WP_003899407.1.96242 WP_003899407.1.96245 WP_003899407.1.96254 WP_003899407.1.96259 WP_003899407.1.96286 WP_003899407.1.96313 WP_003899407.1.96318 WP_003899407.1.96345 WP_003899407.1.96360 WP_003899407.1.96373 WP_003899407.1.96456 WP_003899407.1.96486 WP_003899407.1.96560 WP_003899407.1.96569 WP_003899407.1.96573 WP_003899407.1.96575 WP_003899407.1.96576 WP_003899407.1.96611 WP_003899407.1.96621 WP_003899407.1.9667 WP_003899407.1.96681 WP_003899407.1.96726 WP_003899407.1.96733 WP_003899407.1.96742 WP_003899407.1.96754 WP_003899407.1.9678 WP_003899407.1.96832 WP_003899407.1.9685 WP_003899407.1.97008 WP_003899407.1.97009 WP_003899407.1.97056 WP_003899407.1.97084 WP_003899407.1.97087 WP_003899407.1.97094 WP_003899407.1.97096 WP_003899407.1.97099 WP_003899407.1.97108 WP_003899407.1.97113 WP_003899407.1.97122 WP_003899407.1.97127 WP_003899407.1.97129 WP_003899407.1.97136 WP_003899407.1.9716 WP_003899407.1.97176 WP_003899407.1.97222 WP_003899407.1.97223 WP_003899407.1.97237 WP_003899407.1.97242 WP_003899407.1.97270 WP_003899407.1.97283 WP_003899407.1.97296 WP_003899407.1.97321 WP_003899407.1.97325 WP_003899407.1.97366 WP_003899407.1.97376 WP_003899407.1.97380 WP_003899407.1.9739 WP_003899407.1.97462 WP_003899407.1.97517 WP_003899407.1.97519 WP_003899407.1.97535 WP_003899407.1.97540 WP_003899407.1.97545 WP_003899407.1.97546 WP_003899407.1.97550 WP_003899407.1.97568 WP_003899407.1.97577 WP_003899407.1.97584 WP_003899407.1.9759 WP_003899407.1.97591 WP_003899407.1.97596 WP_003899407.1.97609 WP_003899407.1.97618 WP_003899407.1.9763 WP_003899407.1.97669 WP_003899407.1.97673 WP_003899407.1.97700 WP_003899407.1.97701 WP_003899407.1.9773 WP_003899407.1.97730 WP_003899407.1.97740 WP_003899407.1.97751 WP_003899407.1.97754 WP_003899407.1.97797 WP_003899407.1.9782 WP_003899407.1.9784 WP_003899407.1.97888 WP_003899407.1.9790 WP_003899407.1.9795 WP_003899407.1.97951 WP_003899407.1.97958 WP_003899407.1.97966 WP_003899407.1.97977 WP_003899407.1.97979 WP_003899407.1.97995 WP_003899407.1.98018 WP_003899407.1.98034 WP_003899407.1.98052 WP_003899407.1.98071 WP_003899407.1.98072 WP_003899407.1.98113 WP_003899407.1.98114 WP_003899407.1.98128 WP_003899407.1.98181 WP_003899407.1.98188 WP_003899407.1.98189 WP_003899407.1.98213 WP_003899407.1.98225 WP_003899407.1.98291 WP_003899407.1.98335 WP_003899407.1.98350 WP_003899407.1.98395 WP_003899407.1.98412 WP_003899407.1.98441 WP_003899407.1.98443 WP_003899407.1.98462 WP_003899407.1.9848 WP_003899407.1.98482 WP_003899407.1.98486 WP_003899407.1.98488 WP_003899407.1.98503 WP_003899407.1.98516 WP_003899407.1.98524 WP_003899407.1.98536 WP_003899407.1.98541 WP_003899407.1.98566 WP_003899407.1.98576 WP_003899407.1.98590 WP_003899407.1.98594 WP_003899407.1.98599 WP_003899407.1.98629 WP_003899407.1.98645 WP_003899407.1.98646 WP_003899407.1.98649 WP_003899407.1.98656 WP_003899407.1.9867 WP_003899407.1.98674 WP_003899407.1.98697 WP_003899407.1.98701 WP_003899407.1.98739 WP_003899407.1.98749 WP_003899407.1.98765 WP_003899407.1.98770 WP_003899407.1.98777 WP_003899407.1.98778 WP_003899407.1.98802 WP_003899407.1.98838 WP_003899407.1.98850 WP_003899407.1.98906 WP_003899407.1.98935 WP_003899407.1.98948 WP_003899407.1.98953 WP_003899407.1.98984 WP_003899407.1.99000 WP_003899407.1.99023 WP_003899407.1.99030 WP_003899407.1.99037 WP_003899407.1.99055 WP_003899407.1.99062 WP_003899407.1.99086 WP_003899407.1.99115 WP_003899407.1.99117 WP_003899407.1.99161 WP_003899407.1.99176 WP_003899407.1.99205 WP_003899407.1.99211 WP_003899407.1.99216 WP_003899407.1.99222 WP_003899407.1.99251 WP_003899407.1.99269 WP_003899407.1.99294 WP_003899407.1.99312 WP_003899407.1.99315 WP_003899407.1.99316 WP_003899407.1.99322 WP_003899407.1.99328 WP_003899407.1.99365 WP_003899407.1.99368 WP_003899407.1.99379 WP_003899407.1.99396 WP_003899407.1.99402 WP_003899407.1.99404 WP_003899407.1.99419 WP_003899407.1.99438 WP_003899407.1.99460 WP_003899407.1.99468 WP_003899407.1.99473 WP_003899407.1.99513 WP_003899407.1.99529 WP_003899407.1.99548 WP_003899407.1.99572 WP_003899407.1.99575 WP_003899407.1.99578 WP_003899407.1.99605 WP_003899407.1.99609 WP_003899407.1.99617 WP_003899407.1.99635 WP_003899407.1.99650 WP_003899407.1.99672 WP_003899407.1.99701 WP_003899407.1.99711 WP_003899407.1.99716 WP_003899407.1.99740 WP_003899407.1.99745 WP_003899407.1.99749 WP_003899407.1.9976 WP_003899407.1.99798 WP_003899407.1.99817 WP_003899407.1.99832 WP_003899407.1.99847 WP_003899407.1.99852 WP_003899407.1.99886 WP_003899407.1.99897 WP_003899407.1.99899 WP_003899407.1.99915 WP_003899407.1.9993 WP_003899407.1.99982 WP_003899407.1.99991 gi|148823835|ref|YP_001288589.1| gi|506927182|ref|YP_008007632.1| gi|433642846|ref|YP_007288605.1| gi|224991025|ref|YP_002645712.1| gi|471338650|ref|YP_007611363.1| gi|197738299|ref|YP_002159614.1| gi|449064723|ref|YP_007431806.1| gi|121638531|ref|YP_978755.1| gi|253798274|ref|YP_003031275.1| gi|31793828|ref|NP_856321.1| gi|392431749|ref|YP_006472793.1| gi|15609779|ref|NP_217158.1| gi|433635724|ref|YP_007269351.1| gi|148662483|ref|YP_001284006.1| gi|479056607|ref|YP_007352413.1| gi|375295541|ref|YP_005099808.1| gi|386005535|ref|YP_005923814.1| 233413.Mb2675 336982.TBFG_12660 410289.BCG_2669 419947.MRA_2671 478434.TBMG_01329 561275.JTY_2663 83332.Rv2642 gi|340627663|ref|YP_004746115.1| gi|433627780|ref|YP_007261409.1| gi|479315597|ref|YP_007855649.1| Rv2642 rv2642 gi|494693118|ref|YP_007958661.1| gi|383308410|ref|YP_005361221.1| gi|339632669|ref|YP_004724311.1| gi|494701079|ref|YP_007966561.1| gi|378772386|ref|YP_005172119.1| gi|392387278|ref|YP_005308907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]