SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197738517|ref|YP_002159833.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197738517|ref|YP_002159833.1|
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.26e-28
Family MarR-like transcriptional regulators 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197738517|ref|YP_002159833.1|
Sequence length 139
Comment transcriptional regulator [Mycobacterium tuberculosis str. Haarlem]
Sequence
MGLADDAPLGYLLYRVGAVLRPEVSAALSPLGLTLPEFVCLRMLSQSPGLSSAELARHAS
VTPQAMNTVLRKLEDAGAVARPASVSSGRSLPATLTARGRALAKRAEAVVRAADARVLAR
LTAPQQREFKRMLEKLGSD
Download sequence
Identical sequences A0A045IEF6 A0A083VZ87 A0A0H3LCY8 A0A0H3MDL1 A0A0K2I0F2 A0A109SRD6 A0A109T036 A0A197ITB1 A0A1S1B6S5 A5U6P2 F8M4B2 G0TFV3 I6XFK8 P67748 P9WME8 P9WME9
gi|224991260|ref|YP_002645949.1| gi|433628006|ref|YP_007261635.1| gi|506927429|ref|YP_008007880.1| gi|375295294|ref|YP_005099561.1| gi|148662731|ref|YP_001284254.1| gi|392431501|ref|YP_006472545.1| gi|15842429|ref|NP_337466.1| gi|449064964|ref|YP_007432047.1| gi|339632894|ref|YP_004724536.1| gi|383308638|ref|YP_005361449.1| gi|494701324|ref|YP_007966806.1| gi|479315847|ref|YP_007855899.1| gi|378772624|ref|YP_005172357.1| gi|386005752|ref|YP_005924031.1| gi|525675396|ref|YP_008226981.1| gi|433635953|ref|YP_007269580.1| gi|31794063|ref|NP_856556.1| gi|385992148|ref|YP_005910446.1| gi|253798025|ref|YP_003031026.1| gi|433643079|ref|YP_007288838.1| NP_217403.1.84033 WP_003899525.1.100000 WP_003899525.1.100021 WP_003899525.1.100069 WP_003899525.1.100087 WP_003899525.1.10015 WP_003899525.1.100208 WP_003899525.1.100216 WP_003899525.1.10022 WP_003899525.1.100255 WP_003899525.1.100260 WP_003899525.1.100270 WP_003899525.1.100279 WP_003899525.1.100286 WP_003899525.1.100308 WP_003899525.1.100309 WP_003899525.1.100318 WP_003899525.1.100337 WP_003899525.1.100338 WP_003899525.1.10037 WP_003899525.1.100383 WP_003899525.1.100395 WP_003899525.1.100396 WP_003899525.1.1004 WP_003899525.1.100401 WP_003899525.1.100459 WP_003899525.1.100460 WP_003899525.1.100552 WP_003899525.1.100581 WP_003899525.1.100600 WP_003899525.1.100625 WP_003899525.1.10064 WP_003899525.1.100666 WP_003899525.1.100671 WP_003899525.1.100677 WP_003899525.1.100682 WP_003899525.1.100697 WP_003899525.1.100703 WP_003899525.1.100716 WP_003899525.1.100722 WP_003899525.1.100754 WP_003899525.1.100757 WP_003899525.1.100772 WP_003899525.1.1008 WP_003899525.1.100812 WP_003899525.1.100866 WP_003899525.1.10088 WP_003899525.1.100889 WP_003899525.1.10090 WP_003899525.1.100910 WP_003899525.1.100915 WP_003899525.1.100918 WP_003899525.1.100935 WP_003899525.1.100984 WP_003899525.1.100992 WP_003899525.1.100998 WP_003899525.1.101 WP_003899525.1.101025 WP_003899525.1.101028 WP_003899525.1.10104 WP_003899525.1.101048 WP_003899525.1.101054 WP_003899525.1.101075 WP_003899525.1.101143 WP_003899525.1.101146 WP_003899525.1.10116 WP_003899525.1.10117 WP_003899525.1.101209 WP_003899525.1.10125 WP_003899525.1.101290 WP_003899525.1.101323 WP_003899525.1.101324 WP_003899525.1.101350 WP_003899525.1.101367 WP_003899525.1.101398 WP_003899525.1.101403 WP_003899525.1.101421 WP_003899525.1.10144 WP_003899525.1.101442 WP_003899525.1.10145 WP_003899525.1.101452 WP_003899525.1.101456 WP_003899525.1.101481 WP_003899525.1.101493 WP_003899525.1.101496 WP_003899525.1.101525 WP_003899525.1.101533 WP_003899525.1.101535 WP_003899525.1.101553 WP_003899525.1.101558 WP_003899525.1.10156 WP_003899525.1.101573 WP_003899525.1.101576 WP_003899525.1.10159 WP_003899525.1.101592 WP_003899525.1.101604 WP_003899525.1.101607 WP_003899525.1.101622 WP_003899525.1.101644 WP_003899525.1.101659 WP_003899525.1.101671 WP_003899525.1.101687 WP_003899525.1.101698 WP_003899525.1.10170 WP_003899525.1.101713 WP_003899525.1.101722 WP_003899525.1.101733 WP_003899525.1.101743 WP_003899525.1.101753 WP_003899525.1.101754 WP_003899525.1.101764 WP_003899525.1.101773 WP_003899525.1.101795 WP_003899525.1.101797 WP_003899525.1.101798 WP_003899525.1.101802 WP_003899525.1.101826 WP_003899525.1.101836 WP_003899525.1.101858 WP_003899525.1.101859 WP_003899525.1.101862 WP_003899525.1.101888 WP_003899525.1.101894 WP_003899525.1.101899 WP_003899525.1.1019 WP_003899525.1.101923 WP_003899525.1.101925 WP_003899525.1.10193 WP_003899525.1.101996 WP_003899525.1.102 WP_003899525.1.102008 WP_003899525.1.102017 WP_003899525.1.102053 WP_003899525.1.102055 WP_003899525.1.102063 WP_003899525.1.102099 WP_003899525.1.1021 WP_003899525.1.10211 WP_003899525.1.102119 WP_003899525.1.102121 WP_003899525.1.102143 WP_003899525.1.10216 WP_003899525.1.10224 WP_003899525.1.10253 WP_003899525.1.10262 WP_003899525.1.10272 WP_003899525.1.10277 WP_003899525.1.1033 WP_003899525.1.10350 WP_003899525.1.10362 WP_003899525.1.10366 WP_003899525.1.10376 WP_003899525.1.10396 WP_003899525.1.10410 WP_003899525.1.10414 WP_003899525.1.10421 WP_003899525.1.10430 WP_003899525.1.1044 WP_003899525.1.10440 WP_003899525.1.10471 WP_003899525.1.10472 WP_003899525.1.10489 WP_003899525.1.105 WP_003899525.1.10518 WP_003899525.1.10523 WP_003899525.1.10545 WP_003899525.1.1057 WP_003899525.1.10594 WP_003899525.1.10603 WP_003899525.1.10606 WP_003899525.1.10615 WP_003899525.1.10623 WP_003899525.1.10635 WP_003899525.1.10643 WP_003899525.1.10648 WP_003899525.1.10662 WP_003899525.1.10709 WP_003899525.1.10735 WP_003899525.1.10740 WP_003899525.1.10756 WP_003899525.1.1078 WP_003899525.1.10791 WP_003899525.1.10799 WP_003899525.1.10825 WP_003899525.1.10848 WP_003899525.1.10863 WP_003899525.1.10879 WP_003899525.1.10912 WP_003899525.1.10916 WP_003899525.1.10923 WP_003899525.1.10927 WP_003899525.1.1095 WP_003899525.1.10956 WP_003899525.1.10958 WP_003899525.1.10962 WP_003899525.1.10980 WP_003899525.1.10981 WP_003899525.1.10993 WP_003899525.1.1100 WP_003899525.1.11040 WP_003899525.1.11061 WP_003899525.1.11070 WP_003899525.1.11141 WP_003899525.1.11171 WP_003899525.1.11175 WP_003899525.1.11176 WP_003899525.1.11222 WP_003899525.1.11236 WP_003899525.1.11329 WP_003899525.1.1133 WP_003899525.1.11342 WP_003899525.1.11373 WP_003899525.1.11376 WP_003899525.1.11390 WP_003899525.1.11402 WP_003899525.1.11481 WP_003899525.1.11487 WP_003899525.1.11489 WP_003899525.1.11491 WP_003899525.1.11514 WP_003899525.1.11587 WP_003899525.1.11589 WP_003899525.1.11596 WP_003899525.1.11604 WP_003899525.1.11610 WP_003899525.1.11697 WP_003899525.1.11707 WP_003899525.1.11752 WP_003899525.1.11758 WP_003899525.1.11761 WP_003899525.1.11775 WP_003899525.1.11804 WP_003899525.1.11822 WP_003899525.1.11826 WP_003899525.1.11856 WP_003899525.1.11898 WP_003899525.1.11906 WP_003899525.1.11939 WP_003899525.1.11960 WP_003899525.1.11961 WP_003899525.1.11972 WP_003899525.1.11984 WP_003899525.1.120 WP_003899525.1.12001 WP_003899525.1.12049 WP_003899525.1.12052 WP_003899525.1.12100 WP_003899525.1.12116 WP_003899525.1.12130 WP_003899525.1.12133 WP_003899525.1.12161 WP_003899525.1.12165 WP_003899525.1.12184 WP_003899525.1.12187 WP_003899525.1.12190 WP_003899525.1.12216 WP_003899525.1.12265 WP_003899525.1.12275 WP_003899525.1.12293 WP_003899525.1.12294 WP_003899525.1.123 WP_003899525.1.1231 WP_003899525.1.12314 WP_003899525.1.12327 WP_003899525.1.1236 WP_003899525.1.12371 WP_003899525.1.12372 WP_003899525.1.12389 WP_003899525.1.12406 WP_003899525.1.1241 WP_003899525.1.12421 WP_003899525.1.12424 WP_003899525.1.12446 WP_003899525.1.12464 WP_003899525.1.12479 WP_003899525.1.12519 WP_003899525.1.12523 WP_003899525.1.12526 WP_003899525.1.1255 WP_003899525.1.12550 WP_003899525.1.12551 WP_003899525.1.12563 WP_003899525.1.12611 WP_003899525.1.12669 WP_003899525.1.1267 WP_003899525.1.12672 WP_003899525.1.12692 WP_003899525.1.1271 WP_003899525.1.12710 WP_003899525.1.12768 WP_003899525.1.1279 WP_003899525.1.12794 WP_003899525.1.12801 WP_003899525.1.12804 WP_003899525.1.12821 WP_003899525.1.12841 WP_003899525.1.12854 WP_003899525.1.12901 WP_003899525.1.12941 WP_003899525.1.12947 WP_003899525.1.12957 WP_003899525.1.12972 WP_003899525.1.13028 WP_003899525.1.13043 WP_003899525.1.13086 WP_003899525.1.13087 WP_003899525.1.13090 WP_003899525.1.13096 WP_003899525.1.13163 WP_003899525.1.13175 WP_003899525.1.13183 WP_003899525.1.132 WP_003899525.1.13249 WP_003899525.1.13282 WP_003899525.1.13284 WP_003899525.1.13296 WP_003899525.1.13298 WP_003899525.1.13302 WP_003899525.1.13306 WP_003899525.1.13312 WP_003899525.1.13313 WP_003899525.1.13321 WP_003899525.1.13345 WP_003899525.1.13358 WP_003899525.1.13370 WP_003899525.1.13375 WP_003899525.1.1338 WP_003899525.1.13420 WP_003899525.1.13433 WP_003899525.1.13435 WP_003899525.1.13438 WP_003899525.1.13461 WP_003899525.1.13466 WP_003899525.1.13489 WP_003899525.1.13526 WP_003899525.1.13551 WP_003899525.1.13561 WP_003899525.1.13564 WP_003899525.1.13579 WP_003899525.1.13647 WP_003899525.1.13667 WP_003899525.1.13687 WP_003899525.1.13697 WP_003899525.1.13719 WP_003899525.1.13763 WP_003899525.1.1377 WP_003899525.1.13774 WP_003899525.1.13786 WP_003899525.1.13793 WP_003899525.1.13794 WP_003899525.1.13817 WP_003899525.1.13834 WP_003899525.1.13866 WP_003899525.1.13880 WP_003899525.1.13899 WP_003899525.1.13909 WP_003899525.1.13910 WP_003899525.1.13919 WP_003899525.1.13920 WP_003899525.1.13952 WP_003899525.1.13953 WP_003899525.1.13962 WP_003899525.1.1398 WP_003899525.1.13988 WP_003899525.1.14027 WP_003899525.1.14046 WP_003899525.1.14115 WP_003899525.1.1415 WP_003899525.1.14152 WP_003899525.1.14158 WP_003899525.1.14162 WP_003899525.1.14175 WP_003899525.1.14178 WP_003899525.1.14194 WP_003899525.1.14195 WP_003899525.1.14208 WP_003899525.1.14238 WP_003899525.1.14266 WP_003899525.1.14273 WP_003899525.1.14303 WP_003899525.1.14306 WP_003899525.1.14307 WP_003899525.1.14310 WP_003899525.1.14341 WP_003899525.1.14382 WP_003899525.1.14416 WP_003899525.1.14428 WP_003899525.1.14441 WP_003899525.1.14469 WP_003899525.1.14477 WP_003899525.1.14504 WP_003899525.1.14514 WP_003899525.1.1452 WP_003899525.1.14527 WP_003899525.1.1454 WP_003899525.1.14544 WP_003899525.1.14548 WP_003899525.1.14551 WP_003899525.1.14561 WP_003899525.1.14573 WP_003899525.1.1462 WP_003899525.1.14658 WP_003899525.1.14667 WP_003899525.1.14668 WP_003899525.1.14694 WP_003899525.1.14695 WP_003899525.1.14709 WP_003899525.1.14766 WP_003899525.1.14783 WP_003899525.1.14865 WP_003899525.1.14872 WP_003899525.1.14905 WP_003899525.1.14926 WP_003899525.1.14951 WP_003899525.1.14955 WP_003899525.1.15003 WP_003899525.1.15009 WP_003899525.1.15028 WP_003899525.1.15040 WP_003899525.1.15052 WP_003899525.1.15065 WP_003899525.1.15072 WP_003899525.1.15089 WP_003899525.1.1509 WP_003899525.1.15126 WP_003899525.1.15131 WP_003899525.1.15168 WP_003899525.1.15172 WP_003899525.1.15174 WP_003899525.1.15187 WP_003899525.1.15196 WP_003899525.1.15210 WP_003899525.1.15216 WP_003899525.1.15217 WP_003899525.1.1523 WP_003899525.1.15232 WP_003899525.1.15238 WP_003899525.1.15240 WP_003899525.1.15253 WP_003899525.1.15267 WP_003899525.1.1527 WP_003899525.1.15292 WP_003899525.1.15299 WP_003899525.1.15302 WP_003899525.1.15322 WP_003899525.1.1534 WP_003899525.1.15345 WP_003899525.1.15365 WP_003899525.1.15372 WP_003899525.1.15386 WP_003899525.1.15387 WP_003899525.1.15442 WP_003899525.1.15447 WP_003899525.1.15449 WP_003899525.1.15481 WP_003899525.1.15492 WP_003899525.1.15511 WP_003899525.1.15512 WP_003899525.1.15558 WP_003899525.1.15559 WP_003899525.1.15566 WP_003899525.1.15599 WP_003899525.1.1560 WP_003899525.1.15611 WP_003899525.1.1563 WP_003899525.1.15633 WP_003899525.1.15643 WP_003899525.1.15688 WP_003899525.1.15755 WP_003899525.1.15763 WP_003899525.1.15774 WP_003899525.1.1578 WP_003899525.1.15780 WP_003899525.1.15827 WP_003899525.1.15834 WP_003899525.1.15842 WP_003899525.1.15848 WP_003899525.1.15853 WP_003899525.1.15870 WP_003899525.1.15877 WP_003899525.1.15893 WP_003899525.1.15896 WP_003899525.1.15926 WP_003899525.1.15933 WP_003899525.1.15946 WP_003899525.1.15958 WP_003899525.1.15973 WP_003899525.1.15987 WP_003899525.1.15993 WP_003899525.1.16009 WP_003899525.1.16025 WP_003899525.1.16043 WP_003899525.1.16055 WP_003899525.1.16066 WP_003899525.1.16069 WP_003899525.1.16077 WP_003899525.1.16106 WP_003899525.1.16108 WP_003899525.1.16110 WP_003899525.1.16130 WP_003899525.1.16136 WP_003899525.1.16139 WP_003899525.1.16141 WP_003899525.1.16143 WP_003899525.1.1630 WP_003899525.1.16318 WP_003899525.1.1632 WP_003899525.1.16327 WP_003899525.1.16334 WP_003899525.1.16341 WP_003899525.1.16345 WP_003899525.1.16374 WP_003899525.1.16384 WP_003899525.1.16386 WP_003899525.1.164 WP_003899525.1.1642 WP_003899525.1.16421 WP_003899525.1.16424 WP_003899525.1.16426 WP_003899525.1.16438 WP_003899525.1.1644 WP_003899525.1.16442 WP_003899525.1.16448 WP_003899525.1.16451 WP_003899525.1.16476 WP_003899525.1.16480 WP_003899525.1.16494 WP_003899525.1.1652 WP_003899525.1.16549 WP_003899525.1.16560 WP_003899525.1.16598 WP_003899525.1.16609 WP_003899525.1.16619 WP_003899525.1.16620 WP_003899525.1.16622 WP_003899525.1.16637 WP_003899525.1.1669 WP_003899525.1.16707 WP_003899525.1.16724 WP_003899525.1.16731 WP_003899525.1.16743 WP_003899525.1.1683 WP_003899525.1.16837 WP_003899525.1.16852 WP_003899525.1.16937 WP_003899525.1.16940 WP_003899525.1.16950 WP_003899525.1.16959 WP_003899525.1.16968 WP_003899525.1.1697 WP_003899525.1.16973 WP_003899525.1.16977 WP_003899525.1.16987 WP_003899525.1.17005 WP_003899525.1.17006 WP_003899525.1.17010 WP_003899525.1.17015 WP_003899525.1.17019 WP_003899525.1.17039 WP_003899525.1.17041 WP_003899525.1.17052 WP_003899525.1.17057 WP_003899525.1.17062 WP_003899525.1.1707 WP_003899525.1.17094 WP_003899525.1.17130 WP_003899525.1.17138 WP_003899525.1.17147 WP_003899525.1.17167 WP_003899525.1.17224 WP_003899525.1.17251 WP_003899525.1.17288 WP_003899525.1.17304 WP_003899525.1.17314 WP_003899525.1.17345 WP_003899525.1.17391 WP_003899525.1.17412 WP_003899525.1.1743 WP_003899525.1.17440 WP_003899525.1.17466 WP_003899525.1.17477 WP_003899525.1.17483 WP_003899525.1.17505 WP_003899525.1.17527 WP_003899525.1.17535 WP_003899525.1.17540 WP_003899525.1.17553 WP_003899525.1.17558 WP_003899525.1.17599 WP_003899525.1.17635 WP_003899525.1.17655 WP_003899525.1.17679 WP_003899525.1.1768 WP_003899525.1.17687 WP_003899525.1.17700 WP_003899525.1.17710 WP_003899525.1.17713 WP_003899525.1.17722 WP_003899525.1.17746 WP_003899525.1.17788 WP_003899525.1.17798 WP_003899525.1.17803 WP_003899525.1.17816 WP_003899525.1.17821 WP_003899525.1.17830 WP_003899525.1.17868 WP_003899525.1.17878 WP_003899525.1.1792 WP_003899525.1.17923 WP_003899525.1.1795 WP_003899525.1.17955 WP_003899525.1.17973 WP_003899525.1.18009 WP_003899525.1.18013 WP_003899525.1.18033 WP_003899525.1.18057 WP_003899525.1.18065 WP_003899525.1.18070 WP_003899525.1.18116 WP_003899525.1.18120 WP_003899525.1.18126 WP_003899525.1.1817 WP_003899525.1.18170 WP_003899525.1.18206 WP_003899525.1.18216 WP_003899525.1.18240 WP_003899525.1.18257 WP_003899525.1.18297 WP_003899525.1.18306 WP_003899525.1.18364 WP_003899525.1.18399 WP_003899525.1.18411 WP_003899525.1.18444 WP_003899525.1.18448 WP_003899525.1.18467 WP_003899525.1.18476 WP_003899525.1.18522 WP_003899525.1.18580 WP_003899525.1.18582 WP_003899525.1.18587 WP_003899525.1.186 WP_003899525.1.18601 WP_003899525.1.18639 WP_003899525.1.18646 WP_003899525.1.18647 WP_003899525.1.1868 WP_003899525.1.18694 WP_003899525.1.18710 WP_003899525.1.18751 WP_003899525.1.18781 WP_003899525.1.18793 WP_003899525.1.18804 WP_003899525.1.18816 WP_003899525.1.18823 WP_003899525.1.18827 WP_003899525.1.18838 WP_003899525.1.18849 WP_003899525.1.18856 WP_003899525.1.18945 WP_003899525.1.1898 WP_003899525.1.19005 WP_003899525.1.19056 WP_003899525.1.19063 WP_003899525.1.19066 WP_003899525.1.19071 WP_003899525.1.19085 WP_003899525.1.19094 WP_003899525.1.19144 WP_003899525.1.19159 WP_003899525.1.19193 WP_003899525.1.19231 WP_003899525.1.19243 WP_003899525.1.19264 WP_003899525.1.19295 WP_003899525.1.19307 WP_003899525.1.19326 WP_003899525.1.1933 WP_003899525.1.19364 WP_003899525.1.19382 WP_003899525.1.19400 WP_003899525.1.19426 WP_003899525.1.19429 WP_003899525.1.19464 WP_003899525.1.19480 WP_003899525.1.19512 WP_003899525.1.19553 WP_003899525.1.19562 WP_003899525.1.19564 WP_003899525.1.19568 WP_003899525.1.19572 WP_003899525.1.19595 WP_003899525.1.19596 WP_003899525.1.19600 WP_003899525.1.19630 WP_003899525.1.1967 WP_003899525.1.19694 WP_003899525.1.1970 WP_003899525.1.19707 WP_003899525.1.19742 WP_003899525.1.19785 WP_003899525.1.19820 WP_003899525.1.19868 WP_003899525.1.19874 WP_003899525.1.19890 WP_003899525.1.19900 WP_003899525.1.19922 WP_003899525.1.19936 WP_003899525.1.19946 WP_003899525.1.19949 WP_003899525.1.19960 WP_003899525.1.19964 WP_003899525.1.20007 WP_003899525.1.20016 WP_003899525.1.20028 WP_003899525.1.2003 WP_003899525.1.20037 WP_003899525.1.20039 WP_003899525.1.20082 WP_003899525.1.20085 WP_003899525.1.20097 WP_003899525.1.20116 WP_003899525.1.20130 WP_003899525.1.20140 WP_003899525.1.20141 WP_003899525.1.20142 WP_003899525.1.20158 WP_003899525.1.20239 WP_003899525.1.20243 WP_003899525.1.20259 WP_003899525.1.20262 WP_003899525.1.20268 WP_003899525.1.20272 WP_003899525.1.20273 WP_003899525.1.20280 WP_003899525.1.20294 WP_003899525.1.20300 WP_003899525.1.20309 WP_003899525.1.20322 WP_003899525.1.2037 WP_003899525.1.20372 WP_003899525.1.20381 WP_003899525.1.204 WP_003899525.1.20427 WP_003899525.1.20432 WP_003899525.1.20457 WP_003899525.1.20459 WP_003899525.1.20542 WP_003899525.1.20578 WP_003899525.1.20608 WP_003899525.1.20624 WP_003899525.1.20628 WP_003899525.1.2066 WP_003899525.1.20707 WP_003899525.1.20722 WP_003899525.1.20729 WP_003899525.1.20742 WP_003899525.1.20751 WP_003899525.1.20776 WP_003899525.1.20843 WP_003899525.1.20850 WP_003899525.1.2086 WP_003899525.1.20868 WP_003899525.1.20876 WP_003899525.1.20897 WP_003899525.1.20898 WP_003899525.1.2090 WP_003899525.1.20911 WP_003899525.1.20916 WP_003899525.1.20921 WP_003899525.1.20926 WP_003899525.1.20927 WP_003899525.1.20951 WP_003899525.1.20970 WP_003899525.1.2104 WP_003899525.1.21070 WP_003899525.1.21127 WP_003899525.1.21135 WP_003899525.1.21173 WP_003899525.1.21187 WP_003899525.1.212 WP_003899525.1.2120 WP_003899525.1.21218 WP_003899525.1.21219 WP_003899525.1.2123 WP_003899525.1.21231 WP_003899525.1.21234 WP_003899525.1.2126 WP_003899525.1.21292 WP_003899525.1.21307 WP_003899525.1.2131 WP_003899525.1.21311 WP_003899525.1.21321 WP_003899525.1.21365 WP_003899525.1.2137 WP_003899525.1.21392 WP_003899525.1.21397 WP_003899525.1.21403 WP_003899525.1.21415 WP_003899525.1.21418 WP_003899525.1.21430 WP_003899525.1.21434 WP_003899525.1.21444 WP_003899525.1.21468 WP_003899525.1.21498 WP_003899525.1.21509 WP_003899525.1.21513 WP_003899525.1.21560 WP_003899525.1.21565 WP_003899525.1.21586 WP_003899525.1.21591 WP_003899525.1.21602 WP_003899525.1.21615 WP_003899525.1.21638 WP_003899525.1.21639 WP_003899525.1.21655 WP_003899525.1.21658 WP_003899525.1.2168 WP_003899525.1.2174 WP_003899525.1.21741 WP_003899525.1.21742 WP_003899525.1.21777 WP_003899525.1.21786 WP_003899525.1.21795 WP_003899525.1.218 WP_003899525.1.21826 WP_003899525.1.21829 WP_003899525.1.21840 WP_003899525.1.21843 WP_003899525.1.21872 WP_003899525.1.21873 WP_003899525.1.2188 WP_003899525.1.21882 WP_003899525.1.21906 WP_003899525.1.21912 WP_003899525.1.2194 WP_003899525.1.21941 WP_003899525.1.21956 WP_003899525.1.21958 WP_003899525.1.21960 WP_003899525.1.21973 WP_003899525.1.21983 WP_003899525.1.22003 WP_003899525.1.22013 WP_003899525.1.22025 WP_003899525.1.22036 WP_003899525.1.22075 WP_003899525.1.22092 WP_003899525.1.2212 WP_003899525.1.22127 WP_003899525.1.22140 WP_003899525.1.22233 WP_003899525.1.22255 WP_003899525.1.22277 WP_003899525.1.22305 WP_003899525.1.22348 WP_003899525.1.22356 WP_003899525.1.22366 WP_003899525.1.2238 WP_003899525.1.22380 WP_003899525.1.22437 WP_003899525.1.22438 WP_003899525.1.22445 WP_003899525.1.22490 WP_003899525.1.22511 WP_003899525.1.22524 WP_003899525.1.2253 WP_003899525.1.22585 WP_003899525.1.22589 WP_003899525.1.22606 WP_003899525.1.22608 WP_003899525.1.22609 WP_003899525.1.22618 WP_003899525.1.2262 WP_003899525.1.22624 WP_003899525.1.22629 WP_003899525.1.22647 WP_003899525.1.22665 WP_003899525.1.22670 WP_003899525.1.22674 WP_003899525.1.22680 WP_003899525.1.22725 WP_003899525.1.22728 WP_003899525.1.22733 WP_003899525.1.22737 WP_003899525.1.2275 WP_003899525.1.22754 WP_003899525.1.22800 WP_003899525.1.22804 WP_003899525.1.22840 WP_003899525.1.22844 WP_003899525.1.22963 WP_003899525.1.22970 WP_003899525.1.22996 WP_003899525.1.22997 WP_003899525.1.22999 WP_003899525.1.23015 WP_003899525.1.23032 WP_003899525.1.231 WP_003899525.1.23101 WP_003899525.1.2312 WP_003899525.1.23140 WP_003899525.1.23153 WP_003899525.1.23171 WP_003899525.1.23199 WP_003899525.1.2320 WP_003899525.1.23204 WP_003899525.1.23216 WP_003899525.1.23229 WP_003899525.1.23233 WP_003899525.1.2326 WP_003899525.1.23261 WP_003899525.1.23272 WP_003899525.1.23289 WP_003899525.1.2329 WP_003899525.1.23308 WP_003899525.1.23316 WP_003899525.1.23321 WP_003899525.1.23325 WP_003899525.1.2339 WP_003899525.1.23406 WP_003899525.1.23445 WP_003899525.1.23447 WP_003899525.1.23452 WP_003899525.1.23461 WP_003899525.1.2349 WP_003899525.1.23496 WP_003899525.1.23497 WP_003899525.1.23506 WP_003899525.1.23539 WP_003899525.1.23546 WP_003899525.1.23551 WP_003899525.1.23573 WP_003899525.1.23583 WP_003899525.1.23588 WP_003899525.1.23628 WP_003899525.1.23677 WP_003899525.1.23683 WP_003899525.1.23692 WP_003899525.1.23694 WP_003899525.1.23699 WP_003899525.1.2371 WP_003899525.1.23803 WP_003899525.1.23807 WP_003899525.1.23825 WP_003899525.1.23832 WP_003899525.1.2384 WP_003899525.1.23843 WP_003899525.1.23863 WP_003899525.1.23894 WP_003899525.1.23993 WP_003899525.1.2400 WP_003899525.1.24007 WP_003899525.1.24008 WP_003899525.1.24046 WP_003899525.1.24057 WP_003899525.1.24062 WP_003899525.1.24113 WP_003899525.1.24119 WP_003899525.1.24128 WP_003899525.1.24140 WP_003899525.1.24176 WP_003899525.1.24190 WP_003899525.1.24202 WP_003899525.1.24244 WP_003899525.1.24261 WP_003899525.1.24284 WP_003899525.1.24294 WP_003899525.1.24357 WP_003899525.1.24396 WP_003899525.1.24414 WP_003899525.1.24423 WP_003899525.1.2443 WP_003899525.1.24446 WP_003899525.1.24461 WP_003899525.1.24500 WP_003899525.1.24507 WP_003899525.1.24509 WP_003899525.1.24529 WP_003899525.1.24553 WP_003899525.1.24629 WP_003899525.1.24638 WP_003899525.1.24648 WP_003899525.1.2466 WP_003899525.1.24767 WP_003899525.1.24824 WP_003899525.1.24831 WP_003899525.1.24840 WP_003899525.1.24848 WP_003899525.1.24857 WP_003899525.1.2487 WP_003899525.1.24893 WP_003899525.1.24907 WP_003899525.1.24933 WP_003899525.1.24956 WP_003899525.1.24958 WP_003899525.1.24985 WP_003899525.1.2499 WP_003899525.1.25004 WP_003899525.1.2505 WP_003899525.1.25051 WP_003899525.1.2507 WP_003899525.1.25096 WP_003899525.1.25103 WP_003899525.1.25129 WP_003899525.1.25171 WP_003899525.1.25184 WP_003899525.1.25247 WP_003899525.1.25252 WP_003899525.1.25278 WP_003899525.1.25283 WP_003899525.1.25309 WP_003899525.1.25313 WP_003899525.1.25338 WP_003899525.1.25342 WP_003899525.1.25343 WP_003899525.1.25367 WP_003899525.1.25393 WP_003899525.1.25406 WP_003899525.1.25435 WP_003899525.1.25437 WP_003899525.1.25445 WP_003899525.1.25455 WP_003899525.1.25473 WP_003899525.1.25504 WP_003899525.1.25513 WP_003899525.1.25542 WP_003899525.1.25579 WP_003899525.1.25594 WP_003899525.1.25606 WP_003899525.1.25645 WP_003899525.1.2566 WP_003899525.1.25673 WP_003899525.1.25674 WP_003899525.1.25693 WP_003899525.1.25699 WP_003899525.1.25727 WP_003899525.1.25736 WP_003899525.1.25738 WP_003899525.1.25756 WP_003899525.1.25759 WP_003899525.1.2580 WP_003899525.1.25813 WP_003899525.1.25853 WP_003899525.1.25854 WP_003899525.1.25874 WP_003899525.1.25885 WP_003899525.1.25892 WP_003899525.1.25906 WP_003899525.1.25914 WP_003899525.1.25916 WP_003899525.1.2594 WP_003899525.1.25954 WP_003899525.1.25965 WP_003899525.1.25972 WP_003899525.1.26017 WP_003899525.1.26032 WP_003899525.1.26038 WP_003899525.1.26072 WP_003899525.1.26089 WP_003899525.1.26097 WP_003899525.1.26098 WP_003899525.1.26108 WP_003899525.1.26109 WP_003899525.1.26118 WP_003899525.1.26126 WP_003899525.1.2614 WP_003899525.1.26168 WP_003899525.1.26182 WP_003899525.1.26190 WP_003899525.1.2620 WP_003899525.1.26234 WP_003899525.1.26243 WP_003899525.1.26265 WP_003899525.1.26267 WP_003899525.1.26292 WP_003899525.1.26310 WP_003899525.1.26328 WP_003899525.1.26349 WP_003899525.1.26366 WP_003899525.1.26374 WP_003899525.1.26407 WP_003899525.1.26412 WP_003899525.1.26454 WP_003899525.1.26464 WP_003899525.1.2653 WP_003899525.1.26560 WP_003899525.1.26571 WP_003899525.1.2659 WP_003899525.1.26597 WP_003899525.1.26603 WP_003899525.1.26629 WP_003899525.1.26651 WP_003899525.1.26702 WP_003899525.1.26707 WP_003899525.1.26710 WP_003899525.1.26719 WP_003899525.1.26737 WP_003899525.1.26738 WP_003899525.1.26745 WP_003899525.1.26756 WP_003899525.1.2676 WP_003899525.1.2677 WP_003899525.1.26779 WP_003899525.1.26780 WP_003899525.1.26798 WP_003899525.1.26854 WP_003899525.1.26868 WP_003899525.1.26876 WP_003899525.1.26888 WP_003899525.1.26914 WP_003899525.1.26945 WP_003899525.1.26959 WP_003899525.1.26969 WP_003899525.1.26984 WP_003899525.1.26992 WP_003899525.1.27004 WP_003899525.1.27017 WP_003899525.1.27045 WP_003899525.1.27074 WP_003899525.1.27075 WP_003899525.1.27128 WP_003899525.1.27130 WP_003899525.1.27139 WP_003899525.1.27152 WP_003899525.1.27162 WP_003899525.1.27164 WP_003899525.1.27193 WP_003899525.1.27235 WP_003899525.1.27254 WP_003899525.1.27278 WP_003899525.1.27343 WP_003899525.1.27352 WP_003899525.1.27369 WP_003899525.1.27391 WP_003899525.1.27398 WP_003899525.1.27402 WP_003899525.1.27410 WP_003899525.1.27411 WP_003899525.1.27449 WP_003899525.1.27460 WP_003899525.1.27463 WP_003899525.1.27492 WP_003899525.1.27528 WP_003899525.1.27576 WP_003899525.1.27582 WP_003899525.1.27596 WP_003899525.1.27607 WP_003899525.1.2766 WP_003899525.1.277 WP_003899525.1.27724 WP_003899525.1.27730 WP_003899525.1.27736 WP_003899525.1.27743 WP_003899525.1.27750 WP_003899525.1.27771 WP_003899525.1.27779 WP_003899525.1.27795 WP_003899525.1.27803 WP_003899525.1.27819 WP_003899525.1.27835 WP_003899525.1.27915 WP_003899525.1.27935 WP_003899525.1.27962 WP_003899525.1.28053 WP_003899525.1.28092 WP_003899525.1.28106 WP_003899525.1.28131 WP_003899525.1.28142 WP_003899525.1.28159 WP_003899525.1.2816 WP_003899525.1.28161 WP_003899525.1.28192 WP_003899525.1.28202 WP_003899525.1.28241 WP_003899525.1.28242 WP_003899525.1.28251 WP_003899525.1.28269 WP_003899525.1.28276 WP_003899525.1.28293 WP_003899525.1.28331 WP_003899525.1.28367 WP_003899525.1.28378 WP_003899525.1.28391 WP_003899525.1.2842 WP_003899525.1.28448 WP_003899525.1.2847 WP_003899525.1.28471 WP_003899525.1.28473 WP_003899525.1.28493 WP_003899525.1.28497 WP_003899525.1.28530 WP_003899525.1.28545 WP_003899525.1.28561 WP_003899525.1.28567 WP_003899525.1.28585 WP_003899525.1.286 WP_003899525.1.28610 WP_003899525.1.28617 WP_003899525.1.28634 WP_003899525.1.28642 WP_003899525.1.28671 WP_003899525.1.28682 WP_003899525.1.28698 WP_003899525.1.28703 WP_003899525.1.28739 WP_003899525.1.28758 WP_003899525.1.28781 WP_003899525.1.28787 WP_003899525.1.28827 WP_003899525.1.28839 WP_003899525.1.28847 WP_003899525.1.28850 WP_003899525.1.28851 WP_003899525.1.28865 WP_003899525.1.28897 WP_003899525.1.28914 WP_003899525.1.28935 WP_003899525.1.28936 WP_003899525.1.28939 WP_003899525.1.28943 WP_003899525.1.28952 WP_003899525.1.28975 WP_003899525.1.2899 WP_003899525.1.28993 WP_003899525.1.29000 WP_003899525.1.2901 WP_003899525.1.29028 WP_003899525.1.29033 WP_003899525.1.29058 WP_003899525.1.29078 WP_003899525.1.29102 WP_003899525.1.29115 WP_003899525.1.2916 WP_003899525.1.29217 WP_003899525.1.29223 WP_003899525.1.29234 WP_003899525.1.29264 WP_003899525.1.29275 WP_003899525.1.29306 WP_003899525.1.29339 WP_003899525.1.29348 WP_003899525.1.29364 WP_003899525.1.29367 WP_003899525.1.2938 WP_003899525.1.29399 WP_003899525.1.29426 WP_003899525.1.2944 WP_003899525.1.29449 WP_003899525.1.29450 WP_003899525.1.29452 WP_003899525.1.2949 WP_003899525.1.29510 WP_003899525.1.29515 WP_003899525.1.29525 WP_003899525.1.2953 WP_003899525.1.29559 WP_003899525.1.29587 WP_003899525.1.2959 WP_003899525.1.29592 WP_003899525.1.29599 WP_003899525.1.29611 WP_003899525.1.29632 WP_003899525.1.29649 WP_003899525.1.2965 WP_003899525.1.29659 WP_003899525.1.2969 WP_003899525.1.29696 WP_003899525.1.29698 WP_003899525.1.29718 WP_003899525.1.29742 WP_003899525.1.29745 WP_003899525.1.29747 WP_003899525.1.29769 WP_003899525.1.29825 WP_003899525.1.29830 WP_003899525.1.29847 WP_003899525.1.29861 WP_003899525.1.29869 WP_003899525.1.29883 WP_003899525.1.29890 WP_003899525.1.299 WP_003899525.1.29931 WP_003899525.1.29960 WP_003899525.1.30014 WP_003899525.1.3004 WP_003899525.1.30040 WP_003899525.1.30043 WP_003899525.1.30074 WP_003899525.1.30097 WP_003899525.1.30101 WP_003899525.1.30106 WP_003899525.1.30114 WP_003899525.1.30126 WP_003899525.1.30131 WP_003899525.1.30138 WP_003899525.1.30139 WP_003899525.1.30145 WP_003899525.1.30211 WP_003899525.1.30224 WP_003899525.1.30235 WP_003899525.1.30237 WP_003899525.1.3027 WP_003899525.1.30279 WP_003899525.1.30282 WP_003899525.1.30283 WP_003899525.1.30288 WP_003899525.1.30291 WP_003899525.1.30363 WP_003899525.1.30374 WP_003899525.1.30404 WP_003899525.1.3043 WP_003899525.1.30433 WP_003899525.1.30438 WP_003899525.1.30462 WP_003899525.1.30464 WP_003899525.1.30468 WP_003899525.1.30500 WP_003899525.1.3057 WP_003899525.1.30574 WP_003899525.1.30628 WP_003899525.1.30641 WP_003899525.1.30642 WP_003899525.1.30661 WP_003899525.1.30669 WP_003899525.1.30683 WP_003899525.1.30699 WP_003899525.1.30709 WP_003899525.1.30713 WP_003899525.1.30716 WP_003899525.1.30719 WP_003899525.1.30730 WP_003899525.1.30732 WP_003899525.1.30736 WP_003899525.1.30745 WP_003899525.1.30760 WP_003899525.1.30791 WP_003899525.1.308 WP_003899525.1.30807 WP_003899525.1.30818 WP_003899525.1.30824 WP_003899525.1.30877 WP_003899525.1.30888 WP_003899525.1.30901 WP_003899525.1.30903 WP_003899525.1.30912 WP_003899525.1.30913 WP_003899525.1.30914 WP_003899525.1.30919 WP_003899525.1.30977 WP_003899525.1.3100 WP_003899525.1.31002 WP_003899525.1.3101 WP_003899525.1.31034 WP_003899525.1.31047 WP_003899525.1.31070 WP_003899525.1.31074 WP_003899525.1.31102 WP_003899525.1.31127 WP_003899525.1.31184 WP_003899525.1.31199 WP_003899525.1.31226 WP_003899525.1.31230 WP_003899525.1.31233 WP_003899525.1.31263 WP_003899525.1.31264 WP_003899525.1.31270 WP_003899525.1.31287 WP_003899525.1.31290 WP_003899525.1.31304 WP_003899525.1.31346 WP_003899525.1.31348 WP_003899525.1.31354 WP_003899525.1.31390 WP_003899525.1.31414 WP_003899525.1.31417 WP_003899525.1.31428 WP_003899525.1.3143 WP_003899525.1.31458 WP_003899525.1.31483 WP_003899525.1.3149 WP_003899525.1.31498 WP_003899525.1.31507 WP_003899525.1.31537 WP_003899525.1.31548 WP_003899525.1.31569 WP_003899525.1.31573 WP_003899525.1.316 WP_003899525.1.31629 WP_003899525.1.31666 WP_003899525.1.31693 WP_003899525.1.31703 WP_003899525.1.31744 WP_003899525.1.31745 WP_003899525.1.31770 WP_003899525.1.31776 WP_003899525.1.31783 WP_003899525.1.318 WP_003899525.1.3184 WP_003899525.1.31840 WP_003899525.1.31880 WP_003899525.1.31911 WP_003899525.1.31930 WP_003899525.1.31932 WP_003899525.1.31955 WP_003899525.1.31985 WP_003899525.1.31991 WP_003899525.1.31995 WP_003899525.1.32004 WP_003899525.1.32039 WP_003899525.1.3204 WP_003899525.1.32045 WP_003899525.1.32071 WP_003899525.1.32098 WP_003899525.1.32132 WP_003899525.1.32157 WP_003899525.1.32164 WP_003899525.1.32179 WP_003899525.1.32198 WP_003899525.1.32297 WP_003899525.1.32317 WP_003899525.1.32383 WP_003899525.1.32400 WP_003899525.1.32403 WP_003899525.1.32416 WP_003899525.1.32421 WP_003899525.1.32433 WP_003899525.1.32461 WP_003899525.1.32482 WP_003899525.1.32503 WP_003899525.1.32556 WP_003899525.1.32562 WP_003899525.1.32569 WP_003899525.1.32592 WP_003899525.1.32620 WP_003899525.1.32647 WP_003899525.1.32653 WP_003899525.1.32654 WP_003899525.1.3268 WP_003899525.1.32695 WP_003899525.1.32706 WP_003899525.1.32716 WP_003899525.1.32738 WP_003899525.1.32752 WP_003899525.1.32780 WP_003899525.1.32781 WP_003899525.1.32793 WP_003899525.1.32799 WP_003899525.1.32822 WP_003899525.1.32833 WP_003899525.1.32862 WP_003899525.1.32880 WP_003899525.1.32897 WP_003899525.1.32909 WP_003899525.1.32935 WP_003899525.1.32974 WP_003899525.1.33007 WP_003899525.1.3302 WP_003899525.1.33028 WP_003899525.1.33035 WP_003899525.1.33044 WP_003899525.1.33054 WP_003899525.1.33082 WP_003899525.1.33141 WP_003899525.1.33148 WP_003899525.1.33155 WP_003899525.1.33168 WP_003899525.1.3321 WP_003899525.1.33215 WP_003899525.1.3325 WP_003899525.1.3327 WP_003899525.1.33278 WP_003899525.1.33288 WP_003899525.1.33305 WP_003899525.1.3331 WP_003899525.1.33319 WP_003899525.1.3333 WP_003899525.1.33393 WP_003899525.1.33403 WP_003899525.1.33452 WP_003899525.1.33467 WP_003899525.1.33477 WP_003899525.1.3349 WP_003899525.1.33519 WP_003899525.1.33542 WP_003899525.1.33601 WP_003899525.1.33602 WP_003899525.1.33633 WP_003899525.1.33646 WP_003899525.1.33673 WP_003899525.1.3369 WP_003899525.1.33705 WP_003899525.1.33762 WP_003899525.1.33783 WP_003899525.1.33789 WP_003899525.1.3383 WP_003899525.1.33832 WP_003899525.1.33839 WP_003899525.1.33848 WP_003899525.1.3387 WP_003899525.1.33886 WP_003899525.1.33895 WP_003899525.1.33906 WP_003899525.1.33912 WP_003899525.1.33954 WP_003899525.1.3399 WP_003899525.1.34042 WP_003899525.1.3405 WP_003899525.1.34055 WP_003899525.1.34056 WP_003899525.1.34065 WP_003899525.1.3408 WP_003899525.1.34090 WP_003899525.1.34109 WP_003899525.1.34111 WP_003899525.1.34131 WP_003899525.1.34152 WP_003899525.1.34153 WP_003899525.1.34163 WP_003899525.1.34181 WP_003899525.1.34197 WP_003899525.1.34198 WP_003899525.1.34215 WP_003899525.1.34219 WP_003899525.1.34255 WP_003899525.1.34260 WP_003899525.1.34275 WP_003899525.1.343 WP_003899525.1.34347 WP_003899525.1.34358 WP_003899525.1.34392 WP_003899525.1.344 WP_003899525.1.34428 WP_003899525.1.3443 WP_003899525.1.34435 WP_003899525.1.34446 WP_003899525.1.34499 WP_003899525.1.34505 WP_003899525.1.34516 WP_003899525.1.34529 WP_003899525.1.34551 WP_003899525.1.34563 WP_003899525.1.34576 WP_003899525.1.34581 WP_003899525.1.34588 WP_003899525.1.34596 WP_003899525.1.34599 WP_003899525.1.34639 WP_003899525.1.34673 WP_003899525.1.34724 WP_003899525.1.34740 WP_003899525.1.34755 WP_003899525.1.34777 WP_003899525.1.34783 WP_003899525.1.34841 WP_003899525.1.34908 WP_003899525.1.34919 WP_003899525.1.3492 WP_003899525.1.34933 WP_003899525.1.34945 WP_003899525.1.34946 WP_003899525.1.34954 WP_003899525.1.34960 WP_003899525.1.34961 WP_003899525.1.34963 WP_003899525.1.34965 WP_003899525.1.34968 WP_003899525.1.35023 WP_003899525.1.35069 WP_003899525.1.35072 WP_003899525.1.35078 WP_003899525.1.35100 WP_003899525.1.35146 WP_003899525.1.35156 WP_003899525.1.35160 WP_003899525.1.35162 WP_003899525.1.35173 WP_003899525.1.35176 WP_003899525.1.3520 WP_003899525.1.35213 WP_003899525.1.35221 WP_003899525.1.35246 WP_003899525.1.35278 WP_003899525.1.35301 WP_003899525.1.35311 WP_003899525.1.35312 WP_003899525.1.35317 WP_003899525.1.35319 WP_003899525.1.35347 WP_003899525.1.35363 WP_003899525.1.35382 WP_003899525.1.35385 WP_003899525.1.35396 WP_003899525.1.35397 WP_003899525.1.35403 WP_003899525.1.35426 WP_003899525.1.35439 WP_003899525.1.35455 WP_003899525.1.3548 WP_003899525.1.35484 WP_003899525.1.35492 WP_003899525.1.3553 WP_003899525.1.35553 WP_003899525.1.35555 WP_003899525.1.35561 WP_003899525.1.35602 WP_003899525.1.35610 WP_003899525.1.35635 WP_003899525.1.35657 WP_003899525.1.35680 WP_003899525.1.35687 WP_003899525.1.35689 WP_003899525.1.35707 WP_003899525.1.35732 WP_003899525.1.35754 WP_003899525.1.35767 WP_003899525.1.35770 WP_003899525.1.35771 WP_003899525.1.35780 WP_003899525.1.35805 WP_003899525.1.35811 WP_003899525.1.35821 WP_003899525.1.3584 WP_003899525.1.35848 WP_003899525.1.35864 WP_003899525.1.35874 WP_003899525.1.35876 WP_003899525.1.35897 WP_003899525.1.35899 WP_003899525.1.35923 WP_003899525.1.3593 WP_003899525.1.35954 WP_003899525.1.36005 WP_003899525.1.36014 WP_003899525.1.36023 WP_003899525.1.36051 WP_003899525.1.36053 WP_003899525.1.36075 WP_003899525.1.36089 WP_003899525.1.36097 WP_003899525.1.36098 WP_003899525.1.36116 WP_003899525.1.36145 WP_003899525.1.36156 WP_003899525.1.36205 WP_003899525.1.36228 WP_003899525.1.36246 WP_003899525.1.36252 WP_003899525.1.36260 WP_003899525.1.36270 WP_003899525.1.36271 WP_003899525.1.36303 WP_003899525.1.36309 WP_003899525.1.36315 WP_003899525.1.36319 WP_003899525.1.36321 WP_003899525.1.36326 WP_003899525.1.3634 WP_003899525.1.36356 WP_003899525.1.36357 WP_003899525.1.3636 WP_003899525.1.36385 WP_003899525.1.36399 WP_003899525.1.36436 WP_003899525.1.36465 WP_003899525.1.36469 WP_003899525.1.36473 WP_003899525.1.36485 WP_003899525.1.36508 WP_003899525.1.36540 WP_003899525.1.36561 WP_003899525.1.36571 WP_003899525.1.36573 WP_003899525.1.36578 WP_003899525.1.36585 WP_003899525.1.36614 WP_003899525.1.36657 WP_003899525.1.36674 WP_003899525.1.36720 WP_003899525.1.36727 WP_003899525.1.36733 WP_003899525.1.36785 WP_003899525.1.36810 WP_003899525.1.36844 WP_003899525.1.36851 WP_003899525.1.36862 WP_003899525.1.36893 WP_003899525.1.36901 WP_003899525.1.36921 WP_003899525.1.36935 WP_003899525.1.36941 WP_003899525.1.3695 WP_003899525.1.36951 WP_003899525.1.36968 WP_003899525.1.3700 WP_003899525.1.37004 WP_003899525.1.37071 WP_003899525.1.37088 WP_003899525.1.37131 WP_003899525.1.37157 WP_003899525.1.37175 WP_003899525.1.37188 WP_003899525.1.37213 WP_003899525.1.37229 WP_003899525.1.3724 WP_003899525.1.37277 WP_003899525.1.37305 WP_003899525.1.37330 WP_003899525.1.37389 WP_003899525.1.37400 WP_003899525.1.37440 WP_003899525.1.37459 WP_003899525.1.37468 WP_003899525.1.37475 WP_003899525.1.37484 WP_003899525.1.37601 WP_003899525.1.37612 WP_003899525.1.37632 WP_003899525.1.37643 WP_003899525.1.37655 WP_003899525.1.37660 WP_003899525.1.37674 WP_003899525.1.37700 WP_003899525.1.37701 WP_003899525.1.37709 WP_003899525.1.37711 WP_003899525.1.37721 WP_003899525.1.37722 WP_003899525.1.37747 WP_003899525.1.37765 WP_003899525.1.37772 WP_003899525.1.37804 WP_003899525.1.37809 WP_003899525.1.37859 WP_003899525.1.37877 WP_003899525.1.37912 WP_003899525.1.37913 WP_003899525.1.37943 WP_003899525.1.37950 WP_003899525.1.37973 WP_003899525.1.37975 WP_003899525.1.37983 WP_003899525.1.38 WP_003899525.1.38002 WP_003899525.1.3802 WP_003899525.1.38039 WP_003899525.1.38040 WP_003899525.1.38067 WP_003899525.1.38068 WP_003899525.1.38135 WP_003899525.1.38138 WP_003899525.1.38144 WP_003899525.1.38158 WP_003899525.1.38159 WP_003899525.1.38210 WP_003899525.1.38233 WP_003899525.1.38240 WP_003899525.1.38299 WP_003899525.1.38332 WP_003899525.1.38347 WP_003899525.1.38354 WP_003899525.1.38380 WP_003899525.1.38384 WP_003899525.1.38389 WP_003899525.1.38398 WP_003899525.1.38402 WP_003899525.1.38418 WP_003899525.1.38421 WP_003899525.1.38466 WP_003899525.1.38477 WP_003899525.1.38483 WP_003899525.1.3849 WP_003899525.1.385 WP_003899525.1.38530 WP_003899525.1.38535 WP_003899525.1.38539 WP_003899525.1.38594 WP_003899525.1.38601 WP_003899525.1.38611 WP_003899525.1.38638 WP_003899525.1.38639 WP_003899525.1.38646 WP_003899525.1.38648 WP_003899525.1.38654 WP_003899525.1.38659 WP_003899525.1.38660 WP_003899525.1.38666 WP_003899525.1.38671 WP_003899525.1.38672 WP_003899525.1.38677 WP_003899525.1.38750 WP_003899525.1.38772 WP_003899525.1.38821 WP_003899525.1.38844 WP_003899525.1.38863 WP_003899525.1.38865 WP_003899525.1.38873 WP_003899525.1.3889 WP_003899525.1.38894 WP_003899525.1.38909 WP_003899525.1.38939 WP_003899525.1.38974 WP_003899525.1.38975 WP_003899525.1.38991 WP_003899525.1.39025 WP_003899525.1.39070 WP_003899525.1.39072 WP_003899525.1.39095 WP_003899525.1.39106 WP_003899525.1.39165 WP_003899525.1.39174 WP_003899525.1.39176 WP_003899525.1.39178 WP_003899525.1.39190 WP_003899525.1.39201 WP_003899525.1.39207 WP_003899525.1.39211 WP_003899525.1.39236 WP_003899525.1.39239 WP_003899525.1.39252 WP_003899525.1.39288 WP_003899525.1.39295 WP_003899525.1.39306 WP_003899525.1.39359 WP_003899525.1.39364 WP_003899525.1.39400 WP_003899525.1.39447 WP_003899525.1.3945 WP_003899525.1.39450 WP_003899525.1.39455 WP_003899525.1.3949 WP_003899525.1.39521 WP_003899525.1.39560 WP_003899525.1.39592 WP_003899525.1.39593 WP_003899525.1.396 WP_003899525.1.3960 WP_003899525.1.39616 WP_003899525.1.39654 WP_003899525.1.39657 WP_003899525.1.39661 WP_003899525.1.39674 WP_003899525.1.39678 WP_003899525.1.3968 WP_003899525.1.39694 WP_003899525.1.3971 WP_003899525.1.39718 WP_003899525.1.39728 WP_003899525.1.39739 WP_003899525.1.39748 WP_003899525.1.39751 WP_003899525.1.39759 WP_003899525.1.39801 WP_003899525.1.39804 WP_003899525.1.39848 WP_003899525.1.39877 WP_003899525.1.39925 WP_003899525.1.3994 WP_003899525.1.39959 WP_003899525.1.3996 WP_003899525.1.39960 WP_003899525.1.3997 WP_003899525.1.39980 WP_003899525.1.40000 WP_003899525.1.40028 WP_003899525.1.40029 WP_003899525.1.4003 WP_003899525.1.40094 WP_003899525.1.40096 WP_003899525.1.40150 WP_003899525.1.40156 WP_003899525.1.40174 WP_003899525.1.40186 WP_003899525.1.40276 WP_003899525.1.40277 WP_003899525.1.40323 WP_003899525.1.40336 WP_003899525.1.40353 WP_003899525.1.4036 WP_003899525.1.40372 WP_003899525.1.40402 WP_003899525.1.40413 WP_003899525.1.40440 WP_003899525.1.40446 WP_003899525.1.40451 WP_003899525.1.40455 WP_003899525.1.40523 WP_003899525.1.40543 WP_003899525.1.40641 WP_003899525.1.40646 WP_003899525.1.40651 WP_003899525.1.40653 WP_003899525.1.4067 WP_003899525.1.40705 WP_003899525.1.40723 WP_003899525.1.40731 WP_003899525.1.40735 WP_003899525.1.40795 WP_003899525.1.40799 WP_003899525.1.40852 WP_003899525.1.40876 WP_003899525.1.40881 WP_003899525.1.40922 WP_003899525.1.40948 WP_003899525.1.4095 WP_003899525.1.40957 WP_003899525.1.40964 WP_003899525.1.4097 WP_003899525.1.410 WP_003899525.1.41000 WP_003899525.1.41055 WP_003899525.1.41108 WP_003899525.1.41123 WP_003899525.1.41177 WP_003899525.1.41202 WP_003899525.1.41219 WP_003899525.1.41231 WP_003899525.1.41249 WP_003899525.1.4127 WP_003899525.1.41296 WP_003899525.1.41355 WP_003899525.1.41376 WP_003899525.1.41430 WP_003899525.1.41447 WP_003899525.1.41469 WP_003899525.1.41504 WP_003899525.1.41553 WP_003899525.1.41564 WP_003899525.1.41583 WP_003899525.1.41616 WP_003899525.1.41632 WP_003899525.1.41635 WP_003899525.1.41636 WP_003899525.1.41648 WP_003899525.1.41660 WP_003899525.1.41685 WP_003899525.1.41695 WP_003899525.1.41704 WP_003899525.1.4171 WP_003899525.1.41719 WP_003899525.1.41733 WP_003899525.1.41744 WP_003899525.1.41774 WP_003899525.1.41791 WP_003899525.1.41803 WP_003899525.1.41820 WP_003899525.1.41828 WP_003899525.1.41829 WP_003899525.1.41860 WP_003899525.1.41912 WP_003899525.1.41921 WP_003899525.1.41933 WP_003899525.1.41944 WP_003899525.1.42043 WP_003899525.1.42075 WP_003899525.1.42078 WP_003899525.1.42094 WP_003899525.1.42112 WP_003899525.1.4212 WP_003899525.1.42122 WP_003899525.1.42134 WP_003899525.1.42183 WP_003899525.1.42188 WP_003899525.1.42201 WP_003899525.1.42202 WP_003899525.1.42208 WP_003899525.1.42247 WP_003899525.1.42255 WP_003899525.1.42273 WP_003899525.1.42278 WP_003899525.1.42309 WP_003899525.1.42370 WP_003899525.1.42385 WP_003899525.1.42400 WP_003899525.1.42409 WP_003899525.1.42414 WP_003899525.1.42417 WP_003899525.1.42430 WP_003899525.1.42461 WP_003899525.1.42465 WP_003899525.1.42467 WP_003899525.1.42473 WP_003899525.1.4248 WP_003899525.1.42494 WP_003899525.1.42519 WP_003899525.1.42524 WP_003899525.1.42534 WP_003899525.1.4255 WP_003899525.1.42562 WP_003899525.1.42568 WP_003899525.1.42570 WP_003899525.1.42618 WP_003899525.1.42660 WP_003899525.1.42695 WP_003899525.1.42704 WP_003899525.1.42705 WP_003899525.1.42722 WP_003899525.1.42777 WP_003899525.1.42782 WP_003899525.1.42835 WP_003899525.1.42839 WP_003899525.1.42842 WP_003899525.1.42905 WP_003899525.1.42916 WP_003899525.1.42930 WP_003899525.1.42971 WP_003899525.1.43005 WP_003899525.1.43009 WP_003899525.1.43053 WP_003899525.1.43082 WP_003899525.1.43087 WP_003899525.1.43098 WP_003899525.1.43208 WP_003899525.1.43236 WP_003899525.1.43246 WP_003899525.1.43255 WP_003899525.1.43266 WP_003899525.1.43269 WP_003899525.1.43273 WP_003899525.1.43296 WP_003899525.1.43306 WP_003899525.1.4335 WP_003899525.1.43368 WP_003899525.1.43457 WP_003899525.1.43462 WP_003899525.1.43475 WP_003899525.1.43478 WP_003899525.1.43484 WP_003899525.1.43557 WP_003899525.1.43578 WP_003899525.1.43588 WP_003899525.1.43643 WP_003899525.1.43664 WP_003899525.1.43684 WP_003899525.1.43686 WP_003899525.1.43706 WP_003899525.1.43716 WP_003899525.1.4377 WP_003899525.1.43781 WP_003899525.1.43794 WP_003899525.1.43815 WP_003899525.1.43846 WP_003899525.1.43861 WP_003899525.1.43863 WP_003899525.1.43866 WP_003899525.1.43872 WP_003899525.1.43885 WP_003899525.1.43897 WP_003899525.1.4390 WP_003899525.1.43902 WP_003899525.1.43921 WP_003899525.1.43936 WP_003899525.1.43937 WP_003899525.1.43960 WP_003899525.1.43965 WP_003899525.1.4399 WP_003899525.1.43993 WP_003899525.1.43996 WP_003899525.1.44 WP_003899525.1.44001 WP_003899525.1.44008 WP_003899525.1.44016 WP_003899525.1.44033 WP_003899525.1.44037 WP_003899525.1.44041 WP_003899525.1.44070 WP_003899525.1.44071 WP_003899525.1.44076 WP_003899525.1.44104 WP_003899525.1.44111 WP_003899525.1.44124 WP_003899525.1.44169 WP_003899525.1.44219 WP_003899525.1.44237 WP_003899525.1.44277 WP_003899525.1.44279 WP_003899525.1.44336 WP_003899525.1.44355 WP_003899525.1.44358 WP_003899525.1.4438 WP_003899525.1.44390 WP_003899525.1.4441 WP_003899525.1.44415 WP_003899525.1.44464 WP_003899525.1.44466 WP_003899525.1.44489 WP_003899525.1.44492 WP_003899525.1.44494 WP_003899525.1.44500 WP_003899525.1.44519 WP_003899525.1.44526 WP_003899525.1.44532 WP_003899525.1.44534 WP_003899525.1.44562 WP_003899525.1.44589 WP_003899525.1.44597 WP_003899525.1.44600 WP_003899525.1.44602 WP_003899525.1.44615 WP_003899525.1.4464 WP_003899525.1.44651 WP_003899525.1.44659 WP_003899525.1.44665 WP_003899525.1.44694 WP_003899525.1.44700 WP_003899525.1.44713 WP_003899525.1.44735 WP_003899525.1.44740 WP_003899525.1.44757 WP_003899525.1.4476 WP_003899525.1.44761 WP_003899525.1.44767 WP_003899525.1.44776 WP_003899525.1.44779 WP_003899525.1.44786 WP_003899525.1.44808 WP_003899525.1.44864 WP_003899525.1.44901 WP_003899525.1.44908 WP_003899525.1.44913 WP_003899525.1.4492 WP_003899525.1.44939 WP_003899525.1.44979 WP_003899525.1.44981 WP_003899525.1.45002 WP_003899525.1.45011 WP_003899525.1.4504 WP_003899525.1.45062 WP_003899525.1.45066 WP_003899525.1.45081 WP_003899525.1.45113 WP_003899525.1.45129 WP_003899525.1.45135 WP_003899525.1.45147 WP_003899525.1.45168 WP_003899525.1.4517 WP_003899525.1.45181 WP_003899525.1.45192 WP_003899525.1.45200 WP_003899525.1.45205 WP_003899525.1.45211 WP_003899525.1.45249 WP_003899525.1.4526 WP_003899525.1.45326 WP_003899525.1.45347 WP_003899525.1.45374 WP_003899525.1.45390 WP_003899525.1.454 WP_003899525.1.45407 WP_003899525.1.45451 WP_003899525.1.45453 WP_003899525.1.45460 WP_003899525.1.45463 WP_003899525.1.45470 WP_003899525.1.45474 WP_003899525.1.45491 WP_003899525.1.45510 WP_003899525.1.45563 WP_003899525.1.45584 WP_003899525.1.45590 WP_003899525.1.45619 WP_003899525.1.45626 WP_003899525.1.45631 WP_003899525.1.45666 WP_003899525.1.45697 WP_003899525.1.4571 WP_003899525.1.45731 WP_003899525.1.45743 WP_003899525.1.45765 WP_003899525.1.45776 WP_003899525.1.45783 WP_003899525.1.45805 WP_003899525.1.45815 WP_003899525.1.45849 WP_003899525.1.45867 WP_003899525.1.45884 WP_003899525.1.4590 WP_003899525.1.45923 WP_003899525.1.45926 WP_003899525.1.45963 WP_003899525.1.45989 WP_003899525.1.45992 WP_003899525.1.46025 WP_003899525.1.46083 WP_003899525.1.46090 WP_003899525.1.46092 WP_003899525.1.46100 WP_003899525.1.46101 WP_003899525.1.46103 WP_003899525.1.46107 WP_003899525.1.46127 WP_003899525.1.46128 WP_003899525.1.46129 WP_003899525.1.46141 WP_003899525.1.46150 WP_003899525.1.46201 WP_003899525.1.46226 WP_003899525.1.4624 WP_003899525.1.46268 WP_003899525.1.46285 WP_003899525.1.46300 WP_003899525.1.46313 WP_003899525.1.46336 WP_003899525.1.46365 WP_003899525.1.46370 WP_003899525.1.46381 WP_003899525.1.46402 WP_003899525.1.46411 WP_003899525.1.4644 WP_003899525.1.46442 WP_003899525.1.46453 WP_003899525.1.46463 WP_003899525.1.46478 WP_003899525.1.46492 WP_003899525.1.4653 WP_003899525.1.46532 WP_003899525.1.46539 WP_003899525.1.46568 WP_003899525.1.46585 WP_003899525.1.46609 WP_003899525.1.46613 WP_003899525.1.46625 WP_003899525.1.46642 WP_003899525.1.46647 WP_003899525.1.46674 WP_003899525.1.46724 WP_003899525.1.46758 WP_003899525.1.46773 WP_003899525.1.46777 WP_003899525.1.46786 WP_003899525.1.46792 WP_003899525.1.46847 WP_003899525.1.46851 WP_003899525.1.4687 WP_003899525.1.46897 WP_003899525.1.46936 WP_003899525.1.46980 WP_003899525.1.47011 WP_003899525.1.47012 WP_003899525.1.47066 WP_003899525.1.47077 WP_003899525.1.47083 WP_003899525.1.47106 WP_003899525.1.47142 WP_003899525.1.47147 WP_003899525.1.47166 WP_003899525.1.47178 WP_003899525.1.47179 WP_003899525.1.47194 WP_003899525.1.47207 WP_003899525.1.47210 WP_003899525.1.47261 WP_003899525.1.47262 WP_003899525.1.47402 WP_003899525.1.47423 WP_003899525.1.47467 WP_003899525.1.47502 WP_003899525.1.4751 WP_003899525.1.47511 WP_003899525.1.47537 WP_003899525.1.47540 WP_003899525.1.47568 WP_003899525.1.47572 WP_003899525.1.47588 WP_003899525.1.47636 WP_003899525.1.4764 WP_003899525.1.47653 WP_003899525.1.47679 WP_003899525.1.47681 WP_003899525.1.47690 WP_003899525.1.4771 WP_003899525.1.47717 WP_003899525.1.47743 WP_003899525.1.47754 WP_003899525.1.47773 WP_003899525.1.47776 WP_003899525.1.47780 WP_003899525.1.47805 WP_003899525.1.47832 WP_003899525.1.47858 WP_003899525.1.47861 WP_003899525.1.47868 WP_003899525.1.47893 WP_003899525.1.47899 WP_003899525.1.479 WP_003899525.1.47912 WP_003899525.1.47913 WP_003899525.1.47926 WP_003899525.1.4794 WP_003899525.1.47943 WP_003899525.1.47944 WP_003899525.1.47959 WP_003899525.1.47974 WP_003899525.1.47993 WP_003899525.1.48004 WP_003899525.1.48039 WP_003899525.1.48050 WP_003899525.1.48084 WP_003899525.1.48097 WP_003899525.1.48101 WP_003899525.1.48109 WP_003899525.1.4813 WP_003899525.1.48130 WP_003899525.1.48135 WP_003899525.1.48143 WP_003899525.1.48152 WP_003899525.1.48155 WP_003899525.1.48170 WP_003899525.1.48173 WP_003899525.1.48177 WP_003899525.1.48185 WP_003899525.1.48204 WP_003899525.1.4823 WP_003899525.1.48240 WP_003899525.1.48256 WP_003899525.1.48264 WP_003899525.1.48287 WP_003899525.1.48330 WP_003899525.1.48333 WP_003899525.1.48348 WP_003899525.1.48354 WP_003899525.1.48372 WP_003899525.1.48383 WP_003899525.1.48388 WP_003899525.1.48419 WP_003899525.1.48423 WP_003899525.1.48443 WP_003899525.1.48450 WP_003899525.1.48462 WP_003899525.1.48543 WP_003899525.1.48550 WP_003899525.1.48605 WP_003899525.1.48618 WP_003899525.1.4863 WP_003899525.1.48648 WP_003899525.1.48658 WP_003899525.1.48666 WP_003899525.1.48687 WP_003899525.1.48779 WP_003899525.1.4878 WP_003899525.1.48798 WP_003899525.1.48802 WP_003899525.1.48826 WP_003899525.1.48831 WP_003899525.1.48843 WP_003899525.1.48857 WP_003899525.1.4890 WP_003899525.1.48946 WP_003899525.1.48979 WP_003899525.1.49017 WP_003899525.1.49048 WP_003899525.1.49059 WP_003899525.1.4906 WP_003899525.1.4907 WP_003899525.1.49103 WP_003899525.1.49110 WP_003899525.1.49111 WP_003899525.1.49112 WP_003899525.1.4919 WP_003899525.1.49251 WP_003899525.1.49263 WP_003899525.1.49291 WP_003899525.1.49296 WP_003899525.1.49335 WP_003899525.1.49337 WP_003899525.1.49419 WP_003899525.1.49426 WP_003899525.1.49437 WP_003899525.1.49439 WP_003899525.1.49474 WP_003899525.1.49506 WP_003899525.1.49516 WP_003899525.1.49523 WP_003899525.1.49526 WP_003899525.1.49532 WP_003899525.1.49588 WP_003899525.1.4959 WP_003899525.1.49678 WP_003899525.1.49687 WP_003899525.1.49699 WP_003899525.1.49709 WP_003899525.1.4971 WP_003899525.1.4972 WP_003899525.1.49736 WP_003899525.1.49746 WP_003899525.1.49764 WP_003899525.1.49773 WP_003899525.1.49796 WP_003899525.1.49814 WP_003899525.1.49815 WP_003899525.1.49816 WP_003899525.1.49839 WP_003899525.1.49857 WP_003899525.1.49878 WP_003899525.1.49880 WP_003899525.1.49944 WP_003899525.1.4999 WP_003899525.1.49990 WP_003899525.1.50068 WP_003899525.1.50077 WP_003899525.1.5008 WP_003899525.1.50081 WP_003899525.1.50122 WP_003899525.1.50126 WP_003899525.1.50149 WP_003899525.1.50162 WP_003899525.1.5018 WP_003899525.1.50194 WP_003899525.1.50218 WP_003899525.1.50235 WP_003899525.1.50249 WP_003899525.1.50265 WP_003899525.1.50271 WP_003899525.1.50324 WP_003899525.1.50347 WP_003899525.1.50372 WP_003899525.1.50398 WP_003899525.1.50407 WP_003899525.1.50444 WP_003899525.1.50466 WP_003899525.1.50472 WP_003899525.1.5048 WP_003899525.1.50498 WP_003899525.1.5050 WP_003899525.1.50540 WP_003899525.1.50554 WP_003899525.1.50557 WP_003899525.1.50601 WP_003899525.1.50610 WP_003899525.1.50632 WP_003899525.1.50633 WP_003899525.1.50642 WP_003899525.1.50655 WP_003899525.1.50659 WP_003899525.1.50683 WP_003899525.1.50689 WP_003899525.1.50692 WP_003899525.1.50714 WP_003899525.1.50729 WP_003899525.1.50756 WP_003899525.1.50784 WP_003899525.1.50794 WP_003899525.1.50841 WP_003899525.1.50860 WP_003899525.1.50868 WP_003899525.1.50877 WP_003899525.1.5096 WP_003899525.1.50981 WP_003899525.1.50987 WP_003899525.1.51003 WP_003899525.1.51009 WP_003899525.1.51037 WP_003899525.1.51074 WP_003899525.1.51082 WP_003899525.1.51101 WP_003899525.1.51116 WP_003899525.1.51149 WP_003899525.1.51156 WP_003899525.1.51213 WP_003899525.1.51232 WP_003899525.1.51239 WP_003899525.1.51247 WP_003899525.1.51266 WP_003899525.1.51279 WP_003899525.1.51291 WP_003899525.1.51294 WP_003899525.1.51301 WP_003899525.1.51329 WP_003899525.1.51391 WP_003899525.1.51422 WP_003899525.1.51445 WP_003899525.1.51455 WP_003899525.1.51466 WP_003899525.1.51468 WP_003899525.1.51478 WP_003899525.1.51497 WP_003899525.1.51520 WP_003899525.1.51593 WP_003899525.1.51628 WP_003899525.1.5164 WP_003899525.1.51647 WP_003899525.1.51660 WP_003899525.1.51696 WP_003899525.1.51721 WP_003899525.1.51788 WP_003899525.1.51795 WP_003899525.1.51801 WP_003899525.1.51817 WP_003899525.1.51819 WP_003899525.1.51854 WP_003899525.1.51923 WP_003899525.1.51942 WP_003899525.1.51948 WP_003899525.1.51963 WP_003899525.1.51969 WP_003899525.1.52000 WP_003899525.1.52001 WP_003899525.1.52003 WP_003899525.1.52006 WP_003899525.1.52036 WP_003899525.1.52038 WP_003899525.1.52046 WP_003899525.1.52059 WP_003899525.1.52069 WP_003899525.1.52082 WP_003899525.1.52102 WP_003899525.1.52106 WP_003899525.1.52166 WP_003899525.1.52168 WP_003899525.1.52173 WP_003899525.1.52178 WP_003899525.1.52206 WP_003899525.1.52216 WP_003899525.1.52238 WP_003899525.1.52241 WP_003899525.1.52280 WP_003899525.1.52314 WP_003899525.1.52385 WP_003899525.1.52390 WP_003899525.1.524 WP_003899525.1.52460 WP_003899525.1.52485 WP_003899525.1.52486 WP_003899525.1.52495 WP_003899525.1.52504 WP_003899525.1.52522 WP_003899525.1.52531 WP_003899525.1.52533 WP_003899525.1.52545 WP_003899525.1.52553 WP_003899525.1.52563 WP_003899525.1.52564 WP_003899525.1.52574 WP_003899525.1.52641 WP_003899525.1.52673 WP_003899525.1.52674 WP_003899525.1.52708 WP_003899525.1.52713 WP_003899525.1.52761 WP_003899525.1.52778 WP_003899525.1.52791 WP_003899525.1.52797 WP_003899525.1.52818 WP_003899525.1.52872 WP_003899525.1.52873 WP_003899525.1.52891 WP_003899525.1.52892 WP_003899525.1.52909 WP_003899525.1.52970 WP_003899525.1.52998 WP_003899525.1.53053 WP_003899525.1.53056 WP_003899525.1.5306 WP_003899525.1.53088 WP_003899525.1.5309 WP_003899525.1.531 WP_003899525.1.53117 WP_003899525.1.53118 WP_003899525.1.53142 WP_003899525.1.53143 WP_003899525.1.53157 WP_003899525.1.53167 WP_003899525.1.53204 WP_003899525.1.53213 WP_003899525.1.53217 WP_003899525.1.53226 WP_003899525.1.53229 WP_003899525.1.53230 WP_003899525.1.53237 WP_003899525.1.53254 WP_003899525.1.53257 WP_003899525.1.5327 WP_003899525.1.53276 WP_003899525.1.53278 WP_003899525.1.533 WP_003899525.1.53302 WP_003899525.1.53306 WP_003899525.1.5334 WP_003899525.1.5335 WP_003899525.1.53353 WP_003899525.1.53381 WP_003899525.1.53413 WP_003899525.1.53458 WP_003899525.1.53460 WP_003899525.1.53480 WP_003899525.1.53517 WP_003899525.1.53522 WP_003899525.1.53525 WP_003899525.1.53526 WP_003899525.1.53553 WP_003899525.1.53606 WP_003899525.1.53609 WP_003899525.1.53628 WP_003899525.1.53643 WP_003899525.1.53667 WP_003899525.1.53679 WP_003899525.1.53715 WP_003899525.1.53730 WP_003899525.1.53742 WP_003899525.1.53754 WP_003899525.1.53775 WP_003899525.1.53787 WP_003899525.1.53803 WP_003899525.1.53818 WP_003899525.1.53822 WP_003899525.1.53853 WP_003899525.1.53865 WP_003899525.1.53888 WP_003899525.1.53900 WP_003899525.1.53912 WP_003899525.1.53914 WP_003899525.1.53952 WP_003899525.1.53973 WP_003899525.1.5398 WP_003899525.1.5408 WP_003899525.1.54089 WP_003899525.1.54093 WP_003899525.1.54099 WP_003899525.1.54112 WP_003899525.1.54125 WP_003899525.1.54141 WP_003899525.1.54162 WP_003899525.1.54179 WP_003899525.1.54206 WP_003899525.1.54218 WP_003899525.1.54225 WP_003899525.1.54227 WP_003899525.1.54232 WP_003899525.1.54241 WP_003899525.1.54245 WP_003899525.1.54247 WP_003899525.1.54260 WP_003899525.1.54275 WP_003899525.1.54280 WP_003899525.1.5429 WP_003899525.1.54294 WP_003899525.1.54314 WP_003899525.1.54347 WP_003899525.1.54351 WP_003899525.1.54370 WP_003899525.1.54428 WP_003899525.1.54449 WP_003899525.1.54494 WP_003899525.1.54502 WP_003899525.1.54514 WP_003899525.1.54519 WP_003899525.1.5452 WP_003899525.1.54531 WP_003899525.1.54537 WP_003899525.1.54553 WP_003899525.1.54555 WP_003899525.1.54575 WP_003899525.1.54633 WP_003899525.1.54686 WP_003899525.1.54687 WP_003899525.1.54705 WP_003899525.1.54730 WP_003899525.1.54732 WP_003899525.1.5475 WP_003899525.1.54797 WP_003899525.1.54807 WP_003899525.1.54836 WP_003899525.1.54838 WP_003899525.1.54860 WP_003899525.1.54888 WP_003899525.1.54897 WP_003899525.1.54905 WP_003899525.1.54909 WP_003899525.1.54937 WP_003899525.1.54939 WP_003899525.1.54944 WP_003899525.1.54945 WP_003899525.1.54953 WP_003899525.1.54964 WP_003899525.1.55015 WP_003899525.1.55022 WP_003899525.1.55023 WP_003899525.1.55051 WP_003899525.1.55072 WP_003899525.1.55088 WP_003899525.1.55106 WP_003899525.1.55126 WP_003899525.1.55128 WP_003899525.1.55140 WP_003899525.1.55150 WP_003899525.1.55210 WP_003899525.1.55227 WP_003899525.1.55248 WP_003899525.1.55257 WP_003899525.1.55258 WP_003899525.1.55267 WP_003899525.1.55279 WP_003899525.1.55307 WP_003899525.1.55326 WP_003899525.1.55328 WP_003899525.1.5533 WP_003899525.1.55345 WP_003899525.1.55396 WP_003899525.1.55398 WP_003899525.1.55441 WP_003899525.1.55459 WP_003899525.1.55501 WP_003899525.1.55504 WP_003899525.1.55578 WP_003899525.1.55626 WP_003899525.1.55641 WP_003899525.1.5569 WP_003899525.1.55723 WP_003899525.1.55735 WP_003899525.1.5574 WP_003899525.1.55772 WP_003899525.1.55802 WP_003899525.1.55807 WP_003899525.1.55819 WP_003899525.1.55821 WP_003899525.1.5583 WP_003899525.1.55849 WP_003899525.1.55856 WP_003899525.1.55860 WP_003899525.1.55882 WP_003899525.1.55883 WP_003899525.1.55894 WP_003899525.1.55902 WP_003899525.1.55909 WP_003899525.1.5591 WP_003899525.1.55961 WP_003899525.1.55977 WP_003899525.1.55983 WP_003899525.1.56028 WP_003899525.1.56057 WP_003899525.1.56060 WP_003899525.1.56107 WP_003899525.1.56132 WP_003899525.1.56163 WP_003899525.1.56167 WP_003899525.1.56178 WP_003899525.1.56287 WP_003899525.1.56292 WP_003899525.1.56327 WP_003899525.1.56341 WP_003899525.1.56359 WP_003899525.1.56365 WP_003899525.1.56394 WP_003899525.1.56443 WP_003899525.1.56473 WP_003899525.1.56478 WP_003899525.1.56500 WP_003899525.1.56517 WP_003899525.1.56534 WP_003899525.1.5656 WP_003899525.1.56577 WP_003899525.1.56593 WP_003899525.1.56625 WP_003899525.1.56637 WP_003899525.1.56670 WP_003899525.1.56697 WP_003899525.1.567 WP_003899525.1.56701 WP_003899525.1.56709 WP_003899525.1.56729 WP_003899525.1.56743 WP_003899525.1.56755 WP_003899525.1.56764 WP_003899525.1.56769 WP_003899525.1.56770 WP_003899525.1.5681 WP_003899525.1.56827 WP_003899525.1.56839 WP_003899525.1.56863 WP_003899525.1.56868 WP_003899525.1.56869 WP_003899525.1.56915 WP_003899525.1.56926 WP_003899525.1.56961 WP_003899525.1.56971 WP_003899525.1.56972 WP_003899525.1.57023 WP_003899525.1.57035 WP_003899525.1.57077 WP_003899525.1.57087 WP_003899525.1.57094 WP_003899525.1.57134 WP_003899525.1.57151 WP_003899525.1.57169 WP_003899525.1.57208 WP_003899525.1.57212 WP_003899525.1.57230 WP_003899525.1.5724 WP_003899525.1.5725 WP_003899525.1.5727 WP_003899525.1.57273 WP_003899525.1.573 WP_003899525.1.57314 WP_003899525.1.57326 WP_003899525.1.57328 WP_003899525.1.57331 WP_003899525.1.57340 WP_003899525.1.57351 WP_003899525.1.57352 WP_003899525.1.57380 WP_003899525.1.57430 WP_003899525.1.57440 WP_003899525.1.5745 WP_003899525.1.57461 WP_003899525.1.57469 WP_003899525.1.57489 WP_003899525.1.575 WP_003899525.1.57509 WP_003899525.1.57519 WP_003899525.1.57525 WP_003899525.1.57551 WP_003899525.1.5758 WP_003899525.1.57596 WP_003899525.1.57604 WP_003899525.1.57616 WP_003899525.1.57617 WP_003899525.1.57619 WP_003899525.1.57627 WP_003899525.1.57642 WP_003899525.1.57667 WP_003899525.1.57675 WP_003899525.1.57689 WP_003899525.1.57708 WP_003899525.1.57794 WP_003899525.1.57821 WP_003899525.1.57825 WP_003899525.1.57843 WP_003899525.1.57906 WP_003899525.1.57924 WP_003899525.1.57926 WP_003899525.1.57930 WP_003899525.1.57957 WP_003899525.1.57960 WP_003899525.1.57964 WP_003899525.1.57991 WP_003899525.1.58000 WP_003899525.1.58086 WP_003899525.1.58101 WP_003899525.1.58103 WP_003899525.1.58108 WP_003899525.1.5811 WP_003899525.1.58121 WP_003899525.1.58145 WP_003899525.1.58164 WP_003899525.1.58174 WP_003899525.1.582 WP_003899525.1.58202 WP_003899525.1.58209 WP_003899525.1.58215 WP_003899525.1.5824 WP_003899525.1.58250 WP_003899525.1.58259 WP_003899525.1.58283 WP_003899525.1.58288 WP_003899525.1.5830 WP_003899525.1.58303 WP_003899525.1.58330 WP_003899525.1.58359 WP_003899525.1.58386 WP_003899525.1.58393 WP_003899525.1.58431 WP_003899525.1.5844 WP_003899525.1.58457 WP_003899525.1.58488 WP_003899525.1.58518 WP_003899525.1.58534 WP_003899525.1.58559 WP_003899525.1.58567 WP_003899525.1.58573 WP_003899525.1.58602 WP_003899525.1.58612 WP_003899525.1.58619 WP_003899525.1.58630 WP_003899525.1.5865 WP_003899525.1.58671 WP_003899525.1.58690 WP_003899525.1.58702 WP_003899525.1.58743 WP_003899525.1.58754 WP_003899525.1.5879 WP_003899525.1.5881 WP_003899525.1.58824 WP_003899525.1.58848 WP_003899525.1.58857 WP_003899525.1.58891 WP_003899525.1.58892 WP_003899525.1.5890 WP_003899525.1.58904 WP_003899525.1.58921 WP_003899525.1.58930 WP_003899525.1.58939 WP_003899525.1.58941 WP_003899525.1.58953 WP_003899525.1.58961 WP_003899525.1.5898 WP_003899525.1.59025 WP_003899525.1.59029 WP_003899525.1.59037 WP_003899525.1.59044 WP_003899525.1.59085 WP_003899525.1.59088 WP_003899525.1.59112 WP_003899525.1.59130 WP_003899525.1.5914 WP_003899525.1.59147 WP_003899525.1.59166 WP_003899525.1.59205 WP_003899525.1.59209 WP_003899525.1.59237 WP_003899525.1.59240 WP_003899525.1.59253 WP_003899525.1.59254 WP_003899525.1.59262 WP_003899525.1.59270 WP_003899525.1.5928 WP_003899525.1.59304 WP_003899525.1.59305 WP_003899525.1.59309 WP_003899525.1.59316 WP_003899525.1.59326 WP_003899525.1.59328 WP_003899525.1.59333 WP_003899525.1.59338 WP_003899525.1.59388 WP_003899525.1.59428 WP_003899525.1.59487 WP_003899525.1.59537 WP_003899525.1.59561 WP_003899525.1.59677 WP_003899525.1.59722 WP_003899525.1.59727 WP_003899525.1.59732 WP_003899525.1.59738 WP_003899525.1.59750 WP_003899525.1.59757 WP_003899525.1.59761 WP_003899525.1.59808 WP_003899525.1.59850 WP_003899525.1.59856 WP_003899525.1.59860 WP_003899525.1.59861 WP_003899525.1.5987 WP_003899525.1.59878 WP_003899525.1.59888 WP_003899525.1.59952 WP_003899525.1.5996 WP_003899525.1.59961 WP_003899525.1.59974 WP_003899525.1.6000 WP_003899525.1.60007 WP_003899525.1.60016 WP_003899525.1.6003 WP_003899525.1.60047 WP_003899525.1.6007 WP_003899525.1.60091 WP_003899525.1.60121 WP_003899525.1.60125 WP_003899525.1.60135 WP_003899525.1.60139 WP_003899525.1.60152 WP_003899525.1.60171 WP_003899525.1.60197 WP_003899525.1.6020 WP_003899525.1.60205 WP_003899525.1.60207 WP_003899525.1.60215 WP_003899525.1.60217 WP_003899525.1.60267 WP_003899525.1.60288 WP_003899525.1.60291 WP_003899525.1.60301 WP_003899525.1.60305 WP_003899525.1.60312 WP_003899525.1.60313 WP_003899525.1.60314 WP_003899525.1.60367 WP_003899525.1.60376 WP_003899525.1.60403 WP_003899525.1.60413 WP_003899525.1.60421 WP_003899525.1.60451 WP_003899525.1.60460 WP_003899525.1.60479 WP_003899525.1.60487 WP_003899525.1.60512 WP_003899525.1.60573 WP_003899525.1.60583 WP_003899525.1.60632 WP_003899525.1.60657 WP_003899525.1.60687 WP_003899525.1.60689 WP_003899525.1.60727 WP_003899525.1.60738 WP_003899525.1.60763 WP_003899525.1.6077 WP_003899525.1.60791 WP_003899525.1.60834 WP_003899525.1.60870 WP_003899525.1.60878 WP_003899525.1.60879 WP_003899525.1.60913 WP_003899525.1.60978 WP_003899525.1.61000 WP_003899525.1.61001 WP_003899525.1.61012 WP_003899525.1.61014 WP_003899525.1.61015 WP_003899525.1.61037 WP_003899525.1.61052 WP_003899525.1.61065 WP_003899525.1.61100 WP_003899525.1.61101 WP_003899525.1.61138 WP_003899525.1.61142 WP_003899525.1.61198 WP_003899525.1.612 WP_003899525.1.61234 WP_003899525.1.61256 WP_003899525.1.61281 WP_003899525.1.61314 WP_003899525.1.61321 WP_003899525.1.61326 WP_003899525.1.61328 WP_003899525.1.61368 WP_003899525.1.61391 WP_003899525.1.61406 WP_003899525.1.61409 WP_003899525.1.61420 WP_003899525.1.61422 WP_003899525.1.61425 WP_003899525.1.61428 WP_003899525.1.61469 WP_003899525.1.61494 WP_003899525.1.61522 WP_003899525.1.61552 WP_003899525.1.61557 WP_003899525.1.61567 WP_003899525.1.61571 WP_003899525.1.61573 WP_003899525.1.61584 WP_003899525.1.61586 WP_003899525.1.6159 WP_003899525.1.61592 WP_003899525.1.6160 WP_003899525.1.61614 WP_003899525.1.6163 WP_003899525.1.61655 WP_003899525.1.61665 WP_003899525.1.61669 WP_003899525.1.61682 WP_003899525.1.61692 WP_003899525.1.61719 WP_003899525.1.61728 WP_003899525.1.61750 WP_003899525.1.61754 WP_003899525.1.61755 WP_003899525.1.61757 WP_003899525.1.61778 WP_003899525.1.6179 WP_003899525.1.61793 WP_003899525.1.61816 WP_003899525.1.61842 WP_003899525.1.61850 WP_003899525.1.61862 WP_003899525.1.61865 WP_003899525.1.61868 WP_003899525.1.61925 WP_003899525.1.61941 WP_003899525.1.61953 WP_003899525.1.61979 WP_003899525.1.61986 WP_003899525.1.61987 WP_003899525.1.61998 WP_003899525.1.62021 WP_003899525.1.62087 WP_003899525.1.62089 WP_003899525.1.62101 WP_003899525.1.62104 WP_003899525.1.6211 WP_003899525.1.62132 WP_003899525.1.62162 WP_003899525.1.62225 WP_003899525.1.62230 WP_003899525.1.62238 WP_003899525.1.62249 WP_003899525.1.62270 WP_003899525.1.62281 WP_003899525.1.62307 WP_003899525.1.6231 WP_003899525.1.62359 WP_003899525.1.62360 WP_003899525.1.62371 WP_003899525.1.62379 WP_003899525.1.62395 WP_003899525.1.62408 WP_003899525.1.62449 WP_003899525.1.62468 WP_003899525.1.6248 WP_003899525.1.62508 WP_003899525.1.62565 WP_003899525.1.62594 WP_003899525.1.62606 WP_003899525.1.62616 WP_003899525.1.62666 WP_003899525.1.62687 WP_003899525.1.62715 WP_003899525.1.62730 WP_003899525.1.62738 WP_003899525.1.62761 WP_003899525.1.62766 WP_003899525.1.62786 WP_003899525.1.62813 WP_003899525.1.62841 WP_003899525.1.62909 WP_003899525.1.62936 WP_003899525.1.6294 WP_003899525.1.6295 WP_003899525.1.62962 WP_003899525.1.63007 WP_003899525.1.63019 WP_003899525.1.63032 WP_003899525.1.63037 WP_003899525.1.63064 WP_003899525.1.63066 WP_003899525.1.63072 WP_003899525.1.6308 WP_003899525.1.63081 WP_003899525.1.63096 WP_003899525.1.63106 WP_003899525.1.6314 WP_003899525.1.63144 WP_003899525.1.63154 WP_003899525.1.63160 WP_003899525.1.63161 WP_003899525.1.63166 WP_003899525.1.63175 WP_003899525.1.63194 WP_003899525.1.6322 WP_003899525.1.63222 WP_003899525.1.63247 WP_003899525.1.6328 WP_003899525.1.63291 WP_003899525.1.63312 WP_003899525.1.63317 WP_003899525.1.63331 WP_003899525.1.63373 WP_003899525.1.63384 WP_003899525.1.63403 WP_003899525.1.63424 WP_003899525.1.63428 WP_003899525.1.6345 WP_003899525.1.63464 WP_003899525.1.63483 WP_003899525.1.63502 WP_003899525.1.63504 WP_003899525.1.63522 WP_003899525.1.63530 WP_003899525.1.63564 WP_003899525.1.63567 WP_003899525.1.63596 WP_003899525.1.63600 WP_003899525.1.63623 WP_003899525.1.63624 WP_003899525.1.63625 WP_003899525.1.63627 WP_003899525.1.63662 WP_003899525.1.63711 WP_003899525.1.63734 WP_003899525.1.63807 WP_003899525.1.63819 WP_003899525.1.63844 WP_003899525.1.63888 WP_003899525.1.63913 WP_003899525.1.63915 WP_003899525.1.63918 WP_003899525.1.63961 WP_003899525.1.63970 WP_003899525.1.64000 WP_003899525.1.64027 WP_003899525.1.64058 WP_003899525.1.64065 WP_003899525.1.6407 WP_003899525.1.64082 WP_003899525.1.64091 WP_003899525.1.64102 WP_003899525.1.64104 WP_003899525.1.64119 WP_003899525.1.64169 WP_003899525.1.64219 WP_003899525.1.6422 WP_003899525.1.64222 WP_003899525.1.64223 WP_003899525.1.64228 WP_003899525.1.64235 WP_003899525.1.64249 WP_003899525.1.64278 WP_003899525.1.64287 WP_003899525.1.64414 WP_003899525.1.64419 WP_003899525.1.6443 WP_003899525.1.64463 WP_003899525.1.64480 WP_003899525.1.64497 WP_003899525.1.64506 WP_003899525.1.64511 WP_003899525.1.64514 WP_003899525.1.64515 WP_003899525.1.64522 WP_003899525.1.64526 WP_003899525.1.64543 WP_003899525.1.6456 WP_003899525.1.64567 WP_003899525.1.64588 WP_003899525.1.64589 WP_003899525.1.64594 WP_003899525.1.64595 WP_003899525.1.64608 WP_003899525.1.64619 WP_003899525.1.64629 WP_003899525.1.6464 WP_003899525.1.64664 WP_003899525.1.64669 WP_003899525.1.64672 WP_003899525.1.64680 WP_003899525.1.64682 WP_003899525.1.64727 WP_003899525.1.64729 WP_003899525.1.64774 WP_003899525.1.64776 WP_003899525.1.64802 WP_003899525.1.64832 WP_003899525.1.6486 WP_003899525.1.64870 WP_003899525.1.64898 WP_003899525.1.64922 WP_003899525.1.64924 WP_003899525.1.64937 WP_003899525.1.64941 WP_003899525.1.64966 WP_003899525.1.64973 WP_003899525.1.65001 WP_003899525.1.65026 WP_003899525.1.65053 WP_003899525.1.65070 WP_003899525.1.65079 WP_003899525.1.65102 WP_003899525.1.65157 WP_003899525.1.65181 WP_003899525.1.65212 WP_003899525.1.65229 WP_003899525.1.6523 WP_003899525.1.65253 WP_003899525.1.65289 WP_003899525.1.65291 WP_003899525.1.65315 WP_003899525.1.65329 WP_003899525.1.65359 WP_003899525.1.6536 WP_003899525.1.65374 WP_003899525.1.65386 WP_003899525.1.65414 WP_003899525.1.65416 WP_003899525.1.65433 WP_003899525.1.65455 WP_003899525.1.65467 WP_003899525.1.65488 WP_003899525.1.65529 WP_003899525.1.65539 WP_003899525.1.65583 WP_003899525.1.65612 WP_003899525.1.65623 WP_003899525.1.65635 WP_003899525.1.65637 WP_003899525.1.65648 WP_003899525.1.65683 WP_003899525.1.65686 WP_003899525.1.65688 WP_003899525.1.65707 WP_003899525.1.65733 WP_003899525.1.65746 WP_003899525.1.65747 WP_003899525.1.65759 WP_003899525.1.65816 WP_003899525.1.65830 WP_003899525.1.65858 WP_003899525.1.65862 WP_003899525.1.65869 WP_003899525.1.65893 WP_003899525.1.65929 WP_003899525.1.65932 WP_003899525.1.65958 WP_003899525.1.65974 WP_003899525.1.66004 WP_003899525.1.66013 WP_003899525.1.6606 WP_003899525.1.66149 WP_003899525.1.66151 WP_003899525.1.66229 WP_003899525.1.66276 WP_003899525.1.66293 WP_003899525.1.66297 WP_003899525.1.66323 WP_003899525.1.66325 WP_003899525.1.6633 WP_003899525.1.66334 WP_003899525.1.66355 WP_003899525.1.66367 WP_003899525.1.66394 WP_003899525.1.66396 WP_003899525.1.66451 WP_003899525.1.66457 WP_003899525.1.66460 WP_003899525.1.66464 WP_003899525.1.66466 WP_003899525.1.66487 WP_003899525.1.66504 WP_003899525.1.66544 WP_003899525.1.66580 WP_003899525.1.66582 WP_003899525.1.66612 WP_003899525.1.66615 WP_003899525.1.66617 WP_003899525.1.66635 WP_003899525.1.66656 WP_003899525.1.66675 WP_003899525.1.66715 WP_003899525.1.66718 WP_003899525.1.66762 WP_003899525.1.66776 WP_003899525.1.66808 WP_003899525.1.66817 WP_003899525.1.66819 WP_003899525.1.66826 WP_003899525.1.66830 WP_003899525.1.66842 WP_003899525.1.66868 WP_003899525.1.66878 WP_003899525.1.66880 WP_003899525.1.66893 WP_003899525.1.66961 WP_003899525.1.67005 WP_003899525.1.6704 WP_003899525.1.67044 WP_003899525.1.67061 WP_003899525.1.67089 WP_003899525.1.67098 WP_003899525.1.67146 WP_003899525.1.67170 WP_003899525.1.67197 WP_003899525.1.67198 WP_003899525.1.6720 WP_003899525.1.67207 WP_003899525.1.67218 WP_003899525.1.67220 WP_003899525.1.67225 WP_003899525.1.67231 WP_003899525.1.6724 WP_003899525.1.67257 WP_003899525.1.67298 WP_003899525.1.67307 WP_003899525.1.67324 WP_003899525.1.67332 WP_003899525.1.67346 WP_003899525.1.67354 WP_003899525.1.67360 WP_003899525.1.67381 WP_003899525.1.67396 WP_003899525.1.67417 WP_003899525.1.67422 WP_003899525.1.67453 WP_003899525.1.67459 WP_003899525.1.6746 WP_003899525.1.67473 WP_003899525.1.67481 WP_003899525.1.67482 WP_003899525.1.67496 WP_003899525.1.67499 WP_003899525.1.67516 WP_003899525.1.67523 WP_003899525.1.67536 WP_003899525.1.67575 WP_003899525.1.67587 WP_003899525.1.67598 WP_003899525.1.67600 WP_003899525.1.67602 WP_003899525.1.67630 WP_003899525.1.67679 WP_003899525.1.67692 WP_003899525.1.67744 WP_003899525.1.6775 WP_003899525.1.67750 WP_003899525.1.6777 WP_003899525.1.67809 WP_003899525.1.67816 WP_003899525.1.67844 WP_003899525.1.67848 WP_003899525.1.67870 WP_003899525.1.67888 WP_003899525.1.67915 WP_003899525.1.67945 WP_003899525.1.67949 WP_003899525.1.67980 WP_003899525.1.67982 WP_003899525.1.68022 WP_003899525.1.68029 WP_003899525.1.68037 WP_003899525.1.68038 WP_003899525.1.68045 WP_003899525.1.68057 WP_003899525.1.68083 WP_003899525.1.68088 WP_003899525.1.68106 WP_003899525.1.68110 WP_003899525.1.68153 WP_003899525.1.68164 WP_003899525.1.68169 WP_003899525.1.68193 WP_003899525.1.68212 WP_003899525.1.68227 WP_003899525.1.68243 WP_003899525.1.6825 WP_003899525.1.68297 WP_003899525.1.68309 WP_003899525.1.68325 WP_003899525.1.68329 WP_003899525.1.68340 WP_003899525.1.68384 WP_003899525.1.68388 WP_003899525.1.68429 WP_003899525.1.6843 WP_003899525.1.68433 WP_003899525.1.68444 WP_003899525.1.68465 WP_003899525.1.68484 WP_003899525.1.68518 WP_003899525.1.68569 WP_003899525.1.68576 WP_003899525.1.68580 WP_003899525.1.68586 WP_003899525.1.68623 WP_003899525.1.68624 WP_003899525.1.68637 WP_003899525.1.68646 WP_003899525.1.68667 WP_003899525.1.68669 WP_003899525.1.68672 WP_003899525.1.68684 WP_003899525.1.68704 WP_003899525.1.68708 WP_003899525.1.6872 WP_003899525.1.68730 WP_003899525.1.68734 WP_003899525.1.68748 WP_003899525.1.68754 WP_003899525.1.6876 WP_003899525.1.68761 WP_003899525.1.68763 WP_003899525.1.68766 WP_003899525.1.68774 WP_003899525.1.68796 WP_003899525.1.68824 WP_003899525.1.68832 WP_003899525.1.68833 WP_003899525.1.68841 WP_003899525.1.68859 WP_003899525.1.68876 WP_003899525.1.68906 WP_003899525.1.68916 WP_003899525.1.68923 WP_003899525.1.68945 WP_003899525.1.6896 WP_003899525.1.68981 WP_003899525.1.68984 WP_003899525.1.68997 WP_003899525.1.69008 WP_003899525.1.69076 WP_003899525.1.69079 WP_003899525.1.6908 WP_003899525.1.69082 WP_003899525.1.69178 WP_003899525.1.69181 WP_003899525.1.69208 WP_003899525.1.69231 WP_003899525.1.69256 WP_003899525.1.69311 WP_003899525.1.69315 WP_003899525.1.69322 WP_003899525.1.69342 WP_003899525.1.6935 WP_003899525.1.6936 WP_003899525.1.69369 WP_003899525.1.69374 WP_003899525.1.69398 WP_003899525.1.69401 WP_003899525.1.69426 WP_003899525.1.69427 WP_003899525.1.69429 WP_003899525.1.6949 WP_003899525.1.6951 WP_003899525.1.69511 WP_003899525.1.69526 WP_003899525.1.69528 WP_003899525.1.69547 WP_003899525.1.69573 WP_003899525.1.69581 WP_003899525.1.6960 WP_003899525.1.69617 WP_003899525.1.69634 WP_003899525.1.69647 WP_003899525.1.69659 WP_003899525.1.69673 WP_003899525.1.69682 WP_003899525.1.69684 WP_003899525.1.69686 WP_003899525.1.69707 WP_003899525.1.69709 WP_003899525.1.69723 WP_003899525.1.69736 WP_003899525.1.69778 WP_003899525.1.69800 WP_003899525.1.69802 WP_003899525.1.69845 WP_003899525.1.69870 WP_003899525.1.69873 WP_003899525.1.69898 WP_003899525.1.69913 WP_003899525.1.69925 WP_003899525.1.69931 WP_003899525.1.69938 WP_003899525.1.69955 WP_003899525.1.69957 WP_003899525.1.69981 WP_003899525.1.69990 WP_003899525.1.70 WP_003899525.1.70000 WP_003899525.1.70017 WP_003899525.1.70032 WP_003899525.1.70055 WP_003899525.1.70062 WP_003899525.1.70072 WP_003899525.1.70131 WP_003899525.1.70132 WP_003899525.1.7022 WP_003899525.1.70227 WP_003899525.1.70255 WP_003899525.1.70271 WP_003899525.1.70274 WP_003899525.1.7029 WP_003899525.1.70325 WP_003899525.1.70328 WP_003899525.1.70356 WP_003899525.1.70364 WP_003899525.1.70368 WP_003899525.1.70369 WP_003899525.1.70418 WP_003899525.1.70422 WP_003899525.1.70435 WP_003899525.1.70444 WP_003899525.1.70463 WP_003899525.1.70471 WP_003899525.1.70480 WP_003899525.1.70494 WP_003899525.1.70498 WP_003899525.1.70505 WP_003899525.1.70525 WP_003899525.1.70573 WP_003899525.1.70577 WP_003899525.1.70610 WP_003899525.1.70615 WP_003899525.1.70618 WP_003899525.1.70622 WP_003899525.1.70626 WP_003899525.1.70668 WP_003899525.1.70699 WP_003899525.1.70704 WP_003899525.1.70729 WP_003899525.1.70757 WP_003899525.1.70782 WP_003899525.1.70796 WP_003899525.1.70830 WP_003899525.1.70834 WP_003899525.1.7084 WP_003899525.1.70840 WP_003899525.1.70864 WP_003899525.1.70871 WP_003899525.1.70915 WP_003899525.1.70955 WP_003899525.1.70958 WP_003899525.1.70964 WP_003899525.1.70976 WP_003899525.1.71015 WP_003899525.1.71026 WP_003899525.1.71063 WP_003899525.1.71076 WP_003899525.1.71083 WP_003899525.1.7111 WP_003899525.1.71118 WP_003899525.1.71128 WP_003899525.1.7113 WP_003899525.1.71187 WP_003899525.1.71191 WP_003899525.1.71255 WP_003899525.1.71258 WP_003899525.1.71259 WP_003899525.1.71289 WP_003899525.1.71326 WP_003899525.1.71329 WP_003899525.1.71331 WP_003899525.1.71344 WP_003899525.1.71390 WP_003899525.1.71399 WP_003899525.1.71414 WP_003899525.1.71457 WP_003899525.1.7146 WP_003899525.1.71464 WP_003899525.1.71490 WP_003899525.1.71492 WP_003899525.1.71509 WP_003899525.1.71516 WP_003899525.1.71517 WP_003899525.1.71527 WP_003899525.1.71532 WP_003899525.1.71545 WP_003899525.1.71546 WP_003899525.1.71569 WP_003899525.1.71604 WP_003899525.1.71621 WP_003899525.1.71630 WP_003899525.1.71638 WP_003899525.1.71654 WP_003899525.1.71664 WP_003899525.1.71665 WP_003899525.1.71683 WP_003899525.1.71701 WP_003899525.1.71731 WP_003899525.1.71778 WP_003899525.1.71781 WP_003899525.1.71803 WP_003899525.1.71820 WP_003899525.1.71847 WP_003899525.1.7185 WP_003899525.1.71851 WP_003899525.1.71871 WP_003899525.1.71909 WP_003899525.1.71957 WP_003899525.1.71970 WP_003899525.1.72047 WP_003899525.1.72061 WP_003899525.1.72062 WP_003899525.1.72072 WP_003899525.1.72111 WP_003899525.1.72122 WP_003899525.1.72128 WP_003899525.1.72143 WP_003899525.1.7216 WP_003899525.1.72168 WP_003899525.1.72179 WP_003899525.1.72209 WP_003899525.1.72218 WP_003899525.1.72219 WP_003899525.1.72227 WP_003899525.1.7224 WP_003899525.1.72268 WP_003899525.1.72332 WP_003899525.1.72380 WP_003899525.1.72401 WP_003899525.1.72405 WP_003899525.1.72420 WP_003899525.1.72441 WP_003899525.1.72451 WP_003899525.1.72452 WP_003899525.1.72457 WP_003899525.1.72459 WP_003899525.1.72460 WP_003899525.1.72466 WP_003899525.1.72487 WP_003899525.1.72488 WP_003899525.1.72492 WP_003899525.1.72506 WP_003899525.1.72543 WP_003899525.1.7256 WP_003899525.1.72576 WP_003899525.1.72578 WP_003899525.1.72585 WP_003899525.1.72591 WP_003899525.1.72592 WP_003899525.1.72640 WP_003899525.1.7266 WP_003899525.1.72661 WP_003899525.1.72684 WP_003899525.1.72739 WP_003899525.1.72744 WP_003899525.1.72755 WP_003899525.1.72759 WP_003899525.1.72784 WP_003899525.1.72792 WP_003899525.1.72826 WP_003899525.1.72831 WP_003899525.1.72853 WP_003899525.1.72879 WP_003899525.1.72880 WP_003899525.1.72938 WP_003899525.1.72954 WP_003899525.1.72957 WP_003899525.1.72959 WP_003899525.1.72973 WP_003899525.1.7298 WP_003899525.1.72982 WP_003899525.1.72988 WP_003899525.1.72993 WP_003899525.1.73006 WP_003899525.1.73013 WP_003899525.1.73025 WP_003899525.1.73028 WP_003899525.1.73042 WP_003899525.1.73045 WP_003899525.1.73092 WP_003899525.1.73118 WP_003899525.1.7312 WP_003899525.1.73127 WP_003899525.1.73134 WP_003899525.1.73150 WP_003899525.1.73154 WP_003899525.1.73163 WP_003899525.1.73182 WP_003899525.1.73205 WP_003899525.1.7321 WP_003899525.1.73310 WP_003899525.1.73315 WP_003899525.1.73365 WP_003899525.1.73391 WP_003899525.1.73404 WP_003899525.1.73424 WP_003899525.1.73436 WP_003899525.1.73445 WP_003899525.1.73453 WP_003899525.1.73465 WP_003899525.1.73466 WP_003899525.1.73470 WP_003899525.1.73471 WP_003899525.1.73478 WP_003899525.1.73482 WP_003899525.1.73507 WP_003899525.1.73532 WP_003899525.1.73550 WP_003899525.1.73564 WP_003899525.1.73623 WP_003899525.1.73629 WP_003899525.1.7366 WP_003899525.1.73661 WP_003899525.1.7368 WP_003899525.1.73688 WP_003899525.1.73723 WP_003899525.1.73744 WP_003899525.1.73750 WP_003899525.1.73760 WP_003899525.1.73774 WP_003899525.1.73813 WP_003899525.1.73840 WP_003899525.1.73876 WP_003899525.1.7389 WP_003899525.1.73986 WP_003899525.1.74016 WP_003899525.1.74039 WP_003899525.1.74083 WP_003899525.1.74101 WP_003899525.1.74107 WP_003899525.1.74120 WP_003899525.1.74129 WP_003899525.1.74144 WP_003899525.1.7417 WP_003899525.1.74190 WP_003899525.1.74210 WP_003899525.1.7423 WP_003899525.1.74259 WP_003899525.1.74262 WP_003899525.1.74269 WP_003899525.1.74282 WP_003899525.1.74291 WP_003899525.1.74296 WP_003899525.1.74304 WP_003899525.1.7432 WP_003899525.1.74347 WP_003899525.1.7436 WP_003899525.1.74378 WP_003899525.1.74382 WP_003899525.1.74395 WP_003899525.1.74400 WP_003899525.1.74401 WP_003899525.1.74432 WP_003899525.1.74442 WP_003899525.1.74477 WP_003899525.1.74487 WP_003899525.1.74499 WP_003899525.1.74504 WP_003899525.1.74511 WP_003899525.1.74523 WP_003899525.1.74525 WP_003899525.1.74551 WP_003899525.1.74555 WP_003899525.1.74628 WP_003899525.1.74641 WP_003899525.1.74653 WP_003899525.1.74660 WP_003899525.1.74683 WP_003899525.1.7469 WP_003899525.1.74725 WP_003899525.1.74760 WP_003899525.1.74786 WP_003899525.1.74809 WP_003899525.1.74820 WP_003899525.1.74870 WP_003899525.1.74881 WP_003899525.1.74888 WP_003899525.1.74952 WP_003899525.1.7496 WP_003899525.1.74988 WP_003899525.1.75043 WP_003899525.1.75045 WP_003899525.1.75055 WP_003899525.1.75078 WP_003899525.1.75081 WP_003899525.1.75120 WP_003899525.1.75163 WP_003899525.1.75188 WP_003899525.1.75200 WP_003899525.1.75202 WP_003899525.1.75234 WP_003899525.1.75239 WP_003899525.1.75250 WP_003899525.1.75263 WP_003899525.1.75281 WP_003899525.1.75342 WP_003899525.1.7535 WP_003899525.1.75376 WP_003899525.1.75391 WP_003899525.1.75395 WP_003899525.1.75441 WP_003899525.1.75510 WP_003899525.1.75581 WP_003899525.1.75598 WP_003899525.1.75635 WP_003899525.1.75645 WP_003899525.1.75665 WP_003899525.1.75671 WP_003899525.1.75741 WP_003899525.1.75749 WP_003899525.1.75772 WP_003899525.1.75774 WP_003899525.1.75811 WP_003899525.1.75833 WP_003899525.1.7585 WP_003899525.1.75864 WP_003899525.1.75868 WP_003899525.1.75878 WP_003899525.1.75927 WP_003899525.1.75946 WP_003899525.1.75968 WP_003899525.1.75974 WP_003899525.1.76007 WP_003899525.1.76016 WP_003899525.1.76032 WP_003899525.1.76037 WP_003899525.1.7604 WP_003899525.1.76045 WP_003899525.1.76052 WP_003899525.1.76058 WP_003899525.1.76064 WP_003899525.1.76110 WP_003899525.1.76126 WP_003899525.1.76133 WP_003899525.1.76138 WP_003899525.1.76157 WP_003899525.1.76172 WP_003899525.1.76177 WP_003899525.1.76183 WP_003899525.1.76239 WP_003899525.1.76272 WP_003899525.1.76277 WP_003899525.1.76280 WP_003899525.1.76281 WP_003899525.1.76291 WP_003899525.1.76297 WP_003899525.1.76360 WP_003899525.1.76379 WP_003899525.1.76403 WP_003899525.1.76413 WP_003899525.1.76414 WP_003899525.1.76427 WP_003899525.1.76436 WP_003899525.1.76442 WP_003899525.1.76443 WP_003899525.1.76456 WP_003899525.1.76521 WP_003899525.1.76533 WP_003899525.1.76616 WP_003899525.1.76625 WP_003899525.1.76629 WP_003899525.1.76635 WP_003899525.1.76638 WP_003899525.1.76639 WP_003899525.1.76640 WP_003899525.1.76644 WP_003899525.1.76677 WP_003899525.1.76678 WP_003899525.1.76679 WP_003899525.1.76734 WP_003899525.1.76744 WP_003899525.1.76750 WP_003899525.1.76754 WP_003899525.1.76757 WP_003899525.1.76781 WP_003899525.1.76818 WP_003899525.1.76824 WP_003899525.1.76835 WP_003899525.1.76873 WP_003899525.1.76881 WP_003899525.1.76888 WP_003899525.1.7691 WP_003899525.1.76947 WP_003899525.1.76954 WP_003899525.1.76955 WP_003899525.1.76963 WP_003899525.1.76976 WP_003899525.1.770 WP_003899525.1.77000 WP_003899525.1.77008 WP_003899525.1.77021 WP_003899525.1.77056 WP_003899525.1.77075 WP_003899525.1.77093 WP_003899525.1.77107 WP_003899525.1.77115 WP_003899525.1.77118 WP_003899525.1.77125 WP_003899525.1.77141 WP_003899525.1.77142 WP_003899525.1.77166 WP_003899525.1.77250 WP_003899525.1.77252 WP_003899525.1.77260 WP_003899525.1.77266 WP_003899525.1.77280 WP_003899525.1.77285 WP_003899525.1.77312 WP_003899525.1.77348 WP_003899525.1.77351 WP_003899525.1.77352 WP_003899525.1.77361 WP_003899525.1.774 WP_003899525.1.7740 WP_003899525.1.77404 WP_003899525.1.77425 WP_003899525.1.77463 WP_003899525.1.77474 WP_003899525.1.7748 WP_003899525.1.77484 WP_003899525.1.77491 WP_003899525.1.77499 WP_003899525.1.77510 WP_003899525.1.77530 WP_003899525.1.77554 WP_003899525.1.77559 WP_003899525.1.77599 WP_003899525.1.7762 WP_003899525.1.77627 WP_003899525.1.77649 WP_003899525.1.77654 WP_003899525.1.7766 WP_003899525.1.77667 WP_003899525.1.77704 WP_003899525.1.77706 WP_003899525.1.77726 WP_003899525.1.77774 WP_003899525.1.7778 WP_003899525.1.77790 WP_003899525.1.77809 WP_003899525.1.77820 WP_003899525.1.77843 WP_003899525.1.77855 WP_003899525.1.77865 WP_003899525.1.77868 WP_003899525.1.77879 WP_003899525.1.77890 WP_003899525.1.77909 WP_003899525.1.77911 WP_003899525.1.77984 WP_003899525.1.78020 WP_003899525.1.78024 WP_003899525.1.78075 WP_003899525.1.78084 WP_003899525.1.78086 WP_003899525.1.7809 WP_003899525.1.78098 WP_003899525.1.78105 WP_003899525.1.78113 WP_003899525.1.78136 WP_003899525.1.7817 WP_003899525.1.78200 WP_003899525.1.78216 WP_003899525.1.78236 WP_003899525.1.78238 WP_003899525.1.78322 WP_003899525.1.78338 WP_003899525.1.7836 WP_003899525.1.78360 WP_003899525.1.78386 WP_003899525.1.78429 WP_003899525.1.78435 WP_003899525.1.7844 WP_003899525.1.78459 WP_003899525.1.78488 WP_003899525.1.7849 WP_003899525.1.78499 WP_003899525.1.785 WP_003899525.1.78516 WP_003899525.1.78524 WP_003899525.1.78526 WP_003899525.1.78538 WP_003899525.1.78544 WP_003899525.1.78545 WP_003899525.1.78547 WP_003899525.1.78574 WP_003899525.1.78580 WP_003899525.1.7860 WP_003899525.1.78620 WP_003899525.1.78646 WP_003899525.1.78648 WP_003899525.1.78649 WP_003899525.1.78655 WP_003899525.1.78657 WP_003899525.1.78659 WP_003899525.1.7869 WP_003899525.1.78692 WP_003899525.1.78760 WP_003899525.1.78766 WP_003899525.1.78776 WP_003899525.1.78778 WP_003899525.1.78784 WP_003899525.1.78788 WP_003899525.1.78790 WP_003899525.1.78793 WP_003899525.1.78848 WP_003899525.1.78860 WP_003899525.1.7887 WP_003899525.1.78884 WP_003899525.1.78932 WP_003899525.1.78969 WP_003899525.1.78977 WP_003899525.1.78980 WP_003899525.1.79005 WP_003899525.1.79016 WP_003899525.1.79033 WP_003899525.1.79064 WP_003899525.1.79066 WP_003899525.1.79068 WP_003899525.1.79077 WP_003899525.1.79095 WP_003899525.1.79112 WP_003899525.1.79122 WP_003899525.1.79145 WP_003899525.1.79152 WP_003899525.1.79163 WP_003899525.1.79182 WP_003899525.1.79198 WP_003899525.1.79213 WP_003899525.1.79218 WP_003899525.1.79268 WP_003899525.1.79273 WP_003899525.1.79278 WP_003899525.1.79290 WP_003899525.1.79319 WP_003899525.1.79325 WP_003899525.1.79326 WP_003899525.1.7933 WP_003899525.1.79330 WP_003899525.1.79339 WP_003899525.1.79394 WP_003899525.1.79399 WP_003899525.1.79413 WP_003899525.1.79422 WP_003899525.1.79445 WP_003899525.1.79447 WP_003899525.1.79455 WP_003899525.1.79471 WP_003899525.1.79480 WP_003899525.1.79482 WP_003899525.1.79488 WP_003899525.1.79500 WP_003899525.1.79502 WP_003899525.1.79508 WP_003899525.1.79514 WP_003899525.1.79561 WP_003899525.1.79565 WP_003899525.1.79578 WP_003899525.1.79588 WP_003899525.1.79598 WP_003899525.1.79615 WP_003899525.1.79684 WP_003899525.1.79698 WP_003899525.1.797 WP_003899525.1.79744 WP_003899525.1.79784 WP_003899525.1.79802 WP_003899525.1.79806 WP_003899525.1.79819 WP_003899525.1.79826 WP_003899525.1.79828 WP_003899525.1.79851 WP_003899525.1.79853 WP_003899525.1.79863 WP_003899525.1.79885 WP_003899525.1.79898 WP_003899525.1.7990 WP_003899525.1.79900 WP_003899525.1.79913 WP_003899525.1.79918 WP_003899525.1.79947 WP_003899525.1.79948 WP_003899525.1.7995 WP_003899525.1.7997 WP_003899525.1.80004 WP_003899525.1.80015 WP_003899525.1.80022 WP_003899525.1.80030 WP_003899525.1.80054 WP_003899525.1.80084 WP_003899525.1.80099 WP_003899525.1.80129 WP_003899525.1.80177 WP_003899525.1.80234 WP_003899525.1.8026 WP_003899525.1.80275 WP_003899525.1.8029 WP_003899525.1.80299 WP_003899525.1.80300 WP_003899525.1.80304 WP_003899525.1.80326 WP_003899525.1.80351 WP_003899525.1.8037 WP_003899525.1.80370 WP_003899525.1.80387 WP_003899525.1.80399 WP_003899525.1.8044 WP_003899525.1.80458 WP_003899525.1.80461 WP_003899525.1.80490 WP_003899525.1.80507 WP_003899525.1.80552 WP_003899525.1.80576 WP_003899525.1.80588 WP_003899525.1.80599 WP_003899525.1.8060 WP_003899525.1.80624 WP_003899525.1.80636 WP_003899525.1.80673 WP_003899525.1.80711 WP_003899525.1.80714 WP_003899525.1.80743 WP_003899525.1.80784 WP_003899525.1.80815 WP_003899525.1.80853 WP_003899525.1.80918 WP_003899525.1.8093 WP_003899525.1.80967 WP_003899525.1.8097 WP_003899525.1.80988 WP_003899525.1.81007 WP_003899525.1.81013 WP_003899525.1.8105 WP_003899525.1.81059 WP_003899525.1.81063 WP_003899525.1.81066 WP_003899525.1.81075 WP_003899525.1.81091 WP_003899525.1.81119 WP_003899525.1.81125 WP_003899525.1.81136 WP_003899525.1.8114 WP_003899525.1.81189 WP_003899525.1.81192 WP_003899525.1.812 WP_003899525.1.81230 WP_003899525.1.81249 WP_003899525.1.81250 WP_003899525.1.81264 WP_003899525.1.8128 WP_003899525.1.81287 WP_003899525.1.81297 WP_003899525.1.8138 WP_003899525.1.81407 WP_003899525.1.8143 WP_003899525.1.81439 WP_003899525.1.81465 WP_003899525.1.81505 WP_003899525.1.81529 WP_003899525.1.81538 WP_003899525.1.81541 WP_003899525.1.81560 WP_003899525.1.81561 WP_003899525.1.81567 WP_003899525.1.81583 WP_003899525.1.81686 WP_003899525.1.81712 WP_003899525.1.81720 WP_003899525.1.81731 WP_003899525.1.81774 WP_003899525.1.81788 WP_003899525.1.81809 WP_003899525.1.81820 WP_003899525.1.81850 WP_003899525.1.81883 WP_003899525.1.81891 WP_003899525.1.81911 WP_003899525.1.81918 WP_003899525.1.82011 WP_003899525.1.82048 WP_003899525.1.82069 WP_003899525.1.82071 WP_003899525.1.82108 WP_003899525.1.82136 WP_003899525.1.82142 WP_003899525.1.8215 WP_003899525.1.82158 WP_003899525.1.8217 WP_003899525.1.82209 WP_003899525.1.82210 WP_003899525.1.82228 WP_003899525.1.82236 WP_003899525.1.82251 WP_003899525.1.82271 WP_003899525.1.82305 WP_003899525.1.82307 WP_003899525.1.82309 WP_003899525.1.82317 WP_003899525.1.8232 WP_003899525.1.82346 WP_003899525.1.82374 WP_003899525.1.82385 WP_003899525.1.82429 WP_003899525.1.82460 WP_003899525.1.82483 WP_003899525.1.82494 WP_003899525.1.82531 WP_003899525.1.82546 WP_003899525.1.82549 WP_003899525.1.82577 WP_003899525.1.82592 WP_003899525.1.82597 WP_003899525.1.82598 WP_003899525.1.82625 WP_003899525.1.82642 WP_003899525.1.82651 WP_003899525.1.82653 WP_003899525.1.82681 WP_003899525.1.82685 WP_003899525.1.8271 WP_003899525.1.82712 WP_003899525.1.8273 WP_003899525.1.82743 WP_003899525.1.82757 WP_003899525.1.82774 WP_003899525.1.82803 WP_003899525.1.82836 WP_003899525.1.82860 WP_003899525.1.82871 WP_003899525.1.82892 WP_003899525.1.82935 WP_003899525.1.82957 WP_003899525.1.82973 WP_003899525.1.82981 WP_003899525.1.82983 WP_003899525.1.83004 WP_003899525.1.83009 WP_003899525.1.83044 WP_003899525.1.83065 WP_003899525.1.83074 WP_003899525.1.83110 WP_003899525.1.83146 WP_003899525.1.83149 WP_003899525.1.83159 WP_003899525.1.8317 WP_003899525.1.83173 WP_003899525.1.83181 WP_003899525.1.83182 WP_003899525.1.83191 WP_003899525.1.83197 WP_003899525.1.83212 WP_003899525.1.8326 WP_003899525.1.83262 WP_003899525.1.83268 WP_003899525.1.83273 WP_003899525.1.83309 WP_003899525.1.83332 WP_003899525.1.83334 WP_003899525.1.83341 WP_003899525.1.83349 WP_003899525.1.8335 WP_003899525.1.83353 WP_003899525.1.83367 WP_003899525.1.83380 WP_003899525.1.83381 WP_003899525.1.83389 WP_003899525.1.83408 WP_003899525.1.83409 WP_003899525.1.83435 WP_003899525.1.83470 WP_003899525.1.83524 WP_003899525.1.83526 WP_003899525.1.8358 WP_003899525.1.83589 WP_003899525.1.83601 WP_003899525.1.83611 WP_003899525.1.83638 WP_003899525.1.83648 WP_003899525.1.83656 WP_003899525.1.83667 WP_003899525.1.83689 WP_003899525.1.83692 WP_003899525.1.83704 WP_003899525.1.83705 WP_003899525.1.83766 WP_003899525.1.83793 WP_003899525.1.83794 WP_003899525.1.83802 WP_003899525.1.83805 WP_003899525.1.83839 WP_003899525.1.83842 WP_003899525.1.83850 WP_003899525.1.83861 WP_003899525.1.83884 WP_003899525.1.83920 WP_003899525.1.83929 WP_003899525.1.83930 WP_003899525.1.83975 WP_003899525.1.83991 WP_003899525.1.8400 WP_003899525.1.84027 WP_003899525.1.8404 WP_003899525.1.84057 WP_003899525.1.84070 WP_003899525.1.8409 WP_003899525.1.84112 WP_003899525.1.84146 WP_003899525.1.8415 WP_003899525.1.84176 WP_003899525.1.84186 WP_003899525.1.84192 WP_003899525.1.84228 WP_003899525.1.8424 WP_003899525.1.84244 WP_003899525.1.84259 WP_003899525.1.8426 WP_003899525.1.84277 WP_003899525.1.84287 WP_003899525.1.8434 WP_003899525.1.84388 WP_003899525.1.84408 WP_003899525.1.84409 WP_003899525.1.84438 WP_003899525.1.84460 WP_003899525.1.84488 WP_003899525.1.84504 WP_003899525.1.84525 WP_003899525.1.84620 WP_003899525.1.84623 WP_003899525.1.84641 WP_003899525.1.84655 WP_003899525.1.84666 WP_003899525.1.84670 WP_003899525.1.84739 WP_003899525.1.84748 WP_003899525.1.84766 WP_003899525.1.84772 WP_003899525.1.84774 WP_003899525.1.848 WP_003899525.1.84812 WP_003899525.1.84836 WP_003899525.1.84839 WP_003899525.1.84846 WP_003899525.1.84873 WP_003899525.1.84911 WP_003899525.1.84938 WP_003899525.1.84968 WP_003899525.1.84973 WP_003899525.1.84981 WP_003899525.1.84985 WP_003899525.1.8503 WP_003899525.1.85038 WP_003899525.1.85041 WP_003899525.1.85043 WP_003899525.1.8505 WP_003899525.1.85074 WP_003899525.1.8509 WP_003899525.1.8512 WP_003899525.1.85148 WP_003899525.1.8518 WP_003899525.1.8522 WP_003899525.1.85242 WP_003899525.1.85276 WP_003899525.1.85281 WP_003899525.1.85284 WP_003899525.1.85314 WP_003899525.1.85319 WP_003899525.1.85330 WP_003899525.1.85341 WP_003899525.1.85346 WP_003899525.1.8535 WP_003899525.1.85363 WP_003899525.1.85371 WP_003899525.1.85377 WP_003899525.1.85387 WP_003899525.1.85399 WP_003899525.1.85458 WP_003899525.1.8546 WP_003899525.1.85464 WP_003899525.1.85478 WP_003899525.1.85480 WP_003899525.1.85488 WP_003899525.1.85495 WP_003899525.1.85551 WP_003899525.1.85557 WP_003899525.1.85577 WP_003899525.1.85597 WP_003899525.1.85599 WP_003899525.1.85610 WP_003899525.1.8563 WP_003899525.1.85648 WP_003899525.1.85679 WP_003899525.1.85704 WP_003899525.1.85717 WP_003899525.1.85727 WP_003899525.1.85737 WP_003899525.1.85763 WP_003899525.1.85808 WP_003899525.1.85819 WP_003899525.1.85820 WP_003899525.1.85823 WP_003899525.1.85832 WP_003899525.1.8586 WP_003899525.1.85872 WP_003899525.1.85894 WP_003899525.1.85909 WP_003899525.1.85913 WP_003899525.1.85953 WP_003899525.1.85986 WP_003899525.1.86000 WP_003899525.1.86024 WP_003899525.1.86025 WP_003899525.1.86032 WP_003899525.1.86048 WP_003899525.1.86052 WP_003899525.1.86067 WP_003899525.1.86103 WP_003899525.1.86122 WP_003899525.1.86124 WP_003899525.1.86160 WP_003899525.1.86164 WP_003899525.1.86168 WP_003899525.1.86190 WP_003899525.1.86204 WP_003899525.1.86208 WP_003899525.1.86235 WP_003899525.1.86249 WP_003899525.1.86260 WP_003899525.1.86290 WP_003899525.1.863 WP_003899525.1.86327 WP_003899525.1.86334 WP_003899525.1.86337 WP_003899525.1.86368 WP_003899525.1.86377 WP_003899525.1.86425 WP_003899525.1.86459 WP_003899525.1.8649 WP_003899525.1.86499 WP_003899525.1.86520 WP_003899525.1.86561 WP_003899525.1.86568 WP_003899525.1.86575 WP_003899525.1.86584 WP_003899525.1.86605 WP_003899525.1.86626 WP_003899525.1.86648 WP_003899525.1.8666 WP_003899525.1.86684 WP_003899525.1.86696 WP_003899525.1.86705 WP_003899525.1.86718 WP_003899525.1.86725 WP_003899525.1.86757 WP_003899525.1.86766 WP_003899525.1.86801 WP_003899525.1.86814 WP_003899525.1.86820 WP_003899525.1.86825 WP_003899525.1.86834 WP_003899525.1.8685 WP_003899525.1.86851 WP_003899525.1.86855 WP_003899525.1.86867 WP_003899525.1.86877 WP_003899525.1.86883 WP_003899525.1.8689 WP_003899525.1.86892 WP_003899525.1.86933 WP_003899525.1.86941 WP_003899525.1.86950 WP_003899525.1.86962 WP_003899525.1.86963 WP_003899525.1.86979 WP_003899525.1.8700 WP_003899525.1.87001 WP_003899525.1.87002 WP_003899525.1.87031 WP_003899525.1.87116 WP_003899525.1.87117 WP_003899525.1.8714 WP_003899525.1.87162 WP_003899525.1.87178 WP_003899525.1.87191 WP_003899525.1.87201 WP_003899525.1.87209 WP_003899525.1.87240 WP_003899525.1.87266 WP_003899525.1.87273 WP_003899525.1.87275 WP_003899525.1.8733 WP_003899525.1.87345 WP_003899525.1.87369 WP_003899525.1.8737 WP_003899525.1.87401 WP_003899525.1.87404 WP_003899525.1.87406 WP_003899525.1.87409 WP_003899525.1.87444 WP_003899525.1.87446 WP_003899525.1.87459 WP_003899525.1.87472 WP_003899525.1.87489 WP_003899525.1.87494 WP_003899525.1.87496 WP_003899525.1.87582 WP_003899525.1.87588 WP_003899525.1.87617 WP_003899525.1.87619 WP_003899525.1.87620 WP_003899525.1.87634 WP_003899525.1.87643 WP_003899525.1.8765 WP_003899525.1.87650 WP_003899525.1.87654 WP_003899525.1.87658 WP_003899525.1.87665 WP_003899525.1.87676 WP_003899525.1.87677 WP_003899525.1.87684 WP_003899525.1.87692 WP_003899525.1.87707 WP_003899525.1.87732 WP_003899525.1.87784 WP_003899525.1.87796 WP_003899525.1.87809 WP_003899525.1.87817 WP_003899525.1.87827 WP_003899525.1.87831 WP_003899525.1.87835 WP_003899525.1.87837 WP_003899525.1.87866 WP_003899525.1.8789 WP_003899525.1.87911 WP_003899525.1.87924 WP_003899525.1.87951 WP_003899525.1.87955 WP_003899525.1.87956 WP_003899525.1.87991 WP_003899525.1.88 WP_003899525.1.88002 WP_003899525.1.88037 WP_003899525.1.88039 WP_003899525.1.88072 WP_003899525.1.88121 WP_003899525.1.88180 WP_003899525.1.88191 WP_003899525.1.88205 WP_003899525.1.88217 WP_003899525.1.88219 WP_003899525.1.88245 WP_003899525.1.88253 WP_003899525.1.88294 WP_003899525.1.88315 WP_003899525.1.88316 WP_003899525.1.88320 WP_003899525.1.88338 WP_003899525.1.8840 WP_003899525.1.88437 WP_003899525.1.88453 WP_003899525.1.88469 WP_003899525.1.88489 WP_003899525.1.88507 WP_003899525.1.88521 WP_003899525.1.88530 WP_003899525.1.88537 WP_003899525.1.88541 WP_003899525.1.88592 WP_003899525.1.88616 WP_003899525.1.88618 WP_003899525.1.8862 WP_003899525.1.88625 WP_003899525.1.88632 WP_003899525.1.88634 WP_003899525.1.88649 WP_003899525.1.8870 WP_003899525.1.88737 WP_003899525.1.88756 WP_003899525.1.888 WP_003899525.1.88824 WP_003899525.1.88886 WP_003899525.1.88965 WP_003899525.1.88985 WP_003899525.1.8902 WP_003899525.1.89025 WP_003899525.1.89041 WP_003899525.1.89046 WP_003899525.1.89082 WP_003899525.1.89162 WP_003899525.1.89168 WP_003899525.1.8917 WP_003899525.1.89193 WP_003899525.1.89205 WP_003899525.1.89207 WP_003899525.1.89225 WP_003899525.1.8925 WP_003899525.1.89277 WP_003899525.1.89286 WP_003899525.1.89293 WP_003899525.1.89320 WP_003899525.1.8935 WP_003899525.1.89371 WP_003899525.1.89378 WP_003899525.1.89392 WP_003899525.1.89406 WP_003899525.1.8943 WP_003899525.1.89451 WP_003899525.1.89453 WP_003899525.1.89473 WP_003899525.1.89475 WP_003899525.1.89483 WP_003899525.1.895 WP_003899525.1.89513 WP_003899525.1.89517 WP_003899525.1.89522 WP_003899525.1.8954 WP_003899525.1.89543 WP_003899525.1.89567 WP_003899525.1.8957 WP_003899525.1.89572 WP_003899525.1.89589 WP_003899525.1.89607 WP_003899525.1.89613 WP_003899525.1.89625 WP_003899525.1.89648 WP_003899525.1.8967 WP_003899525.1.89670 WP_003899525.1.89676 WP_003899525.1.89729 WP_003899525.1.89739 WP_003899525.1.89762 WP_003899525.1.8977 WP_003899525.1.89802 WP_003899525.1.89808 WP_003899525.1.8982 WP_003899525.1.89829 WP_003899525.1.89831 WP_003899525.1.89844 WP_003899525.1.89849 WP_003899525.1.8989 WP_003899525.1.89901 WP_003899525.1.89903 WP_003899525.1.89909 WP_003899525.1.8992 WP_003899525.1.89922 WP_003899525.1.89926 WP_003899525.1.89963 WP_003899525.1.89971 WP_003899525.1.8998 WP_003899525.1.89987 WP_003899525.1.900 WP_003899525.1.90048 WP_003899525.1.9007 WP_003899525.1.90080 WP_003899525.1.90130 WP_003899525.1.90134 WP_003899525.1.90137 WP_003899525.1.90157 WP_003899525.1.90184 WP_003899525.1.90199 WP_003899525.1.90231 WP_003899525.1.90245 WP_003899525.1.90308 WP_003899525.1.90322 WP_003899525.1.90328 WP_003899525.1.90372 WP_003899525.1.90439 WP_003899525.1.90481 WP_003899525.1.90499 WP_003899525.1.9050 WP_003899525.1.90527 WP_003899525.1.90550 WP_003899525.1.90560 WP_003899525.1.90612 WP_003899525.1.90640 WP_003899525.1.90672 WP_003899525.1.90687 WP_003899525.1.90691 WP_003899525.1.90711 WP_003899525.1.90722 WP_003899525.1.90744 WP_003899525.1.9075 WP_003899525.1.90756 WP_003899525.1.90767 WP_003899525.1.90771 WP_003899525.1.90785 WP_003899525.1.90788 WP_003899525.1.90800 WP_003899525.1.90810 WP_003899525.1.90816 WP_003899525.1.90819 WP_003899525.1.9082 WP_003899525.1.90831 WP_003899525.1.90884 WP_003899525.1.90899 WP_003899525.1.90906 WP_003899525.1.90958 WP_003899525.1.90976 WP_003899525.1.90977 WP_003899525.1.90987 WP_003899525.1.9102 WP_003899525.1.91026 WP_003899525.1.91032 WP_003899525.1.91043 WP_003899525.1.91053 WP_003899525.1.91082 WP_003899525.1.91106 WP_003899525.1.91112 WP_003899525.1.91144 WP_003899525.1.91151 WP_003899525.1.91157 WP_003899525.1.91167 WP_003899525.1.91169 WP_003899525.1.91192 WP_003899525.1.91201 WP_003899525.1.91207 WP_003899525.1.91208 WP_003899525.1.91211 WP_003899525.1.91214 WP_003899525.1.91230 WP_003899525.1.91244 WP_003899525.1.91251 WP_003899525.1.91260 WP_003899525.1.91265 WP_003899525.1.9128 WP_003899525.1.91284 WP_003899525.1.91294 WP_003899525.1.91303 WP_003899525.1.91322 WP_003899525.1.91352 WP_003899525.1.91386 WP_003899525.1.9139 WP_003899525.1.91398 WP_003899525.1.91411 WP_003899525.1.91430 WP_003899525.1.91436 WP_003899525.1.91483 WP_003899525.1.91496 WP_003899525.1.91507 WP_003899525.1.91508 WP_003899525.1.91576 WP_003899525.1.91589 WP_003899525.1.91694 WP_003899525.1.91695 WP_003899525.1.91713 WP_003899525.1.91716 WP_003899525.1.91717 WP_003899525.1.91728 WP_003899525.1.91743 WP_003899525.1.91759 WP_003899525.1.91784 WP_003899525.1.91785 WP_003899525.1.91786 WP_003899525.1.91802 WP_003899525.1.91822 WP_003899525.1.91828 WP_003899525.1.9189 WP_003899525.1.91896 WP_003899525.1.9190 WP_003899525.1.91915 WP_003899525.1.91931 WP_003899525.1.91937 WP_003899525.1.91944 WP_003899525.1.91953 WP_003899525.1.91957 WP_003899525.1.91976 WP_003899525.1.91978 WP_003899525.1.92021 WP_003899525.1.92083 WP_003899525.1.92127 WP_003899525.1.92144 WP_003899525.1.92150 WP_003899525.1.92153 WP_003899525.1.92190 WP_003899525.1.92192 WP_003899525.1.92200 WP_003899525.1.92220 WP_003899525.1.92221 WP_003899525.1.92222 WP_003899525.1.92273 WP_003899525.1.92289 WP_003899525.1.9229 WP_003899525.1.92294 WP_003899525.1.92300 WP_003899525.1.92317 WP_003899525.1.92334 WP_003899525.1.92338 WP_003899525.1.92345 WP_003899525.1.92356 WP_003899525.1.92364 WP_003899525.1.92380 WP_003899525.1.92416 WP_003899525.1.92428 WP_003899525.1.92447 WP_003899525.1.92456 WP_003899525.1.92467 WP_003899525.1.92471 WP_003899525.1.92490 WP_003899525.1.92508 WP_003899525.1.9251 WP_003899525.1.92511 WP_003899525.1.92523 WP_003899525.1.92527 WP_003899525.1.92536 WP_003899525.1.92592 WP_003899525.1.92597 WP_003899525.1.92603 WP_003899525.1.92606 WP_003899525.1.92610 WP_003899525.1.92613 WP_003899525.1.9263 WP_003899525.1.9265 WP_003899525.1.92650 WP_003899525.1.92660 WP_003899525.1.92677 WP_003899525.1.92685 WP_003899525.1.92689 WP_003899525.1.92690 WP_003899525.1.92706 WP_003899525.1.92736 WP_003899525.1.9274 WP_003899525.1.92752 WP_003899525.1.92760 WP_003899525.1.92777 WP_003899525.1.92803 WP_003899525.1.92833 WP_003899525.1.92856 WP_003899525.1.92881 WP_003899525.1.92892 WP_003899525.1.92907 WP_003899525.1.92908 WP_003899525.1.9291 WP_003899525.1.92917 WP_003899525.1.92996 WP_003899525.1.93006 WP_003899525.1.93008 WP_003899525.1.93009 WP_003899525.1.93015 WP_003899525.1.93043 WP_003899525.1.9307 WP_003899525.1.93083 WP_003899525.1.93137 WP_003899525.1.93192 WP_003899525.1.93199 WP_003899525.1.93203 WP_003899525.1.93212 WP_003899525.1.93234 WP_003899525.1.93245 WP_003899525.1.93257 WP_003899525.1.93265 WP_003899525.1.93297 WP_003899525.1.93320 WP_003899525.1.93328 WP_003899525.1.93337 WP_003899525.1.93343 WP_003899525.1.93349 WP_003899525.1.93363 WP_003899525.1.93377 WP_003899525.1.9338 WP_003899525.1.93407 WP_003899525.1.93417 WP_003899525.1.93419 WP_003899525.1.93426 WP_003899525.1.9344 WP_003899525.1.93443 WP_003899525.1.93447 WP_003899525.1.93470 WP_003899525.1.93483 WP_003899525.1.93487 WP_003899525.1.93495 WP_003899525.1.93499 WP_003899525.1.93516 WP_003899525.1.93536 WP_003899525.1.93544 WP_003899525.1.93555 WP_003899525.1.93560 WP_003899525.1.93564 WP_003899525.1.9357 WP_003899525.1.93573 WP_003899525.1.93576 WP_003899525.1.93588 WP_003899525.1.9363 WP_003899525.1.93645 WP_003899525.1.93649 WP_003899525.1.93659 WP_003899525.1.93677 WP_003899525.1.9368 WP_003899525.1.93689 WP_003899525.1.93693 WP_003899525.1.93698 WP_003899525.1.93706 WP_003899525.1.9371 WP_003899525.1.93792 WP_003899525.1.93823 WP_003899525.1.93871 WP_003899525.1.9388 WP_003899525.1.93894 WP_003899525.1.93903 WP_003899525.1.93907 WP_003899525.1.93913 WP_003899525.1.93946 WP_003899525.1.93950 WP_003899525.1.93953 WP_003899525.1.93954 WP_003899525.1.93988 WP_003899525.1.9407 WP_003899525.1.94154 WP_003899525.1.94184 WP_003899525.1.94204 WP_003899525.1.94205 WP_003899525.1.94226 WP_003899525.1.94231 WP_003899525.1.94256 WP_003899525.1.94261 WP_003899525.1.94281 WP_003899525.1.94292 WP_003899525.1.94297 WP_003899525.1.9431 WP_003899525.1.94326 WP_003899525.1.94339 WP_003899525.1.94392 WP_003899525.1.94416 WP_003899525.1.94421 WP_003899525.1.94456 WP_003899525.1.94470 WP_003899525.1.94480 WP_003899525.1.94495 WP_003899525.1.94511 WP_003899525.1.94512 WP_003899525.1.94525 WP_003899525.1.94528 WP_003899525.1.94564 WP_003899525.1.946 WP_003899525.1.94602 WP_003899525.1.94623 WP_003899525.1.94629 WP_003899525.1.9465 WP_003899525.1.94673 WP_003899525.1.94714 WP_003899525.1.94730 WP_003899525.1.94736 WP_003899525.1.94776 WP_003899525.1.9478 WP_003899525.1.94834 WP_003899525.1.94852 WP_003899525.1.94872 WP_003899525.1.9488 WP_003899525.1.94902 WP_003899525.1.94916 WP_003899525.1.94979 WP_003899525.1.94994 WP_003899525.1.94996 WP_003899525.1.94998 WP_003899525.1.95007 WP_003899525.1.95010 WP_003899525.1.95015 WP_003899525.1.95034 WP_003899525.1.95068 WP_003899525.1.95081 WP_003899525.1.95082 WP_003899525.1.9509 WP_003899525.1.95096 WP_003899525.1.95112 WP_003899525.1.95138 WP_003899525.1.9514 WP_003899525.1.95179 WP_003899525.1.95188 WP_003899525.1.95190 WP_003899525.1.95234 WP_003899525.1.95241 WP_003899525.1.95245 WP_003899525.1.95257 WP_003899525.1.95279 WP_003899525.1.9531 WP_003899525.1.95335 WP_003899525.1.95344 WP_003899525.1.9535 WP_003899525.1.95370 WP_003899525.1.95392 WP_003899525.1.95416 WP_003899525.1.95417 WP_003899525.1.95454 WP_003899525.1.95455 WP_003899525.1.95491 WP_003899525.1.95497 WP_003899525.1.95508 WP_003899525.1.95509 WP_003899525.1.95529 WP_003899525.1.95556 WP_003899525.1.95557 WP_003899525.1.95565 WP_003899525.1.95578 WP_003899525.1.95580 WP_003899525.1.95585 WP_003899525.1.95643 WP_003899525.1.95679 WP_003899525.1.95685 WP_003899525.1.957 WP_003899525.1.95724 WP_003899525.1.95727 WP_003899525.1.95730 WP_003899525.1.95735 WP_003899525.1.95758 WP_003899525.1.95772 WP_003899525.1.95797 WP_003899525.1.95839 WP_003899525.1.9585 WP_003899525.1.9590 WP_003899525.1.95902 WP_003899525.1.95908 WP_003899525.1.95924 WP_003899525.1.95926 WP_003899525.1.95953 WP_003899525.1.95958 WP_003899525.1.95964 WP_003899525.1.95973 WP_003899525.1.96006 WP_003899525.1.9602 WP_003899525.1.96036 WP_003899525.1.96062 WP_003899525.1.96065 WP_003899525.1.96098 WP_003899525.1.96146 WP_003899525.1.96166 WP_003899525.1.96171 WP_003899525.1.96182 WP_003899525.1.96204 WP_003899525.1.96230 WP_003899525.1.96235 WP_003899525.1.96242 WP_003899525.1.96245 WP_003899525.1.96254 WP_003899525.1.96259 WP_003899525.1.96286 WP_003899525.1.96313 WP_003899525.1.96318 WP_003899525.1.96345 WP_003899525.1.96360 WP_003899525.1.96373 WP_003899525.1.96456 WP_003899525.1.96486 WP_003899525.1.96560 WP_003899525.1.96569 WP_003899525.1.96573 WP_003899525.1.96575 WP_003899525.1.96576 WP_003899525.1.96611 WP_003899525.1.96621 WP_003899525.1.96681 WP_003899525.1.96726 WP_003899525.1.96733 WP_003899525.1.96742 WP_003899525.1.96754 WP_003899525.1.9678 WP_003899525.1.96832 WP_003899525.1.9685 WP_003899525.1.97008 WP_003899525.1.97009 WP_003899525.1.97056 WP_003899525.1.97084 WP_003899525.1.97087 WP_003899525.1.97094 WP_003899525.1.97096 WP_003899525.1.97099 WP_003899525.1.97108 WP_003899525.1.97113 WP_003899525.1.97127 WP_003899525.1.97129 WP_003899525.1.97136 WP_003899525.1.9716 WP_003899525.1.97176 WP_003899525.1.97222 WP_003899525.1.97223 WP_003899525.1.97237 WP_003899525.1.97242 WP_003899525.1.97270 WP_003899525.1.97283 WP_003899525.1.97296 WP_003899525.1.97321 WP_003899525.1.97325 WP_003899525.1.97330 WP_003899525.1.97366 WP_003899525.1.97376 WP_003899525.1.97380 WP_003899525.1.9739 WP_003899525.1.97462 WP_003899525.1.97517 WP_003899525.1.97519 WP_003899525.1.97535 WP_003899525.1.97540 WP_003899525.1.97545 WP_003899525.1.97546 WP_003899525.1.97550 WP_003899525.1.97568 WP_003899525.1.97577 WP_003899525.1.97584 WP_003899525.1.9759 WP_003899525.1.97596 WP_003899525.1.97609 WP_003899525.1.97618 WP_003899525.1.9763 WP_003899525.1.97669 WP_003899525.1.97673 WP_003899525.1.97700 WP_003899525.1.97701 WP_003899525.1.9773 WP_003899525.1.97730 WP_003899525.1.97740 WP_003899525.1.97751 WP_003899525.1.97754 WP_003899525.1.97797 WP_003899525.1.9782 WP_003899525.1.9784 WP_003899525.1.97888 WP_003899525.1.9790 WP_003899525.1.9795 WP_003899525.1.97951 WP_003899525.1.97958 WP_003899525.1.97966 WP_003899525.1.97977 WP_003899525.1.97979 WP_003899525.1.97995 WP_003899525.1.98018 WP_003899525.1.98034 WP_003899525.1.98052 WP_003899525.1.98071 WP_003899525.1.98072 WP_003899525.1.98113 WP_003899525.1.98114 WP_003899525.1.98128 WP_003899525.1.98181 WP_003899525.1.98188 WP_003899525.1.98189 WP_003899525.1.98213 WP_003899525.1.98225 WP_003899525.1.98291 WP_003899525.1.98335 WP_003899525.1.98350 WP_003899525.1.98395 WP_003899525.1.98412 WP_003899525.1.98441 WP_003899525.1.98443 WP_003899525.1.98462 WP_003899525.1.9848 WP_003899525.1.98482 WP_003899525.1.98486 WP_003899525.1.98488 WP_003899525.1.98503 WP_003899525.1.98516 WP_003899525.1.98524 WP_003899525.1.98536 WP_003899525.1.98566 WP_003899525.1.98576 WP_003899525.1.98590 WP_003899525.1.98594 WP_003899525.1.98599 WP_003899525.1.98629 WP_003899525.1.98645 WP_003899525.1.98646 WP_003899525.1.98649 WP_003899525.1.98656 WP_003899525.1.9867 WP_003899525.1.98674 WP_003899525.1.98701 WP_003899525.1.98739 WP_003899525.1.98749 WP_003899525.1.98765 WP_003899525.1.98770 WP_003899525.1.98777 WP_003899525.1.98778 WP_003899525.1.98802 WP_003899525.1.98838 WP_003899525.1.98850 WP_003899525.1.98906 WP_003899525.1.98935 WP_003899525.1.98948 WP_003899525.1.98953 WP_003899525.1.98984 WP_003899525.1.99000 WP_003899525.1.99023 WP_003899525.1.99030 WP_003899525.1.99037 WP_003899525.1.99055 WP_003899525.1.99062 WP_003899525.1.99086 WP_003899525.1.99115 WP_003899525.1.99117 WP_003899525.1.99161 WP_003899525.1.99176 WP_003899525.1.99205 WP_003899525.1.99211 WP_003899525.1.99216 WP_003899525.1.99222 WP_003899525.1.99251 WP_003899525.1.99269 WP_003899525.1.99294 WP_003899525.1.99312 WP_003899525.1.99315 WP_003899525.1.99316 WP_003899525.1.99322 WP_003899525.1.99328 WP_003899525.1.99365 WP_003899525.1.99368 WP_003899525.1.99379 WP_003899525.1.99402 WP_003899525.1.99404 WP_003899525.1.99419 WP_003899525.1.99438 WP_003899525.1.99460 WP_003899525.1.99468 WP_003899525.1.99473 WP_003899525.1.99513 WP_003899525.1.99548 WP_003899525.1.99572 WP_003899525.1.99575 WP_003899525.1.99578 WP_003899525.1.99605 WP_003899525.1.99609 WP_003899525.1.99617 WP_003899525.1.99635 WP_003899525.1.99650 WP_003899525.1.99672 WP_003899525.1.99701 WP_003899525.1.99711 WP_003899525.1.99716 WP_003899525.1.99745 WP_003899525.1.99749 WP_003899525.1.9976 WP_003899525.1.99798 WP_003899525.1.99817 WP_003899525.1.99832 WP_003899525.1.99847 WP_003899525.1.99852 WP_003899525.1.99886 WP_003899525.1.99897 WP_003899525.1.99899 WP_003899525.1.99915 WP_003899525.1.9993 WP_003899525.1.99982 WP_003899525.1.99991 gi|15610024|ref|NP_217403.1| gi|121638768|ref|YP_978992.1| gi|471338909|ref|YP_007611622.1| gi|506927429|ref|YP_008007880.1| rv2887 gi|340627877|ref|YP_004746329.1| gi|479056851|ref|YP_007352657.1| gi|15610024|ref|NP_217403.1| 233413.Mb2911 410289.BCG_2908 419947.MRA_2912 478434.TBMG_01084 561275.JTY_2903 83331.MT2955 83332.Rv2887 gi|385999671|ref|YP_005917970.1| gi|433631981|ref|YP_007265609.1| gi|392387513|ref|YP_005309142.1| gi|197738517|ref|YP_002159833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]