SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197738713|ref|YP_002160028.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197738713|ref|YP_002160028.1|
Domain Number 1 Region: 12-146
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.01e-40
Family HxlR-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197738713|ref|YP_002160028.1|
Sequence length 158
Comment transcriptional regulator [Mycobacterium tuberculosis str. Haarlem]
Sequence
MAVSDLSHRFEGESVGRALELVGERWTLLILREAFFGVRRFGQLARNLGIPRPTLSSRLR
MLVEVGLFDRVPYSSDPERHEYRLTEAGRDLFAAIVVLMQWGDEYLPRPEGPPIKLRHHT
CGEHADPRLICTHCGEEITARNVTPEPGPGFKAKLASS
Download sequence
Identical sequences A0A045GQS4 A0A083VVF2 A0A0H3LEX3 A0A0H3M8R6 A0A0K2I071 A0A109SZZ2 A0A120IY89 A0A197IUD6 A0A1S1BFT3 A5U7B0 F8M5M8 G0TGU6 I6X684 M8CIK7 P0A649 P9WMG3 R4MM31
gi|339633103|ref|YP_004724745.1| gi|253797805|ref|YP_003030806.1| gi|148824287|ref|YP_001289041.1| gi|433628236|ref|YP_007261865.1| NP_217611.1.84033 WP_003416099.1.100000 WP_003416099.1.100021 WP_003416099.1.100069 WP_003416099.1.100087 WP_003416099.1.10015 WP_003416099.1.100208 WP_003416099.1.100216 WP_003416099.1.10022 WP_003416099.1.100255 WP_003416099.1.100260 WP_003416099.1.100270 WP_003416099.1.100279 WP_003416099.1.100286 WP_003416099.1.100308 WP_003416099.1.100309 WP_003416099.1.100318 WP_003416099.1.100337 WP_003416099.1.100338 WP_003416099.1.10037 WP_003416099.1.100383 WP_003416099.1.100395 WP_003416099.1.100396 WP_003416099.1.1004 WP_003416099.1.100401 WP_003416099.1.100459 WP_003416099.1.100460 WP_003416099.1.100552 WP_003416099.1.100581 WP_003416099.1.100600 WP_003416099.1.100625 WP_003416099.1.10064 WP_003416099.1.100666 WP_003416099.1.100671 WP_003416099.1.100677 WP_003416099.1.100682 WP_003416099.1.100697 WP_003416099.1.100703 WP_003416099.1.100716 WP_003416099.1.100722 WP_003416099.1.100754 WP_003416099.1.100757 WP_003416099.1.100772 WP_003416099.1.1008 WP_003416099.1.100812 WP_003416099.1.100845 WP_003416099.1.100866 WP_003416099.1.10088 WP_003416099.1.100889 WP_003416099.1.10090 WP_003416099.1.100910 WP_003416099.1.100915 WP_003416099.1.100918 WP_003416099.1.100935 WP_003416099.1.100984 WP_003416099.1.100992 WP_003416099.1.100998 WP_003416099.1.101 WP_003416099.1.101025 WP_003416099.1.101028 WP_003416099.1.10104 WP_003416099.1.101048 WP_003416099.1.101054 WP_003416099.1.101075 WP_003416099.1.101143 WP_003416099.1.101146 WP_003416099.1.10116 WP_003416099.1.10117 WP_003416099.1.101209 WP_003416099.1.10125 WP_003416099.1.101290 WP_003416099.1.101323 WP_003416099.1.101324 WP_003416099.1.101350 WP_003416099.1.101367 WP_003416099.1.101398 WP_003416099.1.101403 WP_003416099.1.101421 WP_003416099.1.10144 WP_003416099.1.101442 WP_003416099.1.10145 WP_003416099.1.101452 WP_003416099.1.101456 WP_003416099.1.101481 WP_003416099.1.101493 WP_003416099.1.101496 WP_003416099.1.101525 WP_003416099.1.101533 WP_003416099.1.101535 WP_003416099.1.101553 WP_003416099.1.101558 WP_003416099.1.10156 WP_003416099.1.101573 WP_003416099.1.101576 WP_003416099.1.10159 WP_003416099.1.101592 WP_003416099.1.101604 WP_003416099.1.101607 WP_003416099.1.101622 WP_003416099.1.101644 WP_003416099.1.101659 WP_003416099.1.101671 WP_003416099.1.101687 WP_003416099.1.101698 WP_003416099.1.10170 WP_003416099.1.101713 WP_003416099.1.101722 WP_003416099.1.101733 WP_003416099.1.101743 WP_003416099.1.101753 WP_003416099.1.101754 WP_003416099.1.101764 WP_003416099.1.101773 WP_003416099.1.101795 WP_003416099.1.101797 WP_003416099.1.101798 WP_003416099.1.101802 WP_003416099.1.101826 WP_003416099.1.101836 WP_003416099.1.101858 WP_003416099.1.101859 WP_003416099.1.101862 WP_003416099.1.101888 WP_003416099.1.101894 WP_003416099.1.101899 WP_003416099.1.1019 WP_003416099.1.101923 WP_003416099.1.101925 WP_003416099.1.10193 WP_003416099.1.101996 WP_003416099.1.102 WP_003416099.1.102008 WP_003416099.1.102017 WP_003416099.1.102053 WP_003416099.1.102055 WP_003416099.1.102063 WP_003416099.1.102099 WP_003416099.1.1021 WP_003416099.1.10211 WP_003416099.1.102119 WP_003416099.1.102121 WP_003416099.1.102143 WP_003416099.1.10216 WP_003416099.1.10224 WP_003416099.1.10253 WP_003416099.1.10262 WP_003416099.1.10272 WP_003416099.1.10277 WP_003416099.1.1033 WP_003416099.1.10350 WP_003416099.1.10362 WP_003416099.1.10366 WP_003416099.1.10376 WP_003416099.1.10396 WP_003416099.1.10410 WP_003416099.1.10414 WP_003416099.1.10421 WP_003416099.1.10430 WP_003416099.1.1044 WP_003416099.1.10440 WP_003416099.1.10445 WP_003416099.1.10471 WP_003416099.1.10472 WP_003416099.1.10489 WP_003416099.1.105 WP_003416099.1.10518 WP_003416099.1.10523 WP_003416099.1.10545 WP_003416099.1.1057 WP_003416099.1.10594 WP_003416099.1.10603 WP_003416099.1.10606 WP_003416099.1.10615 WP_003416099.1.10623 WP_003416099.1.10635 WP_003416099.1.10643 WP_003416099.1.10648 WP_003416099.1.10662 WP_003416099.1.10709 WP_003416099.1.10735 WP_003416099.1.10740 WP_003416099.1.10756 WP_003416099.1.1078 WP_003416099.1.10791 WP_003416099.1.10799 WP_003416099.1.10825 WP_003416099.1.10848 WP_003416099.1.10863 WP_003416099.1.10879 WP_003416099.1.10912 WP_003416099.1.10916 WP_003416099.1.10923 WP_003416099.1.10927 WP_003416099.1.1095 WP_003416099.1.10956 WP_003416099.1.10958 WP_003416099.1.10962 WP_003416099.1.10980 WP_003416099.1.10981 WP_003416099.1.10993 WP_003416099.1.1100 WP_003416099.1.11040 WP_003416099.1.11061 WP_003416099.1.11070 WP_003416099.1.11141 WP_003416099.1.11171 WP_003416099.1.11175 WP_003416099.1.11176 WP_003416099.1.11222 WP_003416099.1.11236 WP_003416099.1.11329 WP_003416099.1.1133 WP_003416099.1.11342 WP_003416099.1.11373 WP_003416099.1.11376 WP_003416099.1.11390 WP_003416099.1.11402 WP_003416099.1.11481 WP_003416099.1.11487 WP_003416099.1.11489 WP_003416099.1.11491 WP_003416099.1.11514 WP_003416099.1.11587 WP_003416099.1.11589 WP_003416099.1.11596 WP_003416099.1.11604 WP_003416099.1.11610 WP_003416099.1.11697 WP_003416099.1.11707 WP_003416099.1.11752 WP_003416099.1.11758 WP_003416099.1.11761 WP_003416099.1.11775 WP_003416099.1.11804 WP_003416099.1.11822 WP_003416099.1.11826 WP_003416099.1.11856 WP_003416099.1.11898 WP_003416099.1.11906 WP_003416099.1.11939 WP_003416099.1.11960 WP_003416099.1.11961 WP_003416099.1.11972 WP_003416099.1.11984 WP_003416099.1.120 WP_003416099.1.12001 WP_003416099.1.12049 WP_003416099.1.12052 WP_003416099.1.12100 WP_003416099.1.12116 WP_003416099.1.12130 WP_003416099.1.12133 WP_003416099.1.12161 WP_003416099.1.12165 WP_003416099.1.12184 WP_003416099.1.12187 WP_003416099.1.12190 WP_003416099.1.12216 WP_003416099.1.12265 WP_003416099.1.12275 WP_003416099.1.12293 WP_003416099.1.12294 WP_003416099.1.123 WP_003416099.1.1231 WP_003416099.1.12314 WP_003416099.1.12327 WP_003416099.1.12338 WP_003416099.1.1236 WP_003416099.1.12371 WP_003416099.1.12372 WP_003416099.1.12389 WP_003416099.1.12406 WP_003416099.1.1241 WP_003416099.1.12421 WP_003416099.1.12424 WP_003416099.1.12446 WP_003416099.1.12464 WP_003416099.1.12479 WP_003416099.1.12519 WP_003416099.1.12523 WP_003416099.1.12526 WP_003416099.1.1255 WP_003416099.1.12550 WP_003416099.1.12551 WP_003416099.1.12563 WP_003416099.1.12611 WP_003416099.1.12669 WP_003416099.1.1267 WP_003416099.1.12672 WP_003416099.1.12692 WP_003416099.1.1271 WP_003416099.1.12710 WP_003416099.1.12768 WP_003416099.1.1279 WP_003416099.1.12794 WP_003416099.1.12801 WP_003416099.1.12804 WP_003416099.1.12821 WP_003416099.1.12841 WP_003416099.1.12854 WP_003416099.1.12871 WP_003416099.1.12901 WP_003416099.1.12941 WP_003416099.1.12947 WP_003416099.1.12957 WP_003416099.1.12972 WP_003416099.1.13028 WP_003416099.1.13043 WP_003416099.1.13086 WP_003416099.1.13087 WP_003416099.1.13090 WP_003416099.1.13096 WP_003416099.1.13163 WP_003416099.1.13175 WP_003416099.1.13183 WP_003416099.1.132 WP_003416099.1.13249 WP_003416099.1.13282 WP_003416099.1.13284 WP_003416099.1.13296 WP_003416099.1.13298 WP_003416099.1.13302 WP_003416099.1.13306 WP_003416099.1.13312 WP_003416099.1.13313 WP_003416099.1.13321 WP_003416099.1.13345 WP_003416099.1.13358 WP_003416099.1.13370 WP_003416099.1.13375 WP_003416099.1.1338 WP_003416099.1.13420 WP_003416099.1.13433 WP_003416099.1.13435 WP_003416099.1.13438 WP_003416099.1.13461 WP_003416099.1.13466 WP_003416099.1.13489 WP_003416099.1.13526 WP_003416099.1.13551 WP_003416099.1.13561 WP_003416099.1.13564 WP_003416099.1.13579 WP_003416099.1.13647 WP_003416099.1.13667 WP_003416099.1.13687 WP_003416099.1.13697 WP_003416099.1.13719 WP_003416099.1.13763 WP_003416099.1.1377 WP_003416099.1.13774 WP_003416099.1.13786 WP_003416099.1.13793 WP_003416099.1.13794 WP_003416099.1.13817 WP_003416099.1.13834 WP_003416099.1.13866 WP_003416099.1.13880 WP_003416099.1.13899 WP_003416099.1.13909 WP_003416099.1.13910 WP_003416099.1.13919 WP_003416099.1.13920 WP_003416099.1.13952 WP_003416099.1.13953 WP_003416099.1.13962 WP_003416099.1.1398 WP_003416099.1.13988 WP_003416099.1.14027 WP_003416099.1.14046 WP_003416099.1.14115 WP_003416099.1.1415 WP_003416099.1.14152 WP_003416099.1.14158 WP_003416099.1.14162 WP_003416099.1.14175 WP_003416099.1.14178 WP_003416099.1.14194 WP_003416099.1.14195 WP_003416099.1.14208 WP_003416099.1.14238 WP_003416099.1.14266 WP_003416099.1.14273 WP_003416099.1.14303 WP_003416099.1.14306 WP_003416099.1.14307 WP_003416099.1.14310 WP_003416099.1.14341 WP_003416099.1.14382 WP_003416099.1.14416 WP_003416099.1.14428 WP_003416099.1.14441 WP_003416099.1.14469 WP_003416099.1.14477 WP_003416099.1.14504 WP_003416099.1.14514 WP_003416099.1.1452 WP_003416099.1.14527 WP_003416099.1.1454 WP_003416099.1.14544 WP_003416099.1.14548 WP_003416099.1.14551 WP_003416099.1.14561 WP_003416099.1.14573 WP_003416099.1.1462 WP_003416099.1.14658 WP_003416099.1.14667 WP_003416099.1.14668 WP_003416099.1.14675 WP_003416099.1.14694 WP_003416099.1.14695 WP_003416099.1.14709 WP_003416099.1.14766 WP_003416099.1.14783 WP_003416099.1.14865 WP_003416099.1.14872 WP_003416099.1.14905 WP_003416099.1.14926 WP_003416099.1.14951 WP_003416099.1.14955 WP_003416099.1.15003 WP_003416099.1.15009 WP_003416099.1.15028 WP_003416099.1.15040 WP_003416099.1.15052 WP_003416099.1.15065 WP_003416099.1.15072 WP_003416099.1.15089 WP_003416099.1.1509 WP_003416099.1.15126 WP_003416099.1.15131 WP_003416099.1.15168 WP_003416099.1.15172 WP_003416099.1.15174 WP_003416099.1.15187 WP_003416099.1.15210 WP_003416099.1.15216 WP_003416099.1.15217 WP_003416099.1.1523 WP_003416099.1.15232 WP_003416099.1.15238 WP_003416099.1.15240 WP_003416099.1.15253 WP_003416099.1.15267 WP_003416099.1.1527 WP_003416099.1.15292 WP_003416099.1.15299 WP_003416099.1.15302 WP_003416099.1.15322 WP_003416099.1.1534 WP_003416099.1.15345 WP_003416099.1.15365 WP_003416099.1.15372 WP_003416099.1.15386 WP_003416099.1.15387 WP_003416099.1.15442 WP_003416099.1.15447 WP_003416099.1.15449 WP_003416099.1.15477 WP_003416099.1.15481 WP_003416099.1.15492 WP_003416099.1.15511 WP_003416099.1.15512 WP_003416099.1.15558 WP_003416099.1.15559 WP_003416099.1.15566 WP_003416099.1.15599 WP_003416099.1.1560 WP_003416099.1.15611 WP_003416099.1.1563 WP_003416099.1.15633 WP_003416099.1.15643 WP_003416099.1.15688 WP_003416099.1.15755 WP_003416099.1.15763 WP_003416099.1.15774 WP_003416099.1.1578 WP_003416099.1.15780 WP_003416099.1.15827 WP_003416099.1.15834 WP_003416099.1.15842 WP_003416099.1.15853 WP_003416099.1.15870 WP_003416099.1.15877 WP_003416099.1.15893 WP_003416099.1.15896 WP_003416099.1.15926 WP_003416099.1.15933 WP_003416099.1.15946 WP_003416099.1.15958 WP_003416099.1.15973 WP_003416099.1.15987 WP_003416099.1.15993 WP_003416099.1.16009 WP_003416099.1.16025 WP_003416099.1.16043 WP_003416099.1.16055 WP_003416099.1.16066 WP_003416099.1.16069 WP_003416099.1.16077 WP_003416099.1.16106 WP_003416099.1.16108 WP_003416099.1.16110 WP_003416099.1.16130 WP_003416099.1.16136 WP_003416099.1.16139 WP_003416099.1.16141 WP_003416099.1.16143 WP_003416099.1.1630 WP_003416099.1.16318 WP_003416099.1.1632 WP_003416099.1.16327 WP_003416099.1.16334 WP_003416099.1.16341 WP_003416099.1.16345 WP_003416099.1.16374 WP_003416099.1.16384 WP_003416099.1.16386 WP_003416099.1.164 WP_003416099.1.1642 WP_003416099.1.16421 WP_003416099.1.16424 WP_003416099.1.16426 WP_003416099.1.16431 WP_003416099.1.16438 WP_003416099.1.1644 WP_003416099.1.16442 WP_003416099.1.16448 WP_003416099.1.16451 WP_003416099.1.16476 WP_003416099.1.16480 WP_003416099.1.16494 WP_003416099.1.1652 WP_003416099.1.16549 WP_003416099.1.16560 WP_003416099.1.16598 WP_003416099.1.16609 WP_003416099.1.16619 WP_003416099.1.16620 WP_003416099.1.16622 WP_003416099.1.16637 WP_003416099.1.1669 WP_003416099.1.16707 WP_003416099.1.16724 WP_003416099.1.16731 WP_003416099.1.16743 WP_003416099.1.1683 WP_003416099.1.16837 WP_003416099.1.16852 WP_003416099.1.16937 WP_003416099.1.16940 WP_003416099.1.16950 WP_003416099.1.16959 WP_003416099.1.16968 WP_003416099.1.1697 WP_003416099.1.16973 WP_003416099.1.16977 WP_003416099.1.16987 WP_003416099.1.17005 WP_003416099.1.17006 WP_003416099.1.17010 WP_003416099.1.17015 WP_003416099.1.17019 WP_003416099.1.17039 WP_003416099.1.17041 WP_003416099.1.17052 WP_003416099.1.17057 WP_003416099.1.17062 WP_003416099.1.1707 WP_003416099.1.17094 WP_003416099.1.17130 WP_003416099.1.17138 WP_003416099.1.17147 WP_003416099.1.17167 WP_003416099.1.17224 WP_003416099.1.17251 WP_003416099.1.17288 WP_003416099.1.17304 WP_003416099.1.17314 WP_003416099.1.17345 WP_003416099.1.17381 WP_003416099.1.17391 WP_003416099.1.17412 WP_003416099.1.1743 WP_003416099.1.17440 WP_003416099.1.17466 WP_003416099.1.17477 WP_003416099.1.17483 WP_003416099.1.17505 WP_003416099.1.17527 WP_003416099.1.17535 WP_003416099.1.17540 WP_003416099.1.17553 WP_003416099.1.17558 WP_003416099.1.17599 WP_003416099.1.17635 WP_003416099.1.17655 WP_003416099.1.17679 WP_003416099.1.1768 WP_003416099.1.17687 WP_003416099.1.17700 WP_003416099.1.17710 WP_003416099.1.17713 WP_003416099.1.17722 WP_003416099.1.17746 WP_003416099.1.17788 WP_003416099.1.17798 WP_003416099.1.17803 WP_003416099.1.17816 WP_003416099.1.17821 WP_003416099.1.17830 WP_003416099.1.17868 WP_003416099.1.17878 WP_003416099.1.1792 WP_003416099.1.17923 WP_003416099.1.1795 WP_003416099.1.17955 WP_003416099.1.17973 WP_003416099.1.18009 WP_003416099.1.18013 WP_003416099.1.18033 WP_003416099.1.18057 WP_003416099.1.18065 WP_003416099.1.18070 WP_003416099.1.18116 WP_003416099.1.18120 WP_003416099.1.18126 WP_003416099.1.1817 WP_003416099.1.18170 WP_003416099.1.18206 WP_003416099.1.18216 WP_003416099.1.18217 WP_003416099.1.18240 WP_003416099.1.18257 WP_003416099.1.18297 WP_003416099.1.18306 WP_003416099.1.18364 WP_003416099.1.18399 WP_003416099.1.18411 WP_003416099.1.18444 WP_003416099.1.18448 WP_003416099.1.18467 WP_003416099.1.18476 WP_003416099.1.18522 WP_003416099.1.18580 WP_003416099.1.18582 WP_003416099.1.18587 WP_003416099.1.186 WP_003416099.1.18601 WP_003416099.1.18639 WP_003416099.1.18646 WP_003416099.1.18647 WP_003416099.1.1868 WP_003416099.1.18694 WP_003416099.1.18710 WP_003416099.1.18751 WP_003416099.1.18781 WP_003416099.1.18793 WP_003416099.1.18804 WP_003416099.1.18816 WP_003416099.1.18823 WP_003416099.1.18827 WP_003416099.1.18838 WP_003416099.1.18849 WP_003416099.1.18856 WP_003416099.1.18945 WP_003416099.1.1898 WP_003416099.1.19005 WP_003416099.1.19056 WP_003416099.1.19063 WP_003416099.1.19066 WP_003416099.1.19071 WP_003416099.1.19085 WP_003416099.1.19094 WP_003416099.1.19144 WP_003416099.1.19159 WP_003416099.1.19193 WP_003416099.1.19231 WP_003416099.1.19243 WP_003416099.1.19264 WP_003416099.1.19295 WP_003416099.1.19307 WP_003416099.1.19326 WP_003416099.1.1933 WP_003416099.1.19364 WP_003416099.1.19382 WP_003416099.1.19400 WP_003416099.1.19426 WP_003416099.1.19429 WP_003416099.1.19464 WP_003416099.1.19480 WP_003416099.1.19512 WP_003416099.1.19553 WP_003416099.1.19562 WP_003416099.1.19564 WP_003416099.1.19568 WP_003416099.1.19572 WP_003416099.1.19595 WP_003416099.1.19596 WP_003416099.1.19600 WP_003416099.1.19630 WP_003416099.1.1967 WP_003416099.1.19694 WP_003416099.1.1970 WP_003416099.1.19707 WP_003416099.1.19742 WP_003416099.1.19785 WP_003416099.1.19820 WP_003416099.1.19868 WP_003416099.1.19874 WP_003416099.1.19890 WP_003416099.1.19900 WP_003416099.1.19922 WP_003416099.1.19936 WP_003416099.1.19946 WP_003416099.1.19949 WP_003416099.1.19960 WP_003416099.1.19964 WP_003416099.1.20007 WP_003416099.1.20016 WP_003416099.1.20028 WP_003416099.1.2003 WP_003416099.1.20037 WP_003416099.1.20039 WP_003416099.1.20082 WP_003416099.1.20085 WP_003416099.1.20097 WP_003416099.1.20116 WP_003416099.1.20130 WP_003416099.1.20140 WP_003416099.1.20141 WP_003416099.1.20142 WP_003416099.1.20158 WP_003416099.1.20239 WP_003416099.1.20243 WP_003416099.1.20259 WP_003416099.1.20262 WP_003416099.1.20268 WP_003416099.1.20272 WP_003416099.1.20273 WP_003416099.1.20280 WP_003416099.1.20294 WP_003416099.1.20300 WP_003416099.1.20309 WP_003416099.1.20322 WP_003416099.1.2037 WP_003416099.1.20372 WP_003416099.1.20381 WP_003416099.1.204 WP_003416099.1.20427 WP_003416099.1.20432 WP_003416099.1.20457 WP_003416099.1.20459 WP_003416099.1.20460 WP_003416099.1.20542 WP_003416099.1.20578 WP_003416099.1.20608 WP_003416099.1.20624 WP_003416099.1.20628 WP_003416099.1.2066 WP_003416099.1.20707 WP_003416099.1.20722 WP_003416099.1.20729 WP_003416099.1.20742 WP_003416099.1.20751 WP_003416099.1.20776 WP_003416099.1.20843 WP_003416099.1.20850 WP_003416099.1.2086 WP_003416099.1.20868 WP_003416099.1.20876 WP_003416099.1.20897 WP_003416099.1.20898 WP_003416099.1.2090 WP_003416099.1.20911 WP_003416099.1.20916 WP_003416099.1.20921 WP_003416099.1.20926 WP_003416099.1.20927 WP_003416099.1.20951 WP_003416099.1.20970 WP_003416099.1.2104 WP_003416099.1.21070 WP_003416099.1.21127 WP_003416099.1.21135 WP_003416099.1.21173 WP_003416099.1.21187 WP_003416099.1.212 WP_003416099.1.2120 WP_003416099.1.21218 WP_003416099.1.21219 WP_003416099.1.2123 WP_003416099.1.21231 WP_003416099.1.21234 WP_003416099.1.2126 WP_003416099.1.21292 WP_003416099.1.21307 WP_003416099.1.2131 WP_003416099.1.21311 WP_003416099.1.21321 WP_003416099.1.21365 WP_003416099.1.21392 WP_003416099.1.21397 WP_003416099.1.21403 WP_003416099.1.21415 WP_003416099.1.21418 WP_003416099.1.21430 WP_003416099.1.21434 WP_003416099.1.21444 WP_003416099.1.21468 WP_003416099.1.21498 WP_003416099.1.21509 WP_003416099.1.21513 WP_003416099.1.21560 WP_003416099.1.21565 WP_003416099.1.21586 WP_003416099.1.21591 WP_003416099.1.21594 WP_003416099.1.21602 WP_003416099.1.21615 WP_003416099.1.21638 WP_003416099.1.21639 WP_003416099.1.21655 WP_003416099.1.21658 WP_003416099.1.2168 WP_003416099.1.2174 WP_003416099.1.21741 WP_003416099.1.21742 WP_003416099.1.21777 WP_003416099.1.21786 WP_003416099.1.21795 WP_003416099.1.218 WP_003416099.1.21826 WP_003416099.1.21829 WP_003416099.1.21840 WP_003416099.1.21843 WP_003416099.1.21872 WP_003416099.1.21873 WP_003416099.1.2188 WP_003416099.1.21882 WP_003416099.1.21906 WP_003416099.1.21912 WP_003416099.1.2194 WP_003416099.1.21941 WP_003416099.1.21956 WP_003416099.1.21958 WP_003416099.1.21960 WP_003416099.1.21971 WP_003416099.1.21973 WP_003416099.1.21983 WP_003416099.1.22003 WP_003416099.1.22013 WP_003416099.1.22025 WP_003416099.1.22036 WP_003416099.1.22075 WP_003416099.1.22092 WP_003416099.1.2212 WP_003416099.1.22127 WP_003416099.1.22140 WP_003416099.1.22233 WP_003416099.1.22255 WP_003416099.1.22277 WP_003416099.1.22305 WP_003416099.1.22348 WP_003416099.1.22356 WP_003416099.1.22366 WP_003416099.1.2238 WP_003416099.1.22380 WP_003416099.1.22437 WP_003416099.1.22438 WP_003416099.1.22445 WP_003416099.1.22490 WP_003416099.1.22511 WP_003416099.1.22524 WP_003416099.1.2253 WP_003416099.1.22585 WP_003416099.1.22589 WP_003416099.1.22606 WP_003416099.1.22608 WP_003416099.1.22609 WP_003416099.1.22618 WP_003416099.1.2262 WP_003416099.1.22624 WP_003416099.1.22629 WP_003416099.1.22647 WP_003416099.1.22664 WP_003416099.1.22665 WP_003416099.1.22670 WP_003416099.1.22674 WP_003416099.1.22680 WP_003416099.1.22725 WP_003416099.1.22728 WP_003416099.1.22733 WP_003416099.1.22737 WP_003416099.1.2275 WP_003416099.1.22754 WP_003416099.1.22797 WP_003416099.1.22800 WP_003416099.1.22804 WP_003416099.1.22829 WP_003416099.1.22840 WP_003416099.1.22844 WP_003416099.1.22963 WP_003416099.1.22970 WP_003416099.1.22996 WP_003416099.1.22997 WP_003416099.1.22999 WP_003416099.1.23015 WP_003416099.1.23032 WP_003416099.1.231 WP_003416099.1.23101 WP_003416099.1.2312 WP_003416099.1.23140 WP_003416099.1.23153 WP_003416099.1.23171 WP_003416099.1.23199 WP_003416099.1.2320 WP_003416099.1.23204 WP_003416099.1.23216 WP_003416099.1.23229 WP_003416099.1.23233 WP_003416099.1.2326 WP_003416099.1.23261 WP_003416099.1.23272 WP_003416099.1.23289 WP_003416099.1.2329 WP_003416099.1.23308 WP_003416099.1.23316 WP_003416099.1.23321 WP_003416099.1.23325 WP_003416099.1.2339 WP_003416099.1.23406 WP_003416099.1.23438 WP_003416099.1.23445 WP_003416099.1.23447 WP_003416099.1.23452 WP_003416099.1.23461 WP_003416099.1.2349 WP_003416099.1.23496 WP_003416099.1.23497 WP_003416099.1.23506 WP_003416099.1.23530 WP_003416099.1.23539 WP_003416099.1.23546 WP_003416099.1.23551 WP_003416099.1.23573 WP_003416099.1.23583 WP_003416099.1.23588 WP_003416099.1.23628 WP_003416099.1.23677 WP_003416099.1.23683 WP_003416099.1.23692 WP_003416099.1.23694 WP_003416099.1.23699 WP_003416099.1.2371 WP_003416099.1.23803 WP_003416099.1.23807 WP_003416099.1.23825 WP_003416099.1.23832 WP_003416099.1.2384 WP_003416099.1.23843 WP_003416099.1.23863 WP_003416099.1.2387 WP_003416099.1.23894 WP_003416099.1.23993 WP_003416099.1.2400 WP_003416099.1.24007 WP_003416099.1.24008 WP_003416099.1.24046 WP_003416099.1.24057 WP_003416099.1.24062 WP_003416099.1.24113 WP_003416099.1.24119 WP_003416099.1.24128 WP_003416099.1.24140 WP_003416099.1.24176 WP_003416099.1.24190 WP_003416099.1.24202 WP_003416099.1.24244 WP_003416099.1.24261 WP_003416099.1.24284 WP_003416099.1.24294 WP_003416099.1.24357 WP_003416099.1.24396 WP_003416099.1.24414 WP_003416099.1.24423 WP_003416099.1.2443 WP_003416099.1.24446 WP_003416099.1.24461 WP_003416099.1.24500 WP_003416099.1.24507 WP_003416099.1.24509 WP_003416099.1.24529 WP_003416099.1.24553 WP_003416099.1.24599 WP_003416099.1.24629 WP_003416099.1.24638 WP_003416099.1.24648 WP_003416099.1.2466 WP_003416099.1.24767 WP_003416099.1.24824 WP_003416099.1.24831 WP_003416099.1.24840 WP_003416099.1.24848 WP_003416099.1.24857 WP_003416099.1.2487 WP_003416099.1.24893 WP_003416099.1.24907 WP_003416099.1.24933 WP_003416099.1.24956 WP_003416099.1.24958 WP_003416099.1.24985 WP_003416099.1.2499 WP_003416099.1.25004 WP_003416099.1.2505 WP_003416099.1.25051 WP_003416099.1.2507 WP_003416099.1.25096 WP_003416099.1.25103 WP_003416099.1.25129 WP_003416099.1.25171 WP_003416099.1.25184 WP_003416099.1.25247 WP_003416099.1.25252 WP_003416099.1.25278 WP_003416099.1.25283 WP_003416099.1.25309 WP_003416099.1.25313 WP_003416099.1.25338 WP_003416099.1.25342 WP_003416099.1.25343 WP_003416099.1.25367 WP_003416099.1.25393 WP_003416099.1.25406 WP_003416099.1.25435 WP_003416099.1.25437 WP_003416099.1.25445 WP_003416099.1.25455 WP_003416099.1.25473 WP_003416099.1.25504 WP_003416099.1.25513 WP_003416099.1.25542 WP_003416099.1.25579 WP_003416099.1.25594 WP_003416099.1.25606 WP_003416099.1.25645 WP_003416099.1.2566 WP_003416099.1.25673 WP_003416099.1.25674 WP_003416099.1.25693 WP_003416099.1.25699 WP_003416099.1.25727 WP_003416099.1.25736 WP_003416099.1.25738 WP_003416099.1.25756 WP_003416099.1.25759 WP_003416099.1.2580 WP_003416099.1.25813 WP_003416099.1.25853 WP_003416099.1.25854 WP_003416099.1.25874 WP_003416099.1.25885 WP_003416099.1.25892 WP_003416099.1.25906 WP_003416099.1.25914 WP_003416099.1.25916 WP_003416099.1.2594 WP_003416099.1.25954 WP_003416099.1.25965 WP_003416099.1.25972 WP_003416099.1.26017 WP_003416099.1.26032 WP_003416099.1.26038 WP_003416099.1.26072 WP_003416099.1.26089 WP_003416099.1.26097 WP_003416099.1.26098 WP_003416099.1.26108 WP_003416099.1.26109 WP_003416099.1.26118 WP_003416099.1.26126 WP_003416099.1.2614 WP_003416099.1.26168 WP_003416099.1.26182 WP_003416099.1.26190 WP_003416099.1.2620 WP_003416099.1.26234 WP_003416099.1.26243 WP_003416099.1.26265 WP_003416099.1.26267 WP_003416099.1.26292 WP_003416099.1.26310 WP_003416099.1.26328 WP_003416099.1.26349 WP_003416099.1.26366 WP_003416099.1.26374 WP_003416099.1.26407 WP_003416099.1.26412 WP_003416099.1.26454 WP_003416099.1.26464 WP_003416099.1.2653 WP_003416099.1.26560 WP_003416099.1.26571 WP_003416099.1.2659 WP_003416099.1.26597 WP_003416099.1.26603 WP_003416099.1.26629 WP_003416099.1.26651 WP_003416099.1.26702 WP_003416099.1.26707 WP_003416099.1.26710 WP_003416099.1.26719 WP_003416099.1.26737 WP_003416099.1.26738 WP_003416099.1.26745 WP_003416099.1.26756 WP_003416099.1.2676 WP_003416099.1.2677 WP_003416099.1.26779 WP_003416099.1.26780 WP_003416099.1.26798 WP_003416099.1.26854 WP_003416099.1.26868 WP_003416099.1.26876 WP_003416099.1.26888 WP_003416099.1.26914 WP_003416099.1.26945 WP_003416099.1.26959 WP_003416099.1.26969 WP_003416099.1.26984 WP_003416099.1.26992 WP_003416099.1.27004 WP_003416099.1.27017 WP_003416099.1.27045 WP_003416099.1.27074 WP_003416099.1.27075 WP_003416099.1.27128 WP_003416099.1.27130 WP_003416099.1.27139 WP_003416099.1.27152 WP_003416099.1.27162 WP_003416099.1.27164 WP_003416099.1.27193 WP_003416099.1.27235 WP_003416099.1.27254 WP_003416099.1.27278 WP_003416099.1.27343 WP_003416099.1.27352 WP_003416099.1.27369 WP_003416099.1.27391 WP_003416099.1.27398 WP_003416099.1.27402 WP_003416099.1.27410 WP_003416099.1.27411 WP_003416099.1.27449 WP_003416099.1.27460 WP_003416099.1.27463 WP_003416099.1.2749 WP_003416099.1.27492 WP_003416099.1.27528 WP_003416099.1.27541 WP_003416099.1.27576 WP_003416099.1.27582 WP_003416099.1.27596 WP_003416099.1.27607 WP_003416099.1.2766 WP_003416099.1.277 WP_003416099.1.27724 WP_003416099.1.27730 WP_003416099.1.27736 WP_003416099.1.27743 WP_003416099.1.27750 WP_003416099.1.27771 WP_003416099.1.27779 WP_003416099.1.27795 WP_003416099.1.27803 WP_003416099.1.27819 WP_003416099.1.27835 WP_003416099.1.27915 WP_003416099.1.27935 WP_003416099.1.27962 WP_003416099.1.28053 WP_003416099.1.28092 WP_003416099.1.28106 WP_003416099.1.28131 WP_003416099.1.28142 WP_003416099.1.28159 WP_003416099.1.2816 WP_003416099.1.28161 WP_003416099.1.28192 WP_003416099.1.28202 WP_003416099.1.28241 WP_003416099.1.28242 WP_003416099.1.28251 WP_003416099.1.28255 WP_003416099.1.28269 WP_003416099.1.28276 WP_003416099.1.28293 WP_003416099.1.28331 WP_003416099.1.28367 WP_003416099.1.28378 WP_003416099.1.28391 WP_003416099.1.2842 WP_003416099.1.28448 WP_003416099.1.2847 WP_003416099.1.28471 WP_003416099.1.28473 WP_003416099.1.28493 WP_003416099.1.28497 WP_003416099.1.28530 WP_003416099.1.28545 WP_003416099.1.28561 WP_003416099.1.28567 WP_003416099.1.28585 WP_003416099.1.286 WP_003416099.1.28610 WP_003416099.1.28617 WP_003416099.1.28634 WP_003416099.1.28642 WP_003416099.1.28671 WP_003416099.1.28682 WP_003416099.1.28698 WP_003416099.1.28703 WP_003416099.1.28739 WP_003416099.1.28758 WP_003416099.1.28781 WP_003416099.1.28787 WP_003416099.1.28827 WP_003416099.1.28839 WP_003416099.1.28847 WP_003416099.1.28850 WP_003416099.1.28851 WP_003416099.1.28865 WP_003416099.1.28897 WP_003416099.1.28914 WP_003416099.1.28935 WP_003416099.1.28936 WP_003416099.1.28939 WP_003416099.1.28943 WP_003416099.1.28952 WP_003416099.1.28975 WP_003416099.1.2899 WP_003416099.1.28993 WP_003416099.1.29000 WP_003416099.1.2901 WP_003416099.1.29028 WP_003416099.1.29033 WP_003416099.1.29058 WP_003416099.1.29078 WP_003416099.1.29102 WP_003416099.1.29115 WP_003416099.1.2916 WP_003416099.1.29217 WP_003416099.1.29223 WP_003416099.1.29234 WP_003416099.1.29264 WP_003416099.1.29275 WP_003416099.1.29306 WP_003416099.1.29339 WP_003416099.1.29348 WP_003416099.1.29364 WP_003416099.1.29367 WP_003416099.1.2938 WP_003416099.1.29399 WP_003416099.1.29426 WP_003416099.1.2944 WP_003416099.1.29449 WP_003416099.1.29450 WP_003416099.1.29452 WP_003416099.1.2949 WP_003416099.1.29510 WP_003416099.1.29515 WP_003416099.1.29525 WP_003416099.1.2953 WP_003416099.1.29559 WP_003416099.1.29587 WP_003416099.1.2959 WP_003416099.1.29592 WP_003416099.1.29599 WP_003416099.1.29611 WP_003416099.1.29632 WP_003416099.1.29649 WP_003416099.1.2965 WP_003416099.1.29659 WP_003416099.1.2969 WP_003416099.1.29696 WP_003416099.1.29698 WP_003416099.1.29718 WP_003416099.1.29742 WP_003416099.1.29745 WP_003416099.1.29747 WP_003416099.1.29769 WP_003416099.1.29825 WP_003416099.1.29830 WP_003416099.1.29847 WP_003416099.1.29861 WP_003416099.1.29869 WP_003416099.1.29883 WP_003416099.1.29890 WP_003416099.1.299 WP_003416099.1.29931 WP_003416099.1.30014 WP_003416099.1.3004 WP_003416099.1.30040 WP_003416099.1.30043 WP_003416099.1.30074 WP_003416099.1.30097 WP_003416099.1.30101 WP_003416099.1.30106 WP_003416099.1.30114 WP_003416099.1.30126 WP_003416099.1.30131 WP_003416099.1.30138 WP_003416099.1.30139 WP_003416099.1.30145 WP_003416099.1.30211 WP_003416099.1.30224 WP_003416099.1.30235 WP_003416099.1.30237 WP_003416099.1.3027 WP_003416099.1.30279 WP_003416099.1.30282 WP_003416099.1.30283 WP_003416099.1.30288 WP_003416099.1.30291 WP_003416099.1.30363 WP_003416099.1.30374 WP_003416099.1.30404 WP_003416099.1.3043 WP_003416099.1.30433 WP_003416099.1.30438 WP_003416099.1.30462 WP_003416099.1.30464 WP_003416099.1.30468 WP_003416099.1.30500 WP_003416099.1.3057 WP_003416099.1.30574 WP_003416099.1.30628 WP_003416099.1.30641 WP_003416099.1.30642 WP_003416099.1.30661 WP_003416099.1.30683 WP_003416099.1.30699 WP_003416099.1.30709 WP_003416099.1.30713 WP_003416099.1.30716 WP_003416099.1.30719 WP_003416099.1.30730 WP_003416099.1.30732 WP_003416099.1.30736 WP_003416099.1.30745 WP_003416099.1.30760 WP_003416099.1.30791 WP_003416099.1.308 WP_003416099.1.30807 WP_003416099.1.30818 WP_003416099.1.30824 WP_003416099.1.30848 WP_003416099.1.30877 WP_003416099.1.30888 WP_003416099.1.30901 WP_003416099.1.30903 WP_003416099.1.30912 WP_003416099.1.30913 WP_003416099.1.30914 WP_003416099.1.30919 WP_003416099.1.30977 WP_003416099.1.3100 WP_003416099.1.31002 WP_003416099.1.3101 WP_003416099.1.31034 WP_003416099.1.31047 WP_003416099.1.31070 WP_003416099.1.31074 WP_003416099.1.31102 WP_003416099.1.31127 WP_003416099.1.31184 WP_003416099.1.31199 WP_003416099.1.31226 WP_003416099.1.31230 WP_003416099.1.31233 WP_003416099.1.31263 WP_003416099.1.31264 WP_003416099.1.31287 WP_003416099.1.31290 WP_003416099.1.31304 WP_003416099.1.31346 WP_003416099.1.31348 WP_003416099.1.31354 WP_003416099.1.31390 WP_003416099.1.31414 WP_003416099.1.31417 WP_003416099.1.31428 WP_003416099.1.3143 WP_003416099.1.31458 WP_003416099.1.31483 WP_003416099.1.3149 WP_003416099.1.31498 WP_003416099.1.31507 WP_003416099.1.31537 WP_003416099.1.31548 WP_003416099.1.31569 WP_003416099.1.31573 WP_003416099.1.316 WP_003416099.1.31629 WP_003416099.1.31666 WP_003416099.1.31693 WP_003416099.1.31703 WP_003416099.1.31744 WP_003416099.1.31745 WP_003416099.1.31770 WP_003416099.1.31776 WP_003416099.1.31783 WP_003416099.1.318 WP_003416099.1.3184 WP_003416099.1.31880 WP_003416099.1.31911 WP_003416099.1.31930 WP_003416099.1.31932 WP_003416099.1.31955 WP_003416099.1.31985 WP_003416099.1.31991 WP_003416099.1.31995 WP_003416099.1.32004 WP_003416099.1.32039 WP_003416099.1.3204 WP_003416099.1.32045 WP_003416099.1.32071 WP_003416099.1.32098 WP_003416099.1.32132 WP_003416099.1.32157 WP_003416099.1.32164 WP_003416099.1.32179 WP_003416099.1.32198 WP_003416099.1.32297 WP_003416099.1.32317 WP_003416099.1.32383 WP_003416099.1.32400 WP_003416099.1.32403 WP_003416099.1.32416 WP_003416099.1.32421 WP_003416099.1.32433 WP_003416099.1.32461 WP_003416099.1.32482 WP_003416099.1.32503 WP_003416099.1.32556 WP_003416099.1.32562 WP_003416099.1.32569 WP_003416099.1.32592 WP_003416099.1.32620 WP_003416099.1.32647 WP_003416099.1.32653 WP_003416099.1.32654 WP_003416099.1.3268 WP_003416099.1.32695 WP_003416099.1.32706 WP_003416099.1.32716 WP_003416099.1.32738 WP_003416099.1.32752 WP_003416099.1.32780 WP_003416099.1.32781 WP_003416099.1.32793 WP_003416099.1.32799 WP_003416099.1.32822 WP_003416099.1.32833 WP_003416099.1.32862 WP_003416099.1.32880 WP_003416099.1.32897 WP_003416099.1.32909 WP_003416099.1.32935 WP_003416099.1.32974 WP_003416099.1.33007 WP_003416099.1.3302 WP_003416099.1.33028 WP_003416099.1.33035 WP_003416099.1.33044 WP_003416099.1.33054 WP_003416099.1.33082 WP_003416099.1.33141 WP_003416099.1.33148 WP_003416099.1.33155 WP_003416099.1.33168 WP_003416099.1.3321 WP_003416099.1.33215 WP_003416099.1.3325 WP_003416099.1.3327 WP_003416099.1.33278 WP_003416099.1.33288 WP_003416099.1.33305 WP_003416099.1.3331 WP_003416099.1.33319 WP_003416099.1.3333 WP_003416099.1.33393 WP_003416099.1.33403 WP_003416099.1.33452 WP_003416099.1.33467 WP_003416099.1.33477 WP_003416099.1.3349 WP_003416099.1.33519 WP_003416099.1.33542 WP_003416099.1.33601 WP_003416099.1.33602 WP_003416099.1.33633 WP_003416099.1.33646 WP_003416099.1.33673 WP_003416099.1.3369 WP_003416099.1.33705 WP_003416099.1.33762 WP_003416099.1.33783 WP_003416099.1.33789 WP_003416099.1.3383 WP_003416099.1.33832 WP_003416099.1.33839 WP_003416099.1.33848 WP_003416099.1.3387 WP_003416099.1.33886 WP_003416099.1.33895 WP_003416099.1.33906 WP_003416099.1.33912 WP_003416099.1.33954 WP_003416099.1.3399 WP_003416099.1.34042 WP_003416099.1.3405 WP_003416099.1.34055 WP_003416099.1.34056 WP_003416099.1.34065 WP_003416099.1.3408 WP_003416099.1.34090 WP_003416099.1.34109 WP_003416099.1.34111 WP_003416099.1.34131 WP_003416099.1.34152 WP_003416099.1.34153 WP_003416099.1.34163 WP_003416099.1.34181 WP_003416099.1.34197 WP_003416099.1.34198 WP_003416099.1.34215 WP_003416099.1.34219 WP_003416099.1.34255 WP_003416099.1.34260 WP_003416099.1.34275 WP_003416099.1.343 WP_003416099.1.34347 WP_003416099.1.34358 WP_003416099.1.34392 WP_003416099.1.344 WP_003416099.1.34428 WP_003416099.1.3443 WP_003416099.1.34435 WP_003416099.1.34446 WP_003416099.1.34499 WP_003416099.1.34505 WP_003416099.1.34516 WP_003416099.1.34529 WP_003416099.1.34551 WP_003416099.1.34563 WP_003416099.1.34576 WP_003416099.1.34581 WP_003416099.1.34588 WP_003416099.1.34596 WP_003416099.1.34599 WP_003416099.1.34639 WP_003416099.1.34673 WP_003416099.1.34724 WP_003416099.1.34740 WP_003416099.1.34755 WP_003416099.1.34777 WP_003416099.1.34783 WP_003416099.1.34841 WP_003416099.1.34908 WP_003416099.1.34919 WP_003416099.1.3492 WP_003416099.1.34933 WP_003416099.1.34945 WP_003416099.1.34946 WP_003416099.1.34954 WP_003416099.1.34960 WP_003416099.1.34961 WP_003416099.1.34963 WP_003416099.1.34965 WP_003416099.1.34968 WP_003416099.1.35023 WP_003416099.1.35069 WP_003416099.1.35072 WP_003416099.1.35078 WP_003416099.1.35100 WP_003416099.1.35146 WP_003416099.1.35156 WP_003416099.1.35160 WP_003416099.1.35162 WP_003416099.1.35173 WP_003416099.1.35176 WP_003416099.1.3520 WP_003416099.1.35213 WP_003416099.1.35221 WP_003416099.1.35246 WP_003416099.1.35278 WP_003416099.1.35301 WP_003416099.1.35311 WP_003416099.1.35312 WP_003416099.1.35317 WP_003416099.1.35319 WP_003416099.1.35347 WP_003416099.1.35363 WP_003416099.1.35382 WP_003416099.1.35385 WP_003416099.1.35397 WP_003416099.1.35403 WP_003416099.1.35426 WP_003416099.1.35439 WP_003416099.1.35455 WP_003416099.1.3548 WP_003416099.1.35484 WP_003416099.1.35492 WP_003416099.1.3553 WP_003416099.1.35553 WP_003416099.1.35561 WP_003416099.1.35602 WP_003416099.1.35610 WP_003416099.1.35635 WP_003416099.1.35657 WP_003416099.1.35680 WP_003416099.1.35687 WP_003416099.1.35689 WP_003416099.1.35707 WP_003416099.1.35732 WP_003416099.1.35754 WP_003416099.1.35767 WP_003416099.1.35770 WP_003416099.1.35771 WP_003416099.1.35780 WP_003416099.1.35805 WP_003416099.1.35811 WP_003416099.1.3584 WP_003416099.1.35848 WP_003416099.1.35864 WP_003416099.1.35874 WP_003416099.1.35876 WP_003416099.1.35897 WP_003416099.1.35899 WP_003416099.1.35923 WP_003416099.1.3593 WP_003416099.1.35954 WP_003416099.1.36005 WP_003416099.1.36014 WP_003416099.1.36023 WP_003416099.1.36051 WP_003416099.1.36053 WP_003416099.1.36075 WP_003416099.1.36089 WP_003416099.1.36097 WP_003416099.1.36098 WP_003416099.1.36116 WP_003416099.1.36145 WP_003416099.1.36205 WP_003416099.1.36228 WP_003416099.1.36246 WP_003416099.1.36252 WP_003416099.1.36260 WP_003416099.1.36270 WP_003416099.1.36271 WP_003416099.1.36303 WP_003416099.1.36309 WP_003416099.1.36315 WP_003416099.1.36319 WP_003416099.1.36321 WP_003416099.1.36326 WP_003416099.1.3634 WP_003416099.1.36356 WP_003416099.1.36357 WP_003416099.1.3636 WP_003416099.1.36385 WP_003416099.1.36399 WP_003416099.1.36436 WP_003416099.1.36465 WP_003416099.1.36469 WP_003416099.1.36473 WP_003416099.1.36485 WP_003416099.1.36508 WP_003416099.1.36540 WP_003416099.1.36561 WP_003416099.1.36571 WP_003416099.1.36573 WP_003416099.1.36578 WP_003416099.1.36585 WP_003416099.1.36597 WP_003416099.1.36614 WP_003416099.1.36657 WP_003416099.1.36674 WP_003416099.1.36720 WP_003416099.1.36727 WP_003416099.1.36733 WP_003416099.1.36785 WP_003416099.1.36810 WP_003416099.1.36844 WP_003416099.1.36851 WP_003416099.1.36862 WP_003416099.1.36893 WP_003416099.1.36901 WP_003416099.1.36921 WP_003416099.1.36935 WP_003416099.1.36941 WP_003416099.1.3695 WP_003416099.1.36951 WP_003416099.1.36968 WP_003416099.1.3700 WP_003416099.1.37004 WP_003416099.1.37012 WP_003416099.1.37071 WP_003416099.1.37088 WP_003416099.1.37131 WP_003416099.1.37157 WP_003416099.1.37175 WP_003416099.1.37188 WP_003416099.1.37213 WP_003416099.1.37229 WP_003416099.1.3724 WP_003416099.1.37277 WP_003416099.1.37305 WP_003416099.1.37330 WP_003416099.1.37389 WP_003416099.1.37400 WP_003416099.1.37440 WP_003416099.1.37459 WP_003416099.1.37468 WP_003416099.1.37475 WP_003416099.1.37484 WP_003416099.1.37601 WP_003416099.1.37612 WP_003416099.1.37632 WP_003416099.1.37643 WP_003416099.1.37655 WP_003416099.1.37660 WP_003416099.1.37674 WP_003416099.1.37700 WP_003416099.1.37701 WP_003416099.1.37709 WP_003416099.1.37711 WP_003416099.1.37721 WP_003416099.1.37722 WP_003416099.1.37747 WP_003416099.1.37765 WP_003416099.1.37772 WP_003416099.1.37804 WP_003416099.1.37809 WP_003416099.1.37859 WP_003416099.1.37877 WP_003416099.1.37912 WP_003416099.1.37913 WP_003416099.1.37943 WP_003416099.1.37950 WP_003416099.1.37973 WP_003416099.1.37975 WP_003416099.1.37983 WP_003416099.1.38 WP_003416099.1.38002 WP_003416099.1.3802 WP_003416099.1.38039 WP_003416099.1.38040 WP_003416099.1.38067 WP_003416099.1.38068 WP_003416099.1.38135 WP_003416099.1.38138 WP_003416099.1.38144 WP_003416099.1.38158 WP_003416099.1.38159 WP_003416099.1.38210 WP_003416099.1.38233 WP_003416099.1.38240 WP_003416099.1.38299 WP_003416099.1.38332 WP_003416099.1.38347 WP_003416099.1.38354 WP_003416099.1.38380 WP_003416099.1.38384 WP_003416099.1.38389 WP_003416099.1.38398 WP_003416099.1.38402 WP_003416099.1.38418 WP_003416099.1.38421 WP_003416099.1.38466 WP_003416099.1.38477 WP_003416099.1.38483 WP_003416099.1.3849 WP_003416099.1.385 WP_003416099.1.38530 WP_003416099.1.38535 WP_003416099.1.38539 WP_003416099.1.38594 WP_003416099.1.38601 WP_003416099.1.38611 WP_003416099.1.38638 WP_003416099.1.38639 WP_003416099.1.38646 WP_003416099.1.38648 WP_003416099.1.38654 WP_003416099.1.38659 WP_003416099.1.38660 WP_003416099.1.38666 WP_003416099.1.38671 WP_003416099.1.38672 WP_003416099.1.38677 WP_003416099.1.38750 WP_003416099.1.38772 WP_003416099.1.38812 WP_003416099.1.38821 WP_003416099.1.38844 WP_003416099.1.38863 WP_003416099.1.38865 WP_003416099.1.38873 WP_003416099.1.3889 WP_003416099.1.38894 WP_003416099.1.38909 WP_003416099.1.38939 WP_003416099.1.38974 WP_003416099.1.38975 WP_003416099.1.38991 WP_003416099.1.39025 WP_003416099.1.39070 WP_003416099.1.39072 WP_003416099.1.39095 WP_003416099.1.39106 WP_003416099.1.39165 WP_003416099.1.39174 WP_003416099.1.39176 WP_003416099.1.39178 WP_003416099.1.39190 WP_003416099.1.39201 WP_003416099.1.39207 WP_003416099.1.39211 WP_003416099.1.39236 WP_003416099.1.39239 WP_003416099.1.39252 WP_003416099.1.39288 WP_003416099.1.39295 WP_003416099.1.39306 WP_003416099.1.39359 WP_003416099.1.39364 WP_003416099.1.39400 WP_003416099.1.39447 WP_003416099.1.3945 WP_003416099.1.39450 WP_003416099.1.39455 WP_003416099.1.3949 WP_003416099.1.39521 WP_003416099.1.39560 WP_003416099.1.39592 WP_003416099.1.39593 WP_003416099.1.396 WP_003416099.1.3960 WP_003416099.1.39616 WP_003416099.1.39654 WP_003416099.1.39657 WP_003416099.1.39661 WP_003416099.1.39674 WP_003416099.1.39678 WP_003416099.1.3968 WP_003416099.1.39694 WP_003416099.1.3971 WP_003416099.1.39718 WP_003416099.1.39739 WP_003416099.1.39748 WP_003416099.1.39751 WP_003416099.1.39759 WP_003416099.1.39801 WP_003416099.1.39804 WP_003416099.1.39848 WP_003416099.1.39877 WP_003416099.1.39925 WP_003416099.1.3994 WP_003416099.1.39959 WP_003416099.1.3996 WP_003416099.1.39960 WP_003416099.1.3997 WP_003416099.1.39980 WP_003416099.1.40000 WP_003416099.1.40028 WP_003416099.1.40029 WP_003416099.1.4003 WP_003416099.1.40094 WP_003416099.1.40096 WP_003416099.1.40150 WP_003416099.1.40156 WP_003416099.1.40174 WP_003416099.1.40186 WP_003416099.1.40276 WP_003416099.1.40277 WP_003416099.1.40323 WP_003416099.1.40336 WP_003416099.1.40353 WP_003416099.1.4036 WP_003416099.1.40372 WP_003416099.1.40402 WP_003416099.1.40413 WP_003416099.1.40440 WP_003416099.1.40446 WP_003416099.1.40451 WP_003416099.1.40455 WP_003416099.1.40523 WP_003416099.1.40543 WP_003416099.1.40641 WP_003416099.1.40646 WP_003416099.1.40651 WP_003416099.1.40653 WP_003416099.1.4067 WP_003416099.1.40705 WP_003416099.1.40723 WP_003416099.1.40731 WP_003416099.1.40735 WP_003416099.1.40799 WP_003416099.1.40852 WP_003416099.1.40876 WP_003416099.1.40881 WP_003416099.1.40922 WP_003416099.1.40948 WP_003416099.1.4095 WP_003416099.1.40956 WP_003416099.1.40957 WP_003416099.1.40964 WP_003416099.1.4097 WP_003416099.1.410 WP_003416099.1.41000 WP_003416099.1.41055 WP_003416099.1.41108 WP_003416099.1.41123 WP_003416099.1.41177 WP_003416099.1.41202 WP_003416099.1.41219 WP_003416099.1.41231 WP_003416099.1.41249 WP_003416099.1.4127 WP_003416099.1.41296 WP_003416099.1.41355 WP_003416099.1.41376 WP_003416099.1.41430 WP_003416099.1.41447 WP_003416099.1.41469 WP_003416099.1.41504 WP_003416099.1.41553 WP_003416099.1.41564 WP_003416099.1.41583 WP_003416099.1.41616 WP_003416099.1.41632 WP_003416099.1.41635 WP_003416099.1.41636 WP_003416099.1.41648 WP_003416099.1.41660 WP_003416099.1.41685 WP_003416099.1.41695 WP_003416099.1.41704 WP_003416099.1.4171 WP_003416099.1.41719 WP_003416099.1.41733 WP_003416099.1.41744 WP_003416099.1.41774 WP_003416099.1.41791 WP_003416099.1.41803 WP_003416099.1.41820 WP_003416099.1.41828 WP_003416099.1.41829 WP_003416099.1.41860 WP_003416099.1.41912 WP_003416099.1.41921 WP_003416099.1.41933 WP_003416099.1.41944 WP_003416099.1.42043 WP_003416099.1.42075 WP_003416099.1.42078 WP_003416099.1.42094 WP_003416099.1.42112 WP_003416099.1.4212 WP_003416099.1.42122 WP_003416099.1.42134 WP_003416099.1.42183 WP_003416099.1.42188 WP_003416099.1.42201 WP_003416099.1.42202 WP_003416099.1.42208 WP_003416099.1.42247 WP_003416099.1.42255 WP_003416099.1.42273 WP_003416099.1.42278 WP_003416099.1.42304 WP_003416099.1.42309 WP_003416099.1.42370 WP_003416099.1.42385 WP_003416099.1.42400 WP_003416099.1.42409 WP_003416099.1.42414 WP_003416099.1.42417 WP_003416099.1.42430 WP_003416099.1.42461 WP_003416099.1.42465 WP_003416099.1.42467 WP_003416099.1.42473 WP_003416099.1.42474 WP_003416099.1.4248 WP_003416099.1.42494 WP_003416099.1.42519 WP_003416099.1.42524 WP_003416099.1.42534 WP_003416099.1.4255 WP_003416099.1.42562 WP_003416099.1.42568 WP_003416099.1.42570 WP_003416099.1.42618 WP_003416099.1.42660 WP_003416099.1.42695 WP_003416099.1.42704 WP_003416099.1.42705 WP_003416099.1.42722 WP_003416099.1.42777 WP_003416099.1.42782 WP_003416099.1.42835 WP_003416099.1.42839 WP_003416099.1.42842 WP_003416099.1.42905 WP_003416099.1.42916 WP_003416099.1.42930 WP_003416099.1.42971 WP_003416099.1.43005 WP_003416099.1.43009 WP_003416099.1.43053 WP_003416099.1.43082 WP_003416099.1.43087 WP_003416099.1.43098 WP_003416099.1.43208 WP_003416099.1.43236 WP_003416099.1.43246 WP_003416099.1.43255 WP_003416099.1.43266 WP_003416099.1.43269 WP_003416099.1.43273 WP_003416099.1.43296 WP_003416099.1.43306 WP_003416099.1.4335 WP_003416099.1.43368 WP_003416099.1.43395 WP_003416099.1.43457 WP_003416099.1.43462 WP_003416099.1.43475 WP_003416099.1.43478 WP_003416099.1.43484 WP_003416099.1.43557 WP_003416099.1.43578 WP_003416099.1.43588 WP_003416099.1.43643 WP_003416099.1.43664 WP_003416099.1.43684 WP_003416099.1.43686 WP_003416099.1.43706 WP_003416099.1.43716 WP_003416099.1.4377 WP_003416099.1.43781 WP_003416099.1.43794 WP_003416099.1.43815 WP_003416099.1.43846 WP_003416099.1.43861 WP_003416099.1.43863 WP_003416099.1.43866 WP_003416099.1.43872 WP_003416099.1.43885 WP_003416099.1.43897 WP_003416099.1.4390 WP_003416099.1.43902 WP_003416099.1.43921 WP_003416099.1.43936 WP_003416099.1.43937 WP_003416099.1.43960 WP_003416099.1.43965 WP_003416099.1.4399 WP_003416099.1.43993 WP_003416099.1.43996 WP_003416099.1.44 WP_003416099.1.44001 WP_003416099.1.44008 WP_003416099.1.44016 WP_003416099.1.44033 WP_003416099.1.44037 WP_003416099.1.44041 WP_003416099.1.44070 WP_003416099.1.44071 WP_003416099.1.44076 WP_003416099.1.44104 WP_003416099.1.44111 WP_003416099.1.44124 WP_003416099.1.44169 WP_003416099.1.44219 WP_003416099.1.44237 WP_003416099.1.44277 WP_003416099.1.44279 WP_003416099.1.44336 WP_003416099.1.44355 WP_003416099.1.44358 WP_003416099.1.4438 WP_003416099.1.44390 WP_003416099.1.44392 WP_003416099.1.4441 WP_003416099.1.44415 WP_003416099.1.44464 WP_003416099.1.44466 WP_003416099.1.44489 WP_003416099.1.44492 WP_003416099.1.44494 WP_003416099.1.44500 WP_003416099.1.44519 WP_003416099.1.44526 WP_003416099.1.44532 WP_003416099.1.44534 WP_003416099.1.44562 WP_003416099.1.44589 WP_003416099.1.44597 WP_003416099.1.44600 WP_003416099.1.44602 WP_003416099.1.44615 WP_003416099.1.4464 WP_003416099.1.44651 WP_003416099.1.44659 WP_003416099.1.44665 WP_003416099.1.44694 WP_003416099.1.44700 WP_003416099.1.44713 WP_003416099.1.44735 WP_003416099.1.44740 WP_003416099.1.44757 WP_003416099.1.4476 WP_003416099.1.44761 WP_003416099.1.44767 WP_003416099.1.44776 WP_003416099.1.44779 WP_003416099.1.44786 WP_003416099.1.44808 WP_003416099.1.44864 WP_003416099.1.44901 WP_003416099.1.44908 WP_003416099.1.44913 WP_003416099.1.4492 WP_003416099.1.44939 WP_003416099.1.44979 WP_003416099.1.44981 WP_003416099.1.45002 WP_003416099.1.4504 WP_003416099.1.45062 WP_003416099.1.45066 WP_003416099.1.45081 WP_003416099.1.45113 WP_003416099.1.45129 WP_003416099.1.45135 WP_003416099.1.45147 WP_003416099.1.45168 WP_003416099.1.4517 WP_003416099.1.45181 WP_003416099.1.45185 WP_003416099.1.45192 WP_003416099.1.45200 WP_003416099.1.45205 WP_003416099.1.45211 WP_003416099.1.45249 WP_003416099.1.4526 WP_003416099.1.45286 WP_003416099.1.45326 WP_003416099.1.45347 WP_003416099.1.45374 WP_003416099.1.45390 WP_003416099.1.454 WP_003416099.1.45407 WP_003416099.1.45451 WP_003416099.1.45453 WP_003416099.1.45460 WP_003416099.1.45463 WP_003416099.1.45470 WP_003416099.1.45474 WP_003416099.1.45491 WP_003416099.1.45510 WP_003416099.1.45563 WP_003416099.1.45584 WP_003416099.1.45590 WP_003416099.1.45619 WP_003416099.1.45626 WP_003416099.1.45631 WP_003416099.1.45666 WP_003416099.1.45697 WP_003416099.1.4571 WP_003416099.1.45731 WP_003416099.1.45743 WP_003416099.1.45765 WP_003416099.1.45776 WP_003416099.1.45783 WP_003416099.1.45805 WP_003416099.1.45815 WP_003416099.1.45849 WP_003416099.1.45867 WP_003416099.1.4590 WP_003416099.1.45923 WP_003416099.1.45926 WP_003416099.1.45963 WP_003416099.1.45989 WP_003416099.1.45992 WP_003416099.1.46025 WP_003416099.1.46083 WP_003416099.1.46090 WP_003416099.1.46092 WP_003416099.1.46100 WP_003416099.1.46101 WP_003416099.1.46103 WP_003416099.1.46107 WP_003416099.1.46127 WP_003416099.1.46128 WP_003416099.1.46129 WP_003416099.1.46141 WP_003416099.1.46150 WP_003416099.1.46201 WP_003416099.1.46226 WP_003416099.1.4624 WP_003416099.1.46253 WP_003416099.1.46268 WP_003416099.1.46285 WP_003416099.1.46300 WP_003416099.1.46313 WP_003416099.1.46336 WP_003416099.1.46365 WP_003416099.1.46370 WP_003416099.1.46381 WP_003416099.1.46402 WP_003416099.1.46411 WP_003416099.1.4644 WP_003416099.1.46442 WP_003416099.1.46453 WP_003416099.1.46463 WP_003416099.1.46478 WP_003416099.1.46492 WP_003416099.1.46521 WP_003416099.1.4653 WP_003416099.1.46532 WP_003416099.1.46539 WP_003416099.1.46568 WP_003416099.1.46585 WP_003416099.1.46609 WP_003416099.1.46613 WP_003416099.1.46625 WP_003416099.1.46642 WP_003416099.1.46647 WP_003416099.1.46674 WP_003416099.1.46724 WP_003416099.1.46758 WP_003416099.1.46773 WP_003416099.1.46777 WP_003416099.1.46786 WP_003416099.1.46792 WP_003416099.1.46847 WP_003416099.1.46851 WP_003416099.1.4687 WP_003416099.1.46897 WP_003416099.1.46936 WP_003416099.1.46980 WP_003416099.1.47011 WP_003416099.1.47012 WP_003416099.1.47066 WP_003416099.1.47077 WP_003416099.1.47083 WP_003416099.1.47106 WP_003416099.1.47142 WP_003416099.1.47147 WP_003416099.1.47166 WP_003416099.1.47178 WP_003416099.1.47179 WP_003416099.1.47194 WP_003416099.1.47207 WP_003416099.1.47210 WP_003416099.1.47261 WP_003416099.1.47262 WP_003416099.1.47402 WP_003416099.1.47423 WP_003416099.1.47467 WP_003416099.1.47502 WP_003416099.1.4751 WP_003416099.1.47511 WP_003416099.1.47537 WP_003416099.1.47540 WP_003416099.1.47568 WP_003416099.1.47572 WP_003416099.1.47588 WP_003416099.1.47636 WP_003416099.1.4764 WP_003416099.1.47653 WP_003416099.1.47679 WP_003416099.1.47681 WP_003416099.1.47690 WP_003416099.1.4771 WP_003416099.1.47717 WP_003416099.1.47743 WP_003416099.1.47754 WP_003416099.1.47773 WP_003416099.1.47776 WP_003416099.1.47780 WP_003416099.1.47805 WP_003416099.1.47832 WP_003416099.1.47847 WP_003416099.1.47858 WP_003416099.1.47861 WP_003416099.1.47868 WP_003416099.1.47893 WP_003416099.1.47899 WP_003416099.1.479 WP_003416099.1.47912 WP_003416099.1.47913 WP_003416099.1.47926 WP_003416099.1.4794 WP_003416099.1.47943 WP_003416099.1.47944 WP_003416099.1.47959 WP_003416099.1.47974 WP_003416099.1.47993 WP_003416099.1.48004 WP_003416099.1.48039 WP_003416099.1.48050 WP_003416099.1.48084 WP_003416099.1.48097 WP_003416099.1.48101 WP_003416099.1.48109 WP_003416099.1.4813 WP_003416099.1.48130 WP_003416099.1.48135 WP_003416099.1.48143 WP_003416099.1.48152 WP_003416099.1.48155 WP_003416099.1.48170 WP_003416099.1.48173 WP_003416099.1.48177 WP_003416099.1.48185 WP_003416099.1.48204 WP_003416099.1.48219 WP_003416099.1.4823 WP_003416099.1.48240 WP_003416099.1.48256 WP_003416099.1.48264 WP_003416099.1.48287 WP_003416099.1.48330 WP_003416099.1.48333 WP_003416099.1.48348 WP_003416099.1.48354 WP_003416099.1.48372 WP_003416099.1.48383 WP_003416099.1.48388 WP_003416099.1.48419 WP_003416099.1.48423 WP_003416099.1.48443 WP_003416099.1.48450 WP_003416099.1.48462 WP_003416099.1.48543 WP_003416099.1.48550 WP_003416099.1.48605 WP_003416099.1.48618 WP_003416099.1.4863 WP_003416099.1.48648 WP_003416099.1.48658 WP_003416099.1.48666 WP_003416099.1.48687 WP_003416099.1.48779 WP_003416099.1.4878 WP_003416099.1.48798 WP_003416099.1.48802 WP_003416099.1.48826 WP_003416099.1.48831 WP_003416099.1.48843 WP_003416099.1.48857 WP_003416099.1.4890 WP_003416099.1.48946 WP_003416099.1.48979 WP_003416099.1.49017 WP_003416099.1.49048 WP_003416099.1.49059 WP_003416099.1.4906 WP_003416099.1.4907 WP_003416099.1.49103 WP_003416099.1.49110 WP_003416099.1.49111 WP_003416099.1.49112 WP_003416099.1.4919 WP_003416099.1.49251 WP_003416099.1.49254 WP_003416099.1.49263 WP_003416099.1.49291 WP_003416099.1.49296 WP_003416099.1.49335 WP_003416099.1.49337 WP_003416099.1.49419 WP_003416099.1.49426 WP_003416099.1.49437 WP_003416099.1.49439 WP_003416099.1.49474 WP_003416099.1.49506 WP_003416099.1.49516 WP_003416099.1.49523 WP_003416099.1.49526 WP_003416099.1.49532 WP_003416099.1.49588 WP_003416099.1.4959 WP_003416099.1.49678 WP_003416099.1.49687 WP_003416099.1.49699 WP_003416099.1.49709 WP_003416099.1.4971 WP_003416099.1.4972 WP_003416099.1.49736 WP_003416099.1.49746 WP_003416099.1.49764 WP_003416099.1.49773 WP_003416099.1.49796 WP_003416099.1.49814 WP_003416099.1.49815 WP_003416099.1.49816 WP_003416099.1.49839 WP_003416099.1.49857 WP_003416099.1.49878 WP_003416099.1.49880 WP_003416099.1.49944 WP_003416099.1.4999 WP_003416099.1.49990 WP_003416099.1.50068 WP_003416099.1.50077 WP_003416099.1.5008 WP_003416099.1.50081 WP_003416099.1.50122 WP_003416099.1.50126 WP_003416099.1.50149 WP_003416099.1.50162 WP_003416099.1.5018 WP_003416099.1.50194 WP_003416099.1.50218 WP_003416099.1.50235 WP_003416099.1.50249 WP_003416099.1.50265 WP_003416099.1.50271 WP_003416099.1.50324 WP_003416099.1.50347 WP_003416099.1.50372 WP_003416099.1.50398 WP_003416099.1.50407 WP_003416099.1.50444 WP_003416099.1.50466 WP_003416099.1.50472 WP_003416099.1.5048 WP_003416099.1.50498 WP_003416099.1.5050 WP_003416099.1.50540 WP_003416099.1.50554 WP_003416099.1.50557 WP_003416099.1.50601 WP_003416099.1.50610 WP_003416099.1.50632 WP_003416099.1.50633 WP_003416099.1.50642 WP_003416099.1.50655 WP_003416099.1.50659 WP_003416099.1.50683 WP_003416099.1.50689 WP_003416099.1.50692 WP_003416099.1.50714 WP_003416099.1.50729 WP_003416099.1.50756 WP_003416099.1.50784 WP_003416099.1.50794 WP_003416099.1.50841 WP_003416099.1.50860 WP_003416099.1.50868 WP_003416099.1.50877 WP_003416099.1.5096 WP_003416099.1.50981 WP_003416099.1.50987 WP_003416099.1.51003 WP_003416099.1.51009 WP_003416099.1.51037 WP_003416099.1.51074 WP_003416099.1.51082 WP_003416099.1.51101 WP_003416099.1.51116 WP_003416099.1.51149 WP_003416099.1.51156 WP_003416099.1.51157 WP_003416099.1.51213 WP_003416099.1.51232 WP_003416099.1.51239 WP_003416099.1.51247 WP_003416099.1.51266 WP_003416099.1.51279 WP_003416099.1.51291 WP_003416099.1.51294 WP_003416099.1.51301 WP_003416099.1.51329 WP_003416099.1.51391 WP_003416099.1.51422 WP_003416099.1.51445 WP_003416099.1.51455 WP_003416099.1.51466 WP_003416099.1.51468 WP_003416099.1.51478 WP_003416099.1.51497 WP_003416099.1.51520 WP_003416099.1.51593 WP_003416099.1.51628 WP_003416099.1.5164 WP_003416099.1.51647 WP_003416099.1.51660 WP_003416099.1.51696 WP_003416099.1.51721 WP_003416099.1.51788 WP_003416099.1.51795 WP_003416099.1.51801 WP_003416099.1.51817 WP_003416099.1.51819 WP_003416099.1.51854 WP_003416099.1.51923 WP_003416099.1.51942 WP_003416099.1.51948 WP_003416099.1.51963 WP_003416099.1.51969 WP_003416099.1.52000 WP_003416099.1.52001 WP_003416099.1.52003 WP_003416099.1.52006 WP_003416099.1.52036 WP_003416099.1.52038 WP_003416099.1.52046 WP_003416099.1.52059 WP_003416099.1.52069 WP_003416099.1.52082 WP_003416099.1.52102 WP_003416099.1.52106 WP_003416099.1.52166 WP_003416099.1.52168 WP_003416099.1.52173 WP_003416099.1.52178 WP_003416099.1.52206 WP_003416099.1.52216 WP_003416099.1.52238 WP_003416099.1.52241 WP_003416099.1.52280 WP_003416099.1.52314 WP_003416099.1.52385 WP_003416099.1.52390 WP_003416099.1.524 WP_003416099.1.52460 WP_003416099.1.52485 WP_003416099.1.52486 WP_003416099.1.52504 WP_003416099.1.52522 WP_003416099.1.52531 WP_003416099.1.52533 WP_003416099.1.52545 WP_003416099.1.52553 WP_003416099.1.52563 WP_003416099.1.52564 WP_003416099.1.52574 WP_003416099.1.52641 WP_003416099.1.52673 WP_003416099.1.52674 WP_003416099.1.52708 WP_003416099.1.52713 WP_003416099.1.52761 WP_003416099.1.52778 WP_003416099.1.52791 WP_003416099.1.52797 WP_003416099.1.52818 WP_003416099.1.52872 WP_003416099.1.52873 WP_003416099.1.52891 WP_003416099.1.52892 WP_003416099.1.52909 WP_003416099.1.52970 WP_003416099.1.52998 WP_003416099.1.53053 WP_003416099.1.53056 WP_003416099.1.5306 WP_003416099.1.53088 WP_003416099.1.5309 WP_003416099.1.531 WP_003416099.1.53117 WP_003416099.1.53118 WP_003416099.1.53142 WP_003416099.1.53143 WP_003416099.1.53157 WP_003416099.1.53167 WP_003416099.1.53200 WP_003416099.1.53204 WP_003416099.1.53213 WP_003416099.1.53217 WP_003416099.1.53226 WP_003416099.1.53229 WP_003416099.1.53230 WP_003416099.1.53237 WP_003416099.1.53254 WP_003416099.1.53257 WP_003416099.1.5327 WP_003416099.1.53276 WP_003416099.1.53278 WP_003416099.1.533 WP_003416099.1.53302 WP_003416099.1.53306 WP_003416099.1.5334 WP_003416099.1.5335 WP_003416099.1.53353 WP_003416099.1.53381 WP_003416099.1.53458 WP_003416099.1.53460 WP_003416099.1.53480 WP_003416099.1.53517 WP_003416099.1.53522 WP_003416099.1.53525 WP_003416099.1.53526 WP_003416099.1.53553 WP_003416099.1.53606 WP_003416099.1.53609 WP_003416099.1.53628 WP_003416099.1.53643 WP_003416099.1.53667 WP_003416099.1.53679 WP_003416099.1.53715 WP_003416099.1.53730 WP_003416099.1.53742 WP_003416099.1.53743 WP_003416099.1.53754 WP_003416099.1.53775 WP_003416099.1.53787 WP_003416099.1.53803 WP_003416099.1.53818 WP_003416099.1.53822 WP_003416099.1.53853 WP_003416099.1.53865 WP_003416099.1.53888 WP_003416099.1.53900 WP_003416099.1.53912 WP_003416099.1.53914 WP_003416099.1.53952 WP_003416099.1.5398 WP_003416099.1.5408 WP_003416099.1.54089 WP_003416099.1.54093 WP_003416099.1.54099 WP_003416099.1.54112 WP_003416099.1.54125 WP_003416099.1.54141 WP_003416099.1.54162 WP_003416099.1.54179 WP_003416099.1.54206 WP_003416099.1.54218 WP_003416099.1.54225 WP_003416099.1.54227 WP_003416099.1.54232 WP_003416099.1.54241 WP_003416099.1.54245 WP_003416099.1.54247 WP_003416099.1.54260 WP_003416099.1.54275 WP_003416099.1.54280 WP_003416099.1.5429 WP_003416099.1.54294 WP_003416099.1.54314 WP_003416099.1.54347 WP_003416099.1.54351 WP_003416099.1.54370 WP_003416099.1.54428 WP_003416099.1.54449 WP_003416099.1.54494 WP_003416099.1.54502 WP_003416099.1.54514 WP_003416099.1.54519 WP_003416099.1.5452 WP_003416099.1.54531 WP_003416099.1.54537 WP_003416099.1.54553 WP_003416099.1.54555 WP_003416099.1.54575 WP_003416099.1.54633 WP_003416099.1.54686 WP_003416099.1.54687 WP_003416099.1.54705 WP_003416099.1.54730 WP_003416099.1.54732 WP_003416099.1.5475 WP_003416099.1.54797 WP_003416099.1.54807 WP_003416099.1.54836 WP_003416099.1.54838 WP_003416099.1.54860 WP_003416099.1.54888 WP_003416099.1.54897 WP_003416099.1.54905 WP_003416099.1.54909 WP_003416099.1.54937 WP_003416099.1.54939 WP_003416099.1.54944 WP_003416099.1.54945 WP_003416099.1.54953 WP_003416099.1.54964 WP_003416099.1.55015 WP_003416099.1.55022 WP_003416099.1.55023 WP_003416099.1.55051 WP_003416099.1.55072 WP_003416099.1.55088 WP_003416099.1.55106 WP_003416099.1.55126 WP_003416099.1.55128 WP_003416099.1.55140 WP_003416099.1.55150 WP_003416099.1.55210 WP_003416099.1.55227 WP_003416099.1.55248 WP_003416099.1.55257 WP_003416099.1.55258 WP_003416099.1.55267 WP_003416099.1.55279 WP_003416099.1.55307 WP_003416099.1.55326 WP_003416099.1.55328 WP_003416099.1.5533 WP_003416099.1.55345 WP_003416099.1.55396 WP_003416099.1.55398 WP_003416099.1.55441 WP_003416099.1.55459 WP_003416099.1.55501 WP_003416099.1.55504 WP_003416099.1.55578 WP_003416099.1.55626 WP_003416099.1.55641 WP_003416099.1.5569 WP_003416099.1.55723 WP_003416099.1.55735 WP_003416099.1.5574 WP_003416099.1.55772 WP_003416099.1.55802 WP_003416099.1.55807 WP_003416099.1.55819 WP_003416099.1.55821 WP_003416099.1.5583 WP_003416099.1.55849 WP_003416099.1.55856 WP_003416099.1.55860 WP_003416099.1.55882 WP_003416099.1.55883 WP_003416099.1.55894 WP_003416099.1.55902 WP_003416099.1.55908 WP_003416099.1.55909 WP_003416099.1.5591 WP_003416099.1.55961 WP_003416099.1.55977 WP_003416099.1.55983 WP_003416099.1.56028 WP_003416099.1.56057 WP_003416099.1.56060 WP_003416099.1.56107 WP_003416099.1.56132 WP_003416099.1.56163 WP_003416099.1.56167 WP_003416099.1.56178 WP_003416099.1.56287 WP_003416099.1.56292 WP_003416099.1.56327 WP_003416099.1.56341 WP_003416099.1.56359 WP_003416099.1.56365 WP_003416099.1.56394 WP_003416099.1.56443 WP_003416099.1.56473 WP_003416099.1.56478 WP_003416099.1.56500 WP_003416099.1.56517 WP_003416099.1.56534 WP_003416099.1.5656 WP_003416099.1.56577 WP_003416099.1.56593 WP_003416099.1.56625 WP_003416099.1.56637 WP_003416099.1.56670 WP_003416099.1.56697 WP_003416099.1.567 WP_003416099.1.56701 WP_003416099.1.56709 WP_003416099.1.56729 WP_003416099.1.56743 WP_003416099.1.56755 WP_003416099.1.56764 WP_003416099.1.56769 WP_003416099.1.56770 WP_003416099.1.56795 WP_003416099.1.5681 WP_003416099.1.56827 WP_003416099.1.56839 WP_003416099.1.56863 WP_003416099.1.56868 WP_003416099.1.56869 WP_003416099.1.56915 WP_003416099.1.56926 WP_003416099.1.56961 WP_003416099.1.56971 WP_003416099.1.56972 WP_003416099.1.57023 WP_003416099.1.57035 WP_003416099.1.57077 WP_003416099.1.57087 WP_003416099.1.57094 WP_003416099.1.57134 WP_003416099.1.57151 WP_003416099.1.57169 WP_003416099.1.57208 WP_003416099.1.57212 WP_003416099.1.57230 WP_003416099.1.5724 WP_003416099.1.5725 WP_003416099.1.5727 WP_003416099.1.57273 WP_003416099.1.573 WP_003416099.1.57314 WP_003416099.1.57326 WP_003416099.1.57328 WP_003416099.1.57331 WP_003416099.1.57340 WP_003416099.1.57351 WP_003416099.1.57352 WP_003416099.1.57380 WP_003416099.1.57430 WP_003416099.1.5744 WP_003416099.1.57440 WP_003416099.1.5745 WP_003416099.1.57461 WP_003416099.1.57469 WP_003416099.1.57489 WP_003416099.1.575 WP_003416099.1.57509 WP_003416099.1.57519 WP_003416099.1.57525 WP_003416099.1.57551 WP_003416099.1.5758 WP_003416099.1.57596 WP_003416099.1.57604 WP_003416099.1.57616 WP_003416099.1.57617 WP_003416099.1.57619 WP_003416099.1.57627 WP_003416099.1.57642 WP_003416099.1.57658 WP_003416099.1.57667 WP_003416099.1.57675 WP_003416099.1.57689 WP_003416099.1.57708 WP_003416099.1.57794 WP_003416099.1.57821 WP_003416099.1.57825 WP_003416099.1.57843 WP_003416099.1.57906 WP_003416099.1.57924 WP_003416099.1.57926 WP_003416099.1.57930 WP_003416099.1.57957 WP_003416099.1.57960 WP_003416099.1.57964 WP_003416099.1.57991 WP_003416099.1.58000 WP_003416099.1.58086 WP_003416099.1.58101 WP_003416099.1.58103 WP_003416099.1.58108 WP_003416099.1.5811 WP_003416099.1.58121 WP_003416099.1.58145 WP_003416099.1.58164 WP_003416099.1.58174 WP_003416099.1.582 WP_003416099.1.58202 WP_003416099.1.58209 WP_003416099.1.58215 WP_003416099.1.5824 WP_003416099.1.58250 WP_003416099.1.58259 WP_003416099.1.58283 WP_003416099.1.58288 WP_003416099.1.5830 WP_003416099.1.58303 WP_003416099.1.58311 WP_003416099.1.58330 WP_003416099.1.58359 WP_003416099.1.58386 WP_003416099.1.58393 WP_003416099.1.58431 WP_003416099.1.5844 WP_003416099.1.58457 WP_003416099.1.58488 WP_003416099.1.58518 WP_003416099.1.58534 WP_003416099.1.58559 WP_003416099.1.58567 WP_003416099.1.58573 WP_003416099.1.58602 WP_003416099.1.58612 WP_003416099.1.58619 WP_003416099.1.58630 WP_003416099.1.5865 WP_003416099.1.58671 WP_003416099.1.58690 WP_003416099.1.58702 WP_003416099.1.58743 WP_003416099.1.58754 WP_003416099.1.5879 WP_003416099.1.5881 WP_003416099.1.58824 WP_003416099.1.58848 WP_003416099.1.58857 WP_003416099.1.58891 WP_003416099.1.58892 WP_003416099.1.5890 WP_003416099.1.58904 WP_003416099.1.58921 WP_003416099.1.58930 WP_003416099.1.58939 WP_003416099.1.58941 WP_003416099.1.58953 WP_003416099.1.58961 WP_003416099.1.5898 WP_003416099.1.59025 WP_003416099.1.59029 WP_003416099.1.59037 WP_003416099.1.59044 WP_003416099.1.59085 WP_003416099.1.59088 WP_003416099.1.59112 WP_003416099.1.59130 WP_003416099.1.5914 WP_003416099.1.59147 WP_003416099.1.59166 WP_003416099.1.59205 WP_003416099.1.59209 WP_003416099.1.59237 WP_003416099.1.59240 WP_003416099.1.59253 WP_003416099.1.59254 WP_003416099.1.59262 WP_003416099.1.59270 WP_003416099.1.5928 WP_003416099.1.59304 WP_003416099.1.59305 WP_003416099.1.59309 WP_003416099.1.59316 WP_003416099.1.59326 WP_003416099.1.59328 WP_003416099.1.59333 WP_003416099.1.59338 WP_003416099.1.59388 WP_003416099.1.59428 WP_003416099.1.59487 WP_003416099.1.59537 WP_003416099.1.59561 WP_003416099.1.59677 WP_003416099.1.59722 WP_003416099.1.59727 WP_003416099.1.59732 WP_003416099.1.59738 WP_003416099.1.59750 WP_003416099.1.59757 WP_003416099.1.59761 WP_003416099.1.59808 WP_003416099.1.59850 WP_003416099.1.59856 WP_003416099.1.59860 WP_003416099.1.59861 WP_003416099.1.5987 WP_003416099.1.59878 WP_003416099.1.59888 WP_003416099.1.59952 WP_003416099.1.5996 WP_003416099.1.59961 WP_003416099.1.59974 WP_003416099.1.6000 WP_003416099.1.60007 WP_003416099.1.60016 WP_003416099.1.6003 WP_003416099.1.60047 WP_003416099.1.6007 WP_003416099.1.60091 WP_003416099.1.60121 WP_003416099.1.60125 WP_003416099.1.60135 WP_003416099.1.60139 WP_003416099.1.60152 WP_003416099.1.60171 WP_003416099.1.60197 WP_003416099.1.6020 WP_003416099.1.60205 WP_003416099.1.60207 WP_003416099.1.60215 WP_003416099.1.60217 WP_003416099.1.60267 WP_003416099.1.60288 WP_003416099.1.60291 WP_003416099.1.60301 WP_003416099.1.60305 WP_003416099.1.60312 WP_003416099.1.60313 WP_003416099.1.60314 WP_003416099.1.60367 WP_003416099.1.60376 WP_003416099.1.60403 WP_003416099.1.60413 WP_003416099.1.60421 WP_003416099.1.60451 WP_003416099.1.60460 WP_003416099.1.60479 WP_003416099.1.60487 WP_003416099.1.60512 WP_003416099.1.60573 WP_003416099.1.60583 WP_003416099.1.60632 WP_003416099.1.60657 WP_003416099.1.60687 WP_003416099.1.60689 WP_003416099.1.60727 WP_003416099.1.60738 WP_003416099.1.60763 WP_003416099.1.6077 WP_003416099.1.60791 WP_003416099.1.60834 WP_003416099.1.60870 WP_003416099.1.60878 WP_003416099.1.60879 WP_003416099.1.60913 WP_003416099.1.60978 WP_003416099.1.61000 WP_003416099.1.61001 WP_003416099.1.61012 WP_003416099.1.61014 WP_003416099.1.61015 WP_003416099.1.61037 WP_003416099.1.61052 WP_003416099.1.61065 WP_003416099.1.61100 WP_003416099.1.61101 WP_003416099.1.61138 WP_003416099.1.61142 WP_003416099.1.61198 WP_003416099.1.612 WP_003416099.1.61234 WP_003416099.1.61256 WP_003416099.1.61281 WP_003416099.1.61314 WP_003416099.1.61321 WP_003416099.1.61326 WP_003416099.1.61328 WP_003416099.1.61368 WP_003416099.1.61391 WP_003416099.1.61406 WP_003416099.1.61409 WP_003416099.1.61420 WP_003416099.1.61422 WP_003416099.1.61425 WP_003416099.1.61428 WP_003416099.1.61469 WP_003416099.1.61494 WP_003416099.1.61522 WP_003416099.1.61552 WP_003416099.1.61557 WP_003416099.1.61567 WP_003416099.1.61571 WP_003416099.1.61573 WP_003416099.1.61584 WP_003416099.1.61586 WP_003416099.1.6159 WP_003416099.1.61592 WP_003416099.1.6160 WP_003416099.1.61614 WP_003416099.1.6163 WP_003416099.1.61655 WP_003416099.1.61665 WP_003416099.1.61669 WP_003416099.1.61682 WP_003416099.1.61692 WP_003416099.1.61719 WP_003416099.1.61728 WP_003416099.1.61750 WP_003416099.1.61754 WP_003416099.1.61755 WP_003416099.1.61757 WP_003416099.1.61778 WP_003416099.1.6179 WP_003416099.1.61793 WP_003416099.1.61816 WP_003416099.1.61842 WP_003416099.1.61850 WP_003416099.1.61862 WP_003416099.1.61865 WP_003416099.1.61868 WP_003416099.1.61911 WP_003416099.1.61925 WP_003416099.1.61941 WP_003416099.1.61953 WP_003416099.1.61979 WP_003416099.1.61987 WP_003416099.1.61998 WP_003416099.1.62021 WP_003416099.1.62087 WP_003416099.1.62089 WP_003416099.1.62101 WP_003416099.1.62104 WP_003416099.1.6211 WP_003416099.1.62132 WP_003416099.1.62162 WP_003416099.1.62225 WP_003416099.1.62230 WP_003416099.1.62238 WP_003416099.1.62249 WP_003416099.1.62270 WP_003416099.1.62281 WP_003416099.1.62307 WP_003416099.1.6231 WP_003416099.1.62359 WP_003416099.1.62360 WP_003416099.1.62371 WP_003416099.1.62379 WP_003416099.1.62395 WP_003416099.1.62408 WP_003416099.1.62449 WP_003416099.1.62468 WP_003416099.1.6248 WP_003416099.1.62508 WP_003416099.1.62565 WP_003416099.1.62594 WP_003416099.1.62606 WP_003416099.1.62616 WP_003416099.1.62666 WP_003416099.1.62687 WP_003416099.1.62715 WP_003416099.1.62730 WP_003416099.1.62738 WP_003416099.1.62761 WP_003416099.1.62766 WP_003416099.1.62786 WP_003416099.1.62813 WP_003416099.1.62839 WP_003416099.1.62841 WP_003416099.1.62909 WP_003416099.1.62936 WP_003416099.1.6294 WP_003416099.1.6295 WP_003416099.1.62962 WP_003416099.1.63007 WP_003416099.1.63019 WP_003416099.1.63032 WP_003416099.1.63037 WP_003416099.1.63064 WP_003416099.1.63066 WP_003416099.1.63072 WP_003416099.1.6308 WP_003416099.1.63081 WP_003416099.1.63096 WP_003416099.1.63106 WP_003416099.1.6314 WP_003416099.1.63144 WP_003416099.1.63154 WP_003416099.1.63160 WP_003416099.1.63161 WP_003416099.1.63166 WP_003416099.1.63175 WP_003416099.1.63194 WP_003416099.1.6322 WP_003416099.1.63222 WP_003416099.1.63247 WP_003416099.1.6328 WP_003416099.1.63291 WP_003416099.1.63312 WP_003416099.1.63317 WP_003416099.1.63331 WP_003416099.1.63373 WP_003416099.1.63384 WP_003416099.1.63403 WP_003416099.1.63424 WP_003416099.1.63428 WP_003416099.1.6345 WP_003416099.1.63464 WP_003416099.1.63483 WP_003416099.1.63502 WP_003416099.1.63504 WP_003416099.1.63522 WP_003416099.1.63530 WP_003416099.1.63538 WP_003416099.1.63564 WP_003416099.1.63567 WP_003416099.1.63596 WP_003416099.1.63600 WP_003416099.1.63623 WP_003416099.1.63624 WP_003416099.1.63625 WP_003416099.1.63627 WP_003416099.1.63654 WP_003416099.1.63662 WP_003416099.1.63711 WP_003416099.1.63734 WP_003416099.1.63807 WP_003416099.1.63819 WP_003416099.1.63844 WP_003416099.1.63888 WP_003416099.1.63913 WP_003416099.1.63915 WP_003416099.1.63918 WP_003416099.1.63961 WP_003416099.1.63970 WP_003416099.1.64000 WP_003416099.1.64027 WP_003416099.1.64058 WP_003416099.1.64065 WP_003416099.1.6407 WP_003416099.1.64082 WP_003416099.1.64091 WP_003416099.1.64102 WP_003416099.1.64104 WP_003416099.1.64119 WP_003416099.1.64169 WP_003416099.1.64219 WP_003416099.1.6422 WP_003416099.1.64222 WP_003416099.1.64223 WP_003416099.1.64228 WP_003416099.1.64235 WP_003416099.1.64249 WP_003416099.1.6427 WP_003416099.1.64278 WP_003416099.1.64287 WP_003416099.1.64414 WP_003416099.1.64419 WP_003416099.1.6443 WP_003416099.1.64463 WP_003416099.1.64480 WP_003416099.1.64497 WP_003416099.1.64506 WP_003416099.1.64511 WP_003416099.1.64513 WP_003416099.1.64514 WP_003416099.1.64515 WP_003416099.1.64522 WP_003416099.1.64526 WP_003416099.1.64543 WP_003416099.1.6456 WP_003416099.1.64567 WP_003416099.1.64588 WP_003416099.1.64589 WP_003416099.1.64594 WP_003416099.1.64595 WP_003416099.1.64608 WP_003416099.1.64619 WP_003416099.1.64629 WP_003416099.1.6464 WP_003416099.1.64664 WP_003416099.1.64669 WP_003416099.1.64672 WP_003416099.1.64680 WP_003416099.1.64682 WP_003416099.1.64727 WP_003416099.1.64729 WP_003416099.1.64774 WP_003416099.1.64776 WP_003416099.1.64802 WP_003416099.1.64832 WP_003416099.1.6486 WP_003416099.1.64870 WP_003416099.1.64898 WP_003416099.1.64922 WP_003416099.1.64924 WP_003416099.1.6493 WP_003416099.1.64937 WP_003416099.1.64941 WP_003416099.1.64966 WP_003416099.1.64973 WP_003416099.1.65001 WP_003416099.1.65026 WP_003416099.1.65053 WP_003416099.1.65070 WP_003416099.1.65079 WP_003416099.1.65102 WP_003416099.1.65157 WP_003416099.1.65181 WP_003416099.1.65212 WP_003416099.1.65229 WP_003416099.1.6523 WP_003416099.1.65253 WP_003416099.1.65289 WP_003416099.1.65291 WP_003416099.1.65315 WP_003416099.1.65329 WP_003416099.1.65359 WP_003416099.1.6536 WP_003416099.1.65374 WP_003416099.1.65386 WP_003416099.1.65414 WP_003416099.1.65416 WP_003416099.1.65433 WP_003416099.1.65455 WP_003416099.1.65467 WP_003416099.1.65488 WP_003416099.1.65529 WP_003416099.1.65539 WP_003416099.1.65583 WP_003416099.1.65612 WP_003416099.1.65623 WP_003416099.1.65635 WP_003416099.1.65637 WP_003416099.1.65648 WP_003416099.1.65683 WP_003416099.1.65686 WP_003416099.1.65688 WP_003416099.1.65707 WP_003416099.1.65733 WP_003416099.1.65746 WP_003416099.1.65747 WP_003416099.1.65759 WP_003416099.1.65816 WP_003416099.1.65830 WP_003416099.1.65858 WP_003416099.1.65862 WP_003416099.1.65869 WP_003416099.1.65893 WP_003416099.1.65929 WP_003416099.1.65932 WP_003416099.1.65958 WP_003416099.1.65974 WP_003416099.1.66004 WP_003416099.1.66013 WP_003416099.1.6606 WP_003416099.1.66089 WP_003416099.1.66149 WP_003416099.1.66151 WP_003416099.1.66229 WP_003416099.1.66276 WP_003416099.1.66293 WP_003416099.1.66297 WP_003416099.1.66323 WP_003416099.1.66325 WP_003416099.1.6633 WP_003416099.1.66334 WP_003416099.1.66355 WP_003416099.1.66367 WP_003416099.1.66394 WP_003416099.1.66396 WP_003416099.1.66451 WP_003416099.1.66455 WP_003416099.1.66457 WP_003416099.1.66460 WP_003416099.1.66464 WP_003416099.1.66466 WP_003416099.1.66487 WP_003416099.1.66504 WP_003416099.1.66544 WP_003416099.1.66558 WP_003416099.1.66580 WP_003416099.1.66582 WP_003416099.1.66612 WP_003416099.1.66615 WP_003416099.1.66617 WP_003416099.1.66635 WP_003416099.1.66656 WP_003416099.1.66663 WP_003416099.1.66675 WP_003416099.1.66715 WP_003416099.1.66718 WP_003416099.1.66762 WP_003416099.1.66776 WP_003416099.1.66808 WP_003416099.1.66817 WP_003416099.1.66819 WP_003416099.1.66826 WP_003416099.1.66830 WP_003416099.1.66842 WP_003416099.1.66868 WP_003416099.1.66878 WP_003416099.1.66880 WP_003416099.1.66893 WP_003416099.1.66961 WP_003416099.1.67005 WP_003416099.1.6704 WP_003416099.1.67044 WP_003416099.1.67061 WP_003416099.1.67089 WP_003416099.1.67098 WP_003416099.1.67146 WP_003416099.1.67170 WP_003416099.1.67197 WP_003416099.1.67198 WP_003416099.1.6720 WP_003416099.1.67207 WP_003416099.1.67218 WP_003416099.1.67220 WP_003416099.1.67225 WP_003416099.1.67231 WP_003416099.1.6724 WP_003416099.1.67257 WP_003416099.1.67298 WP_003416099.1.67307 WP_003416099.1.67324 WP_003416099.1.67332 WP_003416099.1.67346 WP_003416099.1.67354 WP_003416099.1.67360 WP_003416099.1.67381 WP_003416099.1.67396 WP_003416099.1.67417 WP_003416099.1.67422 WP_003416099.1.67453 WP_003416099.1.67459 WP_003416099.1.6746 WP_003416099.1.67473 WP_003416099.1.67481 WP_003416099.1.67482 WP_003416099.1.67496 WP_003416099.1.67499 WP_003416099.1.67516 WP_003416099.1.67523 WP_003416099.1.67536 WP_003416099.1.67575 WP_003416099.1.67587 WP_003416099.1.67598 WP_003416099.1.67600 WP_003416099.1.67602 WP_003416099.1.67630 WP_003416099.1.67679 WP_003416099.1.67692 WP_003416099.1.67744 WP_003416099.1.6775 WP_003416099.1.67750 WP_003416099.1.6777 WP_003416099.1.67809 WP_003416099.1.67816 WP_003416099.1.67844 WP_003416099.1.67848 WP_003416099.1.67870 WP_003416099.1.67888 WP_003416099.1.67915 WP_003416099.1.67945 WP_003416099.1.67949 WP_003416099.1.67980 WP_003416099.1.67982 WP_003416099.1.68022 WP_003416099.1.68029 WP_003416099.1.68037 WP_003416099.1.68038 WP_003416099.1.68045 WP_003416099.1.68057 WP_003416099.1.68083 WP_003416099.1.68088 WP_003416099.1.68106 WP_003416099.1.68110 WP_003416099.1.68153 WP_003416099.1.68164 WP_003416099.1.68169 WP_003416099.1.68193 WP_003416099.1.68212 WP_003416099.1.68227 WP_003416099.1.68243 WP_003416099.1.6825 WP_003416099.1.68297 WP_003416099.1.68309 WP_003416099.1.68325 WP_003416099.1.68329 WP_003416099.1.68340 WP_003416099.1.68384 WP_003416099.1.68388 WP_003416099.1.68429 WP_003416099.1.6843 WP_003416099.1.68433 WP_003416099.1.68444 WP_003416099.1.68465 WP_003416099.1.68484 WP_003416099.1.68518 WP_003416099.1.68569 WP_003416099.1.68576 WP_003416099.1.68580 WP_003416099.1.68586 WP_003416099.1.68623 WP_003416099.1.68624 WP_003416099.1.68637 WP_003416099.1.68646 WP_003416099.1.68667 WP_003416099.1.68669 WP_003416099.1.68672 WP_003416099.1.68684 WP_003416099.1.68704 WP_003416099.1.68708 WP_003416099.1.6872 WP_003416099.1.68730 WP_003416099.1.68734 WP_003416099.1.68748 WP_003416099.1.68754 WP_003416099.1.6876 WP_003416099.1.68761 WP_003416099.1.68763 WP_003416099.1.68766 WP_003416099.1.68774 WP_003416099.1.68796 WP_003416099.1.68824 WP_003416099.1.68832 WP_003416099.1.68833 WP_003416099.1.68841 WP_003416099.1.68859 WP_003416099.1.68876 WP_003416099.1.68906 WP_003416099.1.68916 WP_003416099.1.68923 WP_003416099.1.68945 WP_003416099.1.6896 WP_003416099.1.68981 WP_003416099.1.68984 WP_003416099.1.68997 WP_003416099.1.69008 WP_003416099.1.69076 WP_003416099.1.69079 WP_003416099.1.6908 WP_003416099.1.69082 WP_003416099.1.69178 WP_003416099.1.69181 WP_003416099.1.69208 WP_003416099.1.69231 WP_003416099.1.69256 WP_003416099.1.69311 WP_003416099.1.69315 WP_003416099.1.69322 WP_003416099.1.69342 WP_003416099.1.6935 WP_003416099.1.6936 WP_003416099.1.69369 WP_003416099.1.69374 WP_003416099.1.69398 WP_003416099.1.69401 WP_003416099.1.69426 WP_003416099.1.69427 WP_003416099.1.69429 WP_003416099.1.6949 WP_003416099.1.6951 WP_003416099.1.69511 WP_003416099.1.69526 WP_003416099.1.69528 WP_003416099.1.69547 WP_003416099.1.69573 WP_003416099.1.69581 WP_003416099.1.6960 WP_003416099.1.69617 WP_003416099.1.69634 WP_003416099.1.69647 WP_003416099.1.69659 WP_003416099.1.69673 WP_003416099.1.69682 WP_003416099.1.69684 WP_003416099.1.69686 WP_003416099.1.69707 WP_003416099.1.69709 WP_003416099.1.69723 WP_003416099.1.69736 WP_003416099.1.69778 WP_003416099.1.69800 WP_003416099.1.69802 WP_003416099.1.69845 WP_003416099.1.69870 WP_003416099.1.69873 WP_003416099.1.69898 WP_003416099.1.69913 WP_003416099.1.69925 WP_003416099.1.69931 WP_003416099.1.69938 WP_003416099.1.69955 WP_003416099.1.69957 WP_003416099.1.69981 WP_003416099.1.69990 WP_003416099.1.70 WP_003416099.1.70000 WP_003416099.1.70017 WP_003416099.1.70032 WP_003416099.1.70055 WP_003416099.1.70062 WP_003416099.1.70072 WP_003416099.1.70131 WP_003416099.1.70132 WP_003416099.1.7022 WP_003416099.1.70227 WP_003416099.1.70255 WP_003416099.1.70271 WP_003416099.1.70274 WP_003416099.1.7029 WP_003416099.1.70325 WP_003416099.1.70328 WP_003416099.1.70356 WP_003416099.1.70364 WP_003416099.1.70368 WP_003416099.1.70369 WP_003416099.1.70418 WP_003416099.1.70422 WP_003416099.1.70435 WP_003416099.1.70444 WP_003416099.1.70463 WP_003416099.1.70471 WP_003416099.1.70480 WP_003416099.1.70494 WP_003416099.1.70498 WP_003416099.1.70505 WP_003416099.1.70525 WP_003416099.1.70573 WP_003416099.1.70577 WP_003416099.1.70610 WP_003416099.1.70615 WP_003416099.1.70618 WP_003416099.1.70622 WP_003416099.1.70626 WP_003416099.1.70668 WP_003416099.1.70699 WP_003416099.1.70704 WP_003416099.1.70729 WP_003416099.1.70757 WP_003416099.1.70782 WP_003416099.1.70796 WP_003416099.1.70834 WP_003416099.1.7084 WP_003416099.1.70864 WP_003416099.1.70871 WP_003416099.1.70915 WP_003416099.1.70955 WP_003416099.1.70958 WP_003416099.1.70964 WP_003416099.1.70976 WP_003416099.1.71015 WP_003416099.1.71026 WP_003416099.1.71063 WP_003416099.1.71076 WP_003416099.1.71083 WP_003416099.1.7111 WP_003416099.1.71118 WP_003416099.1.71128 WP_003416099.1.7113 WP_003416099.1.71187 WP_003416099.1.71191 WP_003416099.1.71255 WP_003416099.1.71258 WP_003416099.1.71259 WP_003416099.1.71289 WP_003416099.1.71326 WP_003416099.1.71329 WP_003416099.1.71331 WP_003416099.1.71344 WP_003416099.1.71390 WP_003416099.1.71399 WP_003416099.1.71414 WP_003416099.1.71440 WP_003416099.1.71457 WP_003416099.1.7146 WP_003416099.1.71464 WP_003416099.1.71490 WP_003416099.1.71492 WP_003416099.1.71509 WP_003416099.1.71516 WP_003416099.1.71517 WP_003416099.1.71527 WP_003416099.1.71532 WP_003416099.1.71545 WP_003416099.1.71546 WP_003416099.1.71569 WP_003416099.1.71604 WP_003416099.1.71621 WP_003416099.1.71630 WP_003416099.1.71638 WP_003416099.1.71654 WP_003416099.1.71664 WP_003416099.1.71665 WP_003416099.1.71683 WP_003416099.1.71701 WP_003416099.1.71718 WP_003416099.1.71731 WP_003416099.1.71778 WP_003416099.1.71781 WP_003416099.1.71803 WP_003416099.1.71820 WP_003416099.1.71847 WP_003416099.1.7185 WP_003416099.1.71851 WP_003416099.1.71871 WP_003416099.1.71909 WP_003416099.1.71957 WP_003416099.1.71970 WP_003416099.1.72047 WP_003416099.1.72061 WP_003416099.1.72062 WP_003416099.1.72072 WP_003416099.1.72111 WP_003416099.1.72122 WP_003416099.1.72143 WP_003416099.1.7216 WP_003416099.1.72168 WP_003416099.1.72179 WP_003416099.1.72209 WP_003416099.1.72218 WP_003416099.1.72219 WP_003416099.1.72227 WP_003416099.1.7224 WP_003416099.1.72268 WP_003416099.1.72332 WP_003416099.1.72380 WP_003416099.1.72401 WP_003416099.1.72405 WP_003416099.1.72420 WP_003416099.1.72441 WP_003416099.1.72451 WP_003416099.1.72452 WP_003416099.1.72457 WP_003416099.1.72459 WP_003416099.1.72460 WP_003416099.1.72466 WP_003416099.1.72487 WP_003416099.1.72488 WP_003416099.1.72492 WP_003416099.1.72506 WP_003416099.1.72543 WP_003416099.1.7256 WP_003416099.1.72576 WP_003416099.1.72578 WP_003416099.1.72585 WP_003416099.1.72591 WP_003416099.1.72592 WP_003416099.1.72640 WP_003416099.1.7266 WP_003416099.1.72661 WP_003416099.1.72739 WP_003416099.1.72744 WP_003416099.1.72755 WP_003416099.1.72759 WP_003416099.1.72784 WP_003416099.1.72792 WP_003416099.1.72826 WP_003416099.1.72831 WP_003416099.1.72852 WP_003416099.1.72853 WP_003416099.1.72879 WP_003416099.1.72880 WP_003416099.1.72938 WP_003416099.1.72954 WP_003416099.1.72957 WP_003416099.1.72959 WP_003416099.1.72973 WP_003416099.1.7298 WP_003416099.1.72982 WP_003416099.1.72988 WP_003416099.1.72993 WP_003416099.1.73006 WP_003416099.1.73013 WP_003416099.1.73025 WP_003416099.1.73028 WP_003416099.1.73042 WP_003416099.1.73045 WP_003416099.1.73092 WP_003416099.1.73118 WP_003416099.1.7312 WP_003416099.1.73127 WP_003416099.1.73134 WP_003416099.1.73150 WP_003416099.1.73154 WP_003416099.1.73163 WP_003416099.1.73182 WP_003416099.1.73205 WP_003416099.1.7321 WP_003416099.1.73310 WP_003416099.1.73315 WP_003416099.1.73365 WP_003416099.1.73391 WP_003416099.1.73404 WP_003416099.1.73424 WP_003416099.1.73436 WP_003416099.1.73445 WP_003416099.1.73453 WP_003416099.1.73465 WP_003416099.1.73466 WP_003416099.1.73470 WP_003416099.1.73471 WP_003416099.1.73478 WP_003416099.1.73482 WP_003416099.1.73507 WP_003416099.1.73532 WP_003416099.1.73550 WP_003416099.1.73564 WP_003416099.1.73623 WP_003416099.1.73629 WP_003416099.1.73644 WP_003416099.1.7366 WP_003416099.1.73661 WP_003416099.1.7368 WP_003416099.1.73688 WP_003416099.1.73723 WP_003416099.1.73744 WP_003416099.1.73750 WP_003416099.1.73760 WP_003416099.1.73774 WP_003416099.1.7379 WP_003416099.1.73813 WP_003416099.1.73840 WP_003416099.1.73876 WP_003416099.1.7389 WP_003416099.1.73986 WP_003416099.1.74016 WP_003416099.1.74039 WP_003416099.1.74083 WP_003416099.1.74101 WP_003416099.1.74107 WP_003416099.1.74120 WP_003416099.1.74129 WP_003416099.1.74144 WP_003416099.1.7417 WP_003416099.1.74190 WP_003416099.1.74210 WP_003416099.1.7423 WP_003416099.1.74259 WP_003416099.1.74262 WP_003416099.1.74269 WP_003416099.1.74282 WP_003416099.1.74291 WP_003416099.1.74296 WP_003416099.1.74304 WP_003416099.1.7432 WP_003416099.1.74347 WP_003416099.1.7436 WP_003416099.1.74378 WP_003416099.1.74382 WP_003416099.1.74395 WP_003416099.1.74400 WP_003416099.1.74401 WP_003416099.1.74432 WP_003416099.1.74442 WP_003416099.1.74477 WP_003416099.1.74487 WP_003416099.1.74499 WP_003416099.1.74504 WP_003416099.1.74511 WP_003416099.1.74523 WP_003416099.1.74525 WP_003416099.1.74551 WP_003416099.1.74555 WP_003416099.1.74628 WP_003416099.1.74641 WP_003416099.1.74653 WP_003416099.1.74660 WP_003416099.1.74683 WP_003416099.1.7469 WP_003416099.1.74725 WP_003416099.1.74760 WP_003416099.1.74809 WP_003416099.1.74820 WP_003416099.1.74870 WP_003416099.1.74881 WP_003416099.1.74888 WP_003416099.1.74952 WP_003416099.1.7496 WP_003416099.1.74988 WP_003416099.1.75043 WP_003416099.1.75045 WP_003416099.1.75055 WP_003416099.1.75078 WP_003416099.1.75081 WP_003416099.1.75120 WP_003416099.1.75163 WP_003416099.1.75188 WP_003416099.1.75200 WP_003416099.1.75202 WP_003416099.1.75234 WP_003416099.1.75239 WP_003416099.1.75250 WP_003416099.1.75263 WP_003416099.1.75281 WP_003416099.1.75342 WP_003416099.1.7535 WP_003416099.1.75376 WP_003416099.1.75391 WP_003416099.1.75395 WP_003416099.1.75441 WP_003416099.1.75510 WP_003416099.1.75581 WP_003416099.1.75598 WP_003416099.1.75635 WP_003416099.1.75645 WP_003416099.1.75665 WP_003416099.1.75671 WP_003416099.1.75749 WP_003416099.1.75772 WP_003416099.1.75774 WP_003416099.1.75811 WP_003416099.1.75833 WP_003416099.1.7585 WP_003416099.1.75864 WP_003416099.1.75868 WP_003416099.1.75878 WP_003416099.1.75927 WP_003416099.1.75946 WP_003416099.1.75968 WP_003416099.1.75974 WP_003416099.1.76016 WP_003416099.1.76032 WP_003416099.1.76037 WP_003416099.1.7604 WP_003416099.1.76045 WP_003416099.1.76052 WP_003416099.1.76058 WP_003416099.1.76064 WP_003416099.1.76110 WP_003416099.1.76126 WP_003416099.1.76133 WP_003416099.1.76138 WP_003416099.1.76157 WP_003416099.1.76172 WP_003416099.1.76177 WP_003416099.1.76183 WP_003416099.1.76209 WP_003416099.1.76239 WP_003416099.1.76272 WP_003416099.1.76277 WP_003416099.1.76280 WP_003416099.1.76281 WP_003416099.1.76291 WP_003416099.1.76297 WP_003416099.1.76360 WP_003416099.1.76379 WP_003416099.1.76403 WP_003416099.1.76413 WP_003416099.1.76414 WP_003416099.1.76427 WP_003416099.1.76436 WP_003416099.1.76442 WP_003416099.1.76443 WP_003416099.1.76456 WP_003416099.1.76521 WP_003416099.1.76533 WP_003416099.1.76616 WP_003416099.1.76625 WP_003416099.1.76629 WP_003416099.1.76635 WP_003416099.1.76638 WP_003416099.1.76639 WP_003416099.1.76640 WP_003416099.1.76644 WP_003416099.1.76677 WP_003416099.1.76678 WP_003416099.1.76679 WP_003416099.1.76734 WP_003416099.1.76744 WP_003416099.1.76750 WP_003416099.1.76754 WP_003416099.1.76757 WP_003416099.1.76781 WP_003416099.1.76818 WP_003416099.1.76824 WP_003416099.1.76835 WP_003416099.1.76873 WP_003416099.1.76881 WP_003416099.1.76888 WP_003416099.1.76900 WP_003416099.1.7691 WP_003416099.1.76947 WP_003416099.1.76954 WP_003416099.1.76955 WP_003416099.1.76963 WP_003416099.1.76976 WP_003416099.1.770 WP_003416099.1.77000 WP_003416099.1.77008 WP_003416099.1.77021 WP_003416099.1.77056 WP_003416099.1.77065 WP_003416099.1.77075 WP_003416099.1.77093 WP_003416099.1.77107 WP_003416099.1.77115 WP_003416099.1.77118 WP_003416099.1.77125 WP_003416099.1.77141 WP_003416099.1.77142 WP_003416099.1.77166 WP_003416099.1.77250 WP_003416099.1.77252 WP_003416099.1.77260 WP_003416099.1.77266 WP_003416099.1.77280 WP_003416099.1.77285 WP_003416099.1.77312 WP_003416099.1.77348 WP_003416099.1.77351 WP_003416099.1.77352 WP_003416099.1.77361 WP_003416099.1.774 WP_003416099.1.7740 WP_003416099.1.77404 WP_003416099.1.77425 WP_003416099.1.77463 WP_003416099.1.77474 WP_003416099.1.7748 WP_003416099.1.77484 WP_003416099.1.77491 WP_003416099.1.77499 WP_003416099.1.77510 WP_003416099.1.77530 WP_003416099.1.77554 WP_003416099.1.77559 WP_003416099.1.77599 WP_003416099.1.77605 WP_003416099.1.7762 WP_003416099.1.77627 WP_003416099.1.77649 WP_003416099.1.77654 WP_003416099.1.7766 WP_003416099.1.77667 WP_003416099.1.77704 WP_003416099.1.77706 WP_003416099.1.77726 WP_003416099.1.77774 WP_003416099.1.7778 WP_003416099.1.77790 WP_003416099.1.77809 WP_003416099.1.77820 WP_003416099.1.77843 WP_003416099.1.77855 WP_003416099.1.77865 WP_003416099.1.77868 WP_003416099.1.77879 WP_003416099.1.77890 WP_003416099.1.77909 WP_003416099.1.77911 WP_003416099.1.77931 WP_003416099.1.77984 WP_003416099.1.78020 WP_003416099.1.78024 WP_003416099.1.78075 WP_003416099.1.78084 WP_003416099.1.78086 WP_003416099.1.7809 WP_003416099.1.78098 WP_003416099.1.78105 WP_003416099.1.78113 WP_003416099.1.78136 WP_003416099.1.78162 WP_003416099.1.7817 WP_003416099.1.78200 WP_003416099.1.78216 WP_003416099.1.78236 WP_003416099.1.78238 WP_003416099.1.78322 WP_003416099.1.78338 WP_003416099.1.7836 WP_003416099.1.78360 WP_003416099.1.78386 WP_003416099.1.78429 WP_003416099.1.78435 WP_003416099.1.7844 WP_003416099.1.78459 WP_003416099.1.78488 WP_003416099.1.7849 WP_003416099.1.78499 WP_003416099.1.785 WP_003416099.1.78516 WP_003416099.1.78524 WP_003416099.1.78526 WP_003416099.1.78538 WP_003416099.1.78544 WP_003416099.1.78545 WP_003416099.1.78547 WP_003416099.1.78574 WP_003416099.1.78580 WP_003416099.1.7860 WP_003416099.1.78620 WP_003416099.1.78646 WP_003416099.1.78648 WP_003416099.1.78649 WP_003416099.1.78655 WP_003416099.1.78657 WP_003416099.1.78659 WP_003416099.1.7869 WP_003416099.1.78692 WP_003416099.1.78760 WP_003416099.1.78766 WP_003416099.1.78776 WP_003416099.1.78778 WP_003416099.1.78784 WP_003416099.1.78788 WP_003416099.1.78790 WP_003416099.1.78793 WP_003416099.1.78848 WP_003416099.1.78860 WP_003416099.1.7887 WP_003416099.1.78884 WP_003416099.1.78932 WP_003416099.1.78969 WP_003416099.1.78977 WP_003416099.1.78980 WP_003416099.1.79005 WP_003416099.1.79016 WP_003416099.1.79033 WP_003416099.1.79064 WP_003416099.1.79066 WP_003416099.1.79068 WP_003416099.1.79077 WP_003416099.1.79095 WP_003416099.1.79112 WP_003416099.1.79122 WP_003416099.1.79145 WP_003416099.1.79152 WP_003416099.1.79163 WP_003416099.1.79182 WP_003416099.1.79198 WP_003416099.1.79213 WP_003416099.1.79218 WP_003416099.1.79268 WP_003416099.1.79273 WP_003416099.1.79278 WP_003416099.1.79290 WP_003416099.1.79319 WP_003416099.1.79325 WP_003416099.1.79326 WP_003416099.1.7933 WP_003416099.1.79330 WP_003416099.1.79339 WP_003416099.1.79394 WP_003416099.1.79399 WP_003416099.1.79413 WP_003416099.1.79422 WP_003416099.1.79445 WP_003416099.1.79447 WP_003416099.1.79455 WP_003416099.1.79471 WP_003416099.1.79480 WP_003416099.1.79482 WP_003416099.1.79488 WP_003416099.1.79500 WP_003416099.1.79502 WP_003416099.1.79508 WP_003416099.1.79514 WP_003416099.1.79561 WP_003416099.1.79565 WP_003416099.1.79578 WP_003416099.1.79588 WP_003416099.1.79598 WP_003416099.1.79615 WP_003416099.1.79684 WP_003416099.1.79698 WP_003416099.1.797 WP_003416099.1.79744 WP_003416099.1.79784 WP_003416099.1.79802 WP_003416099.1.79806 WP_003416099.1.79819 WP_003416099.1.79826 WP_003416099.1.79828 WP_003416099.1.79851 WP_003416099.1.79853 WP_003416099.1.79863 WP_003416099.1.79881 WP_003416099.1.79885 WP_003416099.1.79898 WP_003416099.1.7990 WP_003416099.1.79900 WP_003416099.1.79913 WP_003416099.1.79918 WP_003416099.1.79947 WP_003416099.1.79948 WP_003416099.1.7995 WP_003416099.1.7997 WP_003416099.1.80004 WP_003416099.1.80015 WP_003416099.1.80022 WP_003416099.1.80030 WP_003416099.1.80054 WP_003416099.1.80084 WP_003416099.1.80099 WP_003416099.1.80129 WP_003416099.1.80177 WP_003416099.1.80234 WP_003416099.1.8026 WP_003416099.1.80275 WP_003416099.1.8029 WP_003416099.1.80299 WP_003416099.1.80300 WP_003416099.1.80304 WP_003416099.1.80326 WP_003416099.1.80351 WP_003416099.1.8037 WP_003416099.1.80370 WP_003416099.1.80387 WP_003416099.1.80399 WP_003416099.1.8044 WP_003416099.1.80451 WP_003416099.1.80458 WP_003416099.1.80461 WP_003416099.1.80490 WP_003416099.1.80503 WP_003416099.1.80507 WP_003416099.1.80552 WP_003416099.1.80576 WP_003416099.1.80588 WP_003416099.1.80599 WP_003416099.1.8060 WP_003416099.1.80624 WP_003416099.1.80636 WP_003416099.1.80669 WP_003416099.1.80673 WP_003416099.1.80711 WP_003416099.1.80714 WP_003416099.1.80743 WP_003416099.1.80784 WP_003416099.1.80815 WP_003416099.1.80853 WP_003416099.1.80918 WP_003416099.1.8093 WP_003416099.1.80967 WP_003416099.1.8097 WP_003416099.1.80988 WP_003416099.1.81007 WP_003416099.1.81013 WP_003416099.1.8105 WP_003416099.1.81059 WP_003416099.1.81063 WP_003416099.1.81066 WP_003416099.1.81075 WP_003416099.1.81091 WP_003416099.1.81119 WP_003416099.1.81125 WP_003416099.1.81136 WP_003416099.1.8114 WP_003416099.1.81189 WP_003416099.1.81192 WP_003416099.1.812 WP_003416099.1.81230 WP_003416099.1.81249 WP_003416099.1.81250 WP_003416099.1.81264 WP_003416099.1.8128 WP_003416099.1.81287 WP_003416099.1.81297 WP_003416099.1.8138 WP_003416099.1.81407 WP_003416099.1.8143 WP_003416099.1.81439 WP_003416099.1.81465 WP_003416099.1.81505 WP_003416099.1.81529 WP_003416099.1.81538 WP_003416099.1.81541 WP_003416099.1.81560 WP_003416099.1.81561 WP_003416099.1.81567 WP_003416099.1.81583 WP_003416099.1.81686 WP_003416099.1.81712 WP_003416099.1.81720 WP_003416099.1.81731 WP_003416099.1.81774 WP_003416099.1.81788 WP_003416099.1.81809 WP_003416099.1.81820 WP_003416099.1.81850 WP_003416099.1.81883 WP_003416099.1.81891 WP_003416099.1.81911 WP_003416099.1.81918 WP_003416099.1.82011 WP_003416099.1.82048 WP_003416099.1.82069 WP_003416099.1.82071 WP_003416099.1.82108 WP_003416099.1.82136 WP_003416099.1.82142 WP_003416099.1.8215 WP_003416099.1.82158 WP_003416099.1.8217 WP_003416099.1.82209 WP_003416099.1.82210 WP_003416099.1.82228 WP_003416099.1.82236 WP_003416099.1.82251 WP_003416099.1.82271 WP_003416099.1.82305 WP_003416099.1.82307 WP_003416099.1.82309 WP_003416099.1.82317 WP_003416099.1.8232 WP_003416099.1.82346 WP_003416099.1.82374 WP_003416099.1.82385 WP_003416099.1.82429 WP_003416099.1.82460 WP_003416099.1.82462 WP_003416099.1.82483 WP_003416099.1.82494 WP_003416099.1.82531 WP_003416099.1.82546 WP_003416099.1.82547 WP_003416099.1.82549 WP_003416099.1.82577 WP_003416099.1.82592 WP_003416099.1.82597 WP_003416099.1.82598 WP_003416099.1.82625 WP_003416099.1.82642 WP_003416099.1.82651 WP_003416099.1.82653 WP_003416099.1.82681 WP_003416099.1.82685 WP_003416099.1.8271 WP_003416099.1.82712 WP_003416099.1.8273 WP_003416099.1.82743 WP_003416099.1.82757 WP_003416099.1.82774 WP_003416099.1.82803 WP_003416099.1.82836 WP_003416099.1.82860 WP_003416099.1.82871 WP_003416099.1.82892 WP_003416099.1.82935 WP_003416099.1.82957 WP_003416099.1.82973 WP_003416099.1.82981 WP_003416099.1.82983 WP_003416099.1.83004 WP_003416099.1.83009 WP_003416099.1.83044 WP_003416099.1.83065 WP_003416099.1.83074 WP_003416099.1.83110 WP_003416099.1.83146 WP_003416099.1.83149 WP_003416099.1.83159 WP_003416099.1.8317 WP_003416099.1.83173 WP_003416099.1.83181 WP_003416099.1.83182 WP_003416099.1.83191 WP_003416099.1.83197 WP_003416099.1.83212 WP_003416099.1.8326 WP_003416099.1.83262 WP_003416099.1.83268 WP_003416099.1.83273 WP_003416099.1.83309 WP_003416099.1.83332 WP_003416099.1.83334 WP_003416099.1.83341 WP_003416099.1.83349 WP_003416099.1.8335 WP_003416099.1.83353 WP_003416099.1.83367 WP_003416099.1.83380 WP_003416099.1.83381 WP_003416099.1.83389 WP_003416099.1.83408 WP_003416099.1.83409 WP_003416099.1.83435 WP_003416099.1.83470 WP_003416099.1.83524 WP_003416099.1.83526 WP_003416099.1.8358 WP_003416099.1.83589 WP_003416099.1.83601 WP_003416099.1.83611 WP_003416099.1.83638 WP_003416099.1.83648 WP_003416099.1.83656 WP_003416099.1.83667 WP_003416099.1.83689 WP_003416099.1.83692 WP_003416099.1.83704 WP_003416099.1.83705 WP_003416099.1.83766 WP_003416099.1.83793 WP_003416099.1.83794 WP_003416099.1.83802 WP_003416099.1.83805 WP_003416099.1.83839 WP_003416099.1.83842 WP_003416099.1.83850 WP_003416099.1.83861 WP_003416099.1.83884 WP_003416099.1.83920 WP_003416099.1.83929 WP_003416099.1.83930 WP_003416099.1.83975 WP_003416099.1.83991 WP_003416099.1.8400 WP_003416099.1.84027 WP_003416099.1.8404 WP_003416099.1.84057 WP_003416099.1.84070 WP_003416099.1.8409 WP_003416099.1.84112 WP_003416099.1.84146 WP_003416099.1.8415 WP_003416099.1.84176 WP_003416099.1.84186 WP_003416099.1.84192 WP_003416099.1.84228 WP_003416099.1.8424 WP_003416099.1.84244 WP_003416099.1.84259 WP_003416099.1.8426 WP_003416099.1.84277 WP_003416099.1.84287 WP_003416099.1.8434 WP_003416099.1.84388 WP_003416099.1.84408 WP_003416099.1.84409 WP_003416099.1.84438 WP_003416099.1.84460 WP_003416099.1.84488 WP_003416099.1.84504 WP_003416099.1.84525 WP_003416099.1.84620 WP_003416099.1.84623 WP_003416099.1.84641 WP_003416099.1.84655 WP_003416099.1.84666 WP_003416099.1.84670 WP_003416099.1.84739 WP_003416099.1.84748 WP_003416099.1.84766 WP_003416099.1.84772 WP_003416099.1.84774 WP_003416099.1.848 WP_003416099.1.84812 WP_003416099.1.84836 WP_003416099.1.84839 WP_003416099.1.84846 WP_003416099.1.84873 WP_003416099.1.84911 WP_003416099.1.84938 WP_003416099.1.84968 WP_003416099.1.84973 WP_003416099.1.84981 WP_003416099.1.84985 WP_003416099.1.8503 WP_003416099.1.85038 WP_003416099.1.85041 WP_003416099.1.85043 WP_003416099.1.8505 WP_003416099.1.85074 WP_003416099.1.8509 WP_003416099.1.8512 WP_003416099.1.85148 WP_003416099.1.8518 WP_003416099.1.8522 WP_003416099.1.85242 WP_003416099.1.85276 WP_003416099.1.85284 WP_003416099.1.85314 WP_003416099.1.85319 WP_003416099.1.85330 WP_003416099.1.85341 WP_003416099.1.85346 WP_003416099.1.8535 WP_003416099.1.85363 WP_003416099.1.85371 WP_003416099.1.85377 WP_003416099.1.85387 WP_003416099.1.85399 WP_003416099.1.85458 WP_003416099.1.8546 WP_003416099.1.85464 WP_003416099.1.85478 WP_003416099.1.85480 WP_003416099.1.85488 WP_003416099.1.85495 WP_003416099.1.85551 WP_003416099.1.85557 WP_003416099.1.85577 WP_003416099.1.85597 WP_003416099.1.85599 WP_003416099.1.85610 WP_003416099.1.8563 WP_003416099.1.85648 WP_003416099.1.85679 WP_003416099.1.85704 WP_003416099.1.85717 WP_003416099.1.85727 WP_003416099.1.85737 WP_003416099.1.85763 WP_003416099.1.85808 WP_003416099.1.85819 WP_003416099.1.85820 WP_003416099.1.85823 WP_003416099.1.85832 WP_003416099.1.8586 WP_003416099.1.85872 WP_003416099.1.85894 WP_003416099.1.85909 WP_003416099.1.85913 WP_003416099.1.85953 WP_003416099.1.85986 WP_003416099.1.86000 WP_003416099.1.86024 WP_003416099.1.86025 WP_003416099.1.86032 WP_003416099.1.86048 WP_003416099.1.86052 WP_003416099.1.86067 WP_003416099.1.86103 WP_003416099.1.86122 WP_003416099.1.86124 WP_003416099.1.86160 WP_003416099.1.86164 WP_003416099.1.86168 WP_003416099.1.86190 WP_003416099.1.86204 WP_003416099.1.86208 WP_003416099.1.86235 WP_003416099.1.86249 WP_003416099.1.86260 WP_003416099.1.86290 WP_003416099.1.863 WP_003416099.1.86327 WP_003416099.1.86334 WP_003416099.1.86337 WP_003416099.1.86368 WP_003416099.1.86377 WP_003416099.1.86425 WP_003416099.1.86459 WP_003416099.1.8649 WP_003416099.1.86499 WP_003416099.1.86520 WP_003416099.1.86561 WP_003416099.1.86568 WP_003416099.1.86575 WP_003416099.1.86584 WP_003416099.1.86605 WP_003416099.1.86626 WP_003416099.1.86648 WP_003416099.1.8666 WP_003416099.1.86684 WP_003416099.1.86696 WP_003416099.1.86705 WP_003416099.1.86718 WP_003416099.1.86725 WP_003416099.1.86757 WP_003416099.1.86766 WP_003416099.1.86801 WP_003416099.1.86814 WP_003416099.1.86820 WP_003416099.1.86825 WP_003416099.1.86834 WP_003416099.1.8685 WP_003416099.1.86851 WP_003416099.1.86855 WP_003416099.1.86867 WP_003416099.1.86877 WP_003416099.1.86883 WP_003416099.1.8689 WP_003416099.1.86892 WP_003416099.1.86933 WP_003416099.1.86941 WP_003416099.1.86950 WP_003416099.1.86962 WP_003416099.1.86963 WP_003416099.1.86979 WP_003416099.1.8700 WP_003416099.1.87001 WP_003416099.1.87002 WP_003416099.1.87031 WP_003416099.1.87116 WP_003416099.1.87117 WP_003416099.1.8714 WP_003416099.1.87162 WP_003416099.1.87178 WP_003416099.1.87191 WP_003416099.1.87201 WP_003416099.1.87209 WP_003416099.1.87240 WP_003416099.1.87266 WP_003416099.1.87273 WP_003416099.1.87275 WP_003416099.1.8733 WP_003416099.1.87345 WP_003416099.1.87369 WP_003416099.1.8737 WP_003416099.1.87401 WP_003416099.1.87404 WP_003416099.1.87406 WP_003416099.1.87409 WP_003416099.1.87444 WP_003416099.1.87446 WP_003416099.1.87459 WP_003416099.1.87472 WP_003416099.1.87489 WP_003416099.1.87494 WP_003416099.1.87496 WP_003416099.1.87582 WP_003416099.1.87588 WP_003416099.1.87617 WP_003416099.1.87619 WP_003416099.1.87620 WP_003416099.1.87634 WP_003416099.1.87643 WP_003416099.1.8765 WP_003416099.1.87650 WP_003416099.1.87654 WP_003416099.1.87658 WP_003416099.1.87665 WP_003416099.1.87676 WP_003416099.1.87677 WP_003416099.1.87684 WP_003416099.1.87692 WP_003416099.1.87707 WP_003416099.1.87732 WP_003416099.1.87784 WP_003416099.1.87796 WP_003416099.1.87809 WP_003416099.1.87817 WP_003416099.1.87827 WP_003416099.1.87831 WP_003416099.1.87835 WP_003416099.1.87837 WP_003416099.1.87866 WP_003416099.1.8789 WP_003416099.1.87911 WP_003416099.1.87924 WP_003416099.1.87951 WP_003416099.1.87955 WP_003416099.1.87956 WP_003416099.1.87991 WP_003416099.1.88 WP_003416099.1.88002 WP_003416099.1.88037 WP_003416099.1.88039 WP_003416099.1.88072 WP_003416099.1.88077 WP_003416099.1.88121 WP_003416099.1.88180 WP_003416099.1.88191 WP_003416099.1.88205 WP_003416099.1.88217 WP_003416099.1.88219 WP_003416099.1.88245 WP_003416099.1.88253 WP_003416099.1.88294 WP_003416099.1.88315 WP_003416099.1.88316 WP_003416099.1.88320 WP_003416099.1.88338 WP_003416099.1.8840 WP_003416099.1.88437 WP_003416099.1.88453 WP_003416099.1.88469 WP_003416099.1.88489 WP_003416099.1.88507 WP_003416099.1.88521 WP_003416099.1.88530 WP_003416099.1.88537 WP_003416099.1.88541 WP_003416099.1.88592 WP_003416099.1.88616 WP_003416099.1.88618 WP_003416099.1.8862 WP_003416099.1.88625 WP_003416099.1.88632 WP_003416099.1.88634 WP_003416099.1.88649 WP_003416099.1.8870 WP_003416099.1.88737 WP_003416099.1.88756 WP_003416099.1.888 WP_003416099.1.88824 WP_003416099.1.88886 WP_003416099.1.88965 WP_003416099.1.88985 WP_003416099.1.8902 WP_003416099.1.89025 WP_003416099.1.89041 WP_003416099.1.89046 WP_003416099.1.89082 WP_003416099.1.89162 WP_003416099.1.89168 WP_003416099.1.8917 WP_003416099.1.89193 WP_003416099.1.89205 WP_003416099.1.89207 WP_003416099.1.89225 WP_003416099.1.8925 WP_003416099.1.89277 WP_003416099.1.89286 WP_003416099.1.89293 WP_003416099.1.89320 WP_003416099.1.8935 WP_003416099.1.89371 WP_003416099.1.89378 WP_003416099.1.89392 WP_003416099.1.89406 WP_003416099.1.8943 WP_003416099.1.89451 WP_003416099.1.89453 WP_003416099.1.89473 WP_003416099.1.89475 WP_003416099.1.89483 WP_003416099.1.895 WP_003416099.1.89513 WP_003416099.1.89517 WP_003416099.1.89522 WP_003416099.1.8954 WP_003416099.1.89543 WP_003416099.1.89567 WP_003416099.1.8957 WP_003416099.1.89572 WP_003416099.1.89589 WP_003416099.1.89607 WP_003416099.1.89613 WP_003416099.1.89625 WP_003416099.1.89648 WP_003416099.1.8967 WP_003416099.1.89670 WP_003416099.1.89676 WP_003416099.1.89729 WP_003416099.1.89739 WP_003416099.1.89762 WP_003416099.1.8977 WP_003416099.1.89802 WP_003416099.1.89808 WP_003416099.1.8982 WP_003416099.1.89829 WP_003416099.1.89831 WP_003416099.1.89844 WP_003416099.1.89849 WP_003416099.1.8989 WP_003416099.1.89901 WP_003416099.1.89903 WP_003416099.1.89909 WP_003416099.1.8992 WP_003416099.1.89922 WP_003416099.1.89926 WP_003416099.1.89963 WP_003416099.1.89971 WP_003416099.1.8998 WP_003416099.1.89987 WP_003416099.1.900 WP_003416099.1.90048 WP_003416099.1.9007 WP_003416099.1.90080 WP_003416099.1.90130 WP_003416099.1.90134 WP_003416099.1.90137 WP_003416099.1.90157 WP_003416099.1.90184 WP_003416099.1.90199 WP_003416099.1.90231 WP_003416099.1.90245 WP_003416099.1.90308 WP_003416099.1.90322 WP_003416099.1.90328 WP_003416099.1.90372 WP_003416099.1.90439 WP_003416099.1.90481 WP_003416099.1.90499 WP_003416099.1.9050 WP_003416099.1.90527 WP_003416099.1.90550 WP_003416099.1.90560 WP_003416099.1.90612 WP_003416099.1.90640 WP_003416099.1.90672 WP_003416099.1.90687 WP_003416099.1.90691 WP_003416099.1.90711 WP_003416099.1.90722 WP_003416099.1.90744 WP_003416099.1.9075 WP_003416099.1.90756 WP_003416099.1.90767 WP_003416099.1.90771 WP_003416099.1.90785 WP_003416099.1.90788 WP_003416099.1.90800 WP_003416099.1.90810 WP_003416099.1.90816 WP_003416099.1.90819 WP_003416099.1.9082 WP_003416099.1.90831 WP_003416099.1.90884 WP_003416099.1.90899 WP_003416099.1.90906 WP_003416099.1.90958 WP_003416099.1.90976 WP_003416099.1.90977 WP_003416099.1.90987 WP_003416099.1.9102 WP_003416099.1.91026 WP_003416099.1.91032 WP_003416099.1.91043 WP_003416099.1.91053 WP_003416099.1.91082 WP_003416099.1.91106 WP_003416099.1.91112 WP_003416099.1.91144 WP_003416099.1.91151 WP_003416099.1.91157 WP_003416099.1.91167 WP_003416099.1.91169 WP_003416099.1.91192 WP_003416099.1.91201 WP_003416099.1.91207 WP_003416099.1.91208 WP_003416099.1.91211 WP_003416099.1.91214 WP_003416099.1.91230 WP_003416099.1.91244 WP_003416099.1.91251 WP_003416099.1.91260 WP_003416099.1.91265 WP_003416099.1.9128 WP_003416099.1.91284 WP_003416099.1.91294 WP_003416099.1.91303 WP_003416099.1.91322 WP_003416099.1.91352 WP_003416099.1.91386 WP_003416099.1.9139 WP_003416099.1.91398 WP_003416099.1.91411 WP_003416099.1.91430 WP_003416099.1.91436 WP_003416099.1.91483 WP_003416099.1.91496 WP_003416099.1.91507 WP_003416099.1.91508 WP_003416099.1.91576 WP_003416099.1.91589 WP_003416099.1.91694 WP_003416099.1.91695 WP_003416099.1.91713 WP_003416099.1.91716 WP_003416099.1.91717 WP_003416099.1.91728 WP_003416099.1.91743 WP_003416099.1.91759 WP_003416099.1.91784 WP_003416099.1.91785 WP_003416099.1.91786 WP_003416099.1.91802 WP_003416099.1.91822 WP_003416099.1.91828 WP_003416099.1.9189 WP_003416099.1.91896 WP_003416099.1.9190 WP_003416099.1.91915 WP_003416099.1.91931 WP_003416099.1.91937 WP_003416099.1.91944 WP_003416099.1.91953 WP_003416099.1.91957 WP_003416099.1.91976 WP_003416099.1.91978 WP_003416099.1.92021 WP_003416099.1.92083 WP_003416099.1.92127 WP_003416099.1.92144 WP_003416099.1.92150 WP_003416099.1.92153 WP_003416099.1.92190 WP_003416099.1.92192 WP_003416099.1.92200 WP_003416099.1.92220 WP_003416099.1.92221 WP_003416099.1.92222 WP_003416099.1.92273 WP_003416099.1.92289 WP_003416099.1.9229 WP_003416099.1.92294 WP_003416099.1.92300 WP_003416099.1.92317 WP_003416099.1.92334 WP_003416099.1.92338 WP_003416099.1.92345 WP_003416099.1.92356 WP_003416099.1.92364 WP_003416099.1.92380 WP_003416099.1.92416 WP_003416099.1.92428 WP_003416099.1.92447 WP_003416099.1.92456 WP_003416099.1.92467 WP_003416099.1.92471 WP_003416099.1.92490 WP_003416099.1.92508 WP_003416099.1.9251 WP_003416099.1.92511 WP_003416099.1.92523 WP_003416099.1.92527 WP_003416099.1.92536 WP_003416099.1.92597 WP_003416099.1.92603 WP_003416099.1.92606 WP_003416099.1.92610 WP_003416099.1.92613 WP_003416099.1.9263 WP_003416099.1.9265 WP_003416099.1.92650 WP_003416099.1.92660 WP_003416099.1.92677 WP_003416099.1.92685 WP_003416099.1.92689 WP_003416099.1.92690 WP_003416099.1.92706 WP_003416099.1.92714 WP_003416099.1.92736 WP_003416099.1.9274 WP_003416099.1.92752 WP_003416099.1.92760 WP_003416099.1.92777 WP_003416099.1.92803 WP_003416099.1.92833 WP_003416099.1.92856 WP_003416099.1.92881 WP_003416099.1.92892 WP_003416099.1.92907 WP_003416099.1.92908 WP_003416099.1.9291 WP_003416099.1.92917 WP_003416099.1.92996 WP_003416099.1.93006 WP_003416099.1.93008 WP_003416099.1.93009 WP_003416099.1.93015 WP_003416099.1.93043 WP_003416099.1.9307 WP_003416099.1.93097 WP_003416099.1.93137 WP_003416099.1.93192 WP_003416099.1.93199 WP_003416099.1.93203 WP_003416099.1.93212 WP_003416099.1.93234 WP_003416099.1.93245 WP_003416099.1.93257 WP_003416099.1.93265 WP_003416099.1.93297 WP_003416099.1.93320 WP_003416099.1.93328 WP_003416099.1.93337 WP_003416099.1.93343 WP_003416099.1.93349 WP_003416099.1.93363 WP_003416099.1.93377 WP_003416099.1.9338 WP_003416099.1.93407 WP_003416099.1.93417 WP_003416099.1.93419 WP_003416099.1.93426 WP_003416099.1.9344 WP_003416099.1.93443 WP_003416099.1.93447 WP_003416099.1.93470 WP_003416099.1.93483 WP_003416099.1.93487 WP_003416099.1.93495 WP_003416099.1.93499 WP_003416099.1.93516 WP_003416099.1.93536 WP_003416099.1.93544 WP_003416099.1.93555 WP_003416099.1.93560 WP_003416099.1.93564 WP_003416099.1.9357 WP_003416099.1.93573 WP_003416099.1.93576 WP_003416099.1.93588 WP_003416099.1.9363 WP_003416099.1.93645 WP_003416099.1.93649 WP_003416099.1.93659 WP_003416099.1.93677 WP_003416099.1.9368 WP_003416099.1.93689 WP_003416099.1.93693 WP_003416099.1.93698 WP_003416099.1.93706 WP_003416099.1.9371 WP_003416099.1.93792 WP_003416099.1.93823 WP_003416099.1.93871 WP_003416099.1.9388 WP_003416099.1.93894 WP_003416099.1.93903 WP_003416099.1.93907 WP_003416099.1.93913 WP_003416099.1.93946 WP_003416099.1.93950 WP_003416099.1.93953 WP_003416099.1.93954 WP_003416099.1.93988 WP_003416099.1.9407 WP_003416099.1.94143 WP_003416099.1.94154 WP_003416099.1.94184 WP_003416099.1.94204 WP_003416099.1.94205 WP_003416099.1.94226 WP_003416099.1.94231 WP_003416099.1.94256 WP_003416099.1.94261 WP_003416099.1.94281 WP_003416099.1.94292 WP_003416099.1.94297 WP_003416099.1.9431 WP_003416099.1.94326 WP_003416099.1.94339 WP_003416099.1.94392 WP_003416099.1.94416 WP_003416099.1.94421 WP_003416099.1.94456 WP_003416099.1.94470 WP_003416099.1.94480 WP_003416099.1.94495 WP_003416099.1.94511 WP_003416099.1.94512 WP_003416099.1.94525 WP_003416099.1.94528 WP_003416099.1.94564 WP_003416099.1.946 WP_003416099.1.94602 WP_003416099.1.94623 WP_003416099.1.94629 WP_003416099.1.9465 WP_003416099.1.94673 WP_003416099.1.94714 WP_003416099.1.94730 WP_003416099.1.94736 WP_003416099.1.94776 WP_003416099.1.9478 WP_003416099.1.94834 WP_003416099.1.94852 WP_003416099.1.94872 WP_003416099.1.9488 WP_003416099.1.94902 WP_003416099.1.94916 WP_003416099.1.94979 WP_003416099.1.94994 WP_003416099.1.94996 WP_003416099.1.94998 WP_003416099.1.95007 WP_003416099.1.95010 WP_003416099.1.95015 WP_003416099.1.95034 WP_003416099.1.95068 WP_003416099.1.95081 WP_003416099.1.95082 WP_003416099.1.9509 WP_003416099.1.95096 WP_003416099.1.95112 WP_003416099.1.95138 WP_003416099.1.9514 WP_003416099.1.95179 WP_003416099.1.95188 WP_003416099.1.95190 WP_003416099.1.95234 WP_003416099.1.95241 WP_003416099.1.95245 WP_003416099.1.95257 WP_003416099.1.95279 WP_003416099.1.9531 WP_003416099.1.95335 WP_003416099.1.95344 WP_003416099.1.9535 WP_003416099.1.95370 WP_003416099.1.95392 WP_003416099.1.95416 WP_003416099.1.95417 WP_003416099.1.95454 WP_003416099.1.95455 WP_003416099.1.95491 WP_003416099.1.95497 WP_003416099.1.95508 WP_003416099.1.95509 WP_003416099.1.95529 WP_003416099.1.95556 WP_003416099.1.95557 WP_003416099.1.95565 WP_003416099.1.95578 WP_003416099.1.95580 WP_003416099.1.95585 WP_003416099.1.95643 WP_003416099.1.95679 WP_003416099.1.95685 WP_003416099.1.957 WP_003416099.1.95724 WP_003416099.1.95727 WP_003416099.1.95730 WP_003416099.1.95735 WP_003416099.1.95758 WP_003416099.1.95772 WP_003416099.1.95797 WP_003416099.1.95839 WP_003416099.1.9585 WP_003416099.1.9590 WP_003416099.1.95902 WP_003416099.1.95908 WP_003416099.1.95924 WP_003416099.1.95926 WP_003416099.1.95953 WP_003416099.1.95958 WP_003416099.1.95964 WP_003416099.1.95973 WP_003416099.1.96006 WP_003416099.1.9602 WP_003416099.1.96036 WP_003416099.1.96062 WP_003416099.1.96065 WP_003416099.1.96098 WP_003416099.1.96146 WP_003416099.1.96166 WP_003416099.1.96171 WP_003416099.1.96182 WP_003416099.1.96204 WP_003416099.1.96230 WP_003416099.1.96235 WP_003416099.1.96242 WP_003416099.1.96254 WP_003416099.1.96259 WP_003416099.1.96286 WP_003416099.1.96313 WP_003416099.1.96318 WP_003416099.1.96345 WP_003416099.1.96360 WP_003416099.1.96373 WP_003416099.1.96456 WP_003416099.1.96486 WP_003416099.1.96560 WP_003416099.1.96569 WP_003416099.1.96573 WP_003416099.1.96575 WP_003416099.1.96576 WP_003416099.1.96611 WP_003416099.1.96621 WP_003416099.1.9667 WP_003416099.1.96681 WP_003416099.1.96726 WP_003416099.1.96733 WP_003416099.1.96742 WP_003416099.1.96754 WP_003416099.1.9678 WP_003416099.1.96832 WP_003416099.1.9685 WP_003416099.1.97008 WP_003416099.1.97009 WP_003416099.1.97056 WP_003416099.1.97084 WP_003416099.1.97087 WP_003416099.1.97094 WP_003416099.1.97096 WP_003416099.1.97099 WP_003416099.1.97108 WP_003416099.1.97113 WP_003416099.1.97122 WP_003416099.1.97127 WP_003416099.1.97129 WP_003416099.1.97136 WP_003416099.1.9716 WP_003416099.1.97176 WP_003416099.1.97222 WP_003416099.1.97223 WP_003416099.1.97237 WP_003416099.1.97242 WP_003416099.1.97270 WP_003416099.1.97283 WP_003416099.1.97296 WP_003416099.1.97321 WP_003416099.1.97325 WP_003416099.1.97330 WP_003416099.1.97366 WP_003416099.1.97376 WP_003416099.1.97380 WP_003416099.1.9739 WP_003416099.1.97462 WP_003416099.1.97517 WP_003416099.1.97519 WP_003416099.1.97535 WP_003416099.1.97540 WP_003416099.1.97545 WP_003416099.1.97546 WP_003416099.1.97550 WP_003416099.1.97568 WP_003416099.1.97577 WP_003416099.1.97584 WP_003416099.1.9759 WP_003416099.1.97591 WP_003416099.1.97596 WP_003416099.1.97609 WP_003416099.1.97618 WP_003416099.1.9763 WP_003416099.1.97669 WP_003416099.1.97673 WP_003416099.1.97700 WP_003416099.1.97701 WP_003416099.1.9773 WP_003416099.1.97730 WP_003416099.1.97740 WP_003416099.1.97751 WP_003416099.1.97754 WP_003416099.1.97797 WP_003416099.1.9782 WP_003416099.1.9784 WP_003416099.1.97888 WP_003416099.1.9790 WP_003416099.1.9795 WP_003416099.1.97951 WP_003416099.1.97958 WP_003416099.1.97966 WP_003416099.1.97977 WP_003416099.1.97979 WP_003416099.1.97995 WP_003416099.1.98018 WP_003416099.1.98034 WP_003416099.1.98052 WP_003416099.1.98071 WP_003416099.1.98072 WP_003416099.1.98113 WP_003416099.1.98114 WP_003416099.1.98128 WP_003416099.1.98181 WP_003416099.1.98188 WP_003416099.1.98189 WP_003416099.1.98213 WP_003416099.1.98225 WP_003416099.1.98291 WP_003416099.1.98335 WP_003416099.1.98350 WP_003416099.1.98395 WP_003416099.1.98412 WP_003416099.1.98441 WP_003416099.1.98443 WP_003416099.1.98462 WP_003416099.1.9848 WP_003416099.1.98482 WP_003416099.1.98486 WP_003416099.1.98488 WP_003416099.1.98503 WP_003416099.1.98516 WP_003416099.1.98524 WP_003416099.1.98536 WP_003416099.1.98541 WP_003416099.1.98566 WP_003416099.1.98576 WP_003416099.1.98590 WP_003416099.1.98594 WP_003416099.1.98599 WP_003416099.1.98629 WP_003416099.1.98645 WP_003416099.1.98646 WP_003416099.1.98649 WP_003416099.1.98656 WP_003416099.1.9867 WP_003416099.1.98674 WP_003416099.1.98697 WP_003416099.1.98701 WP_003416099.1.98739 WP_003416099.1.98749 WP_003416099.1.98765 WP_003416099.1.98770 WP_003416099.1.98777 WP_003416099.1.98778 WP_003416099.1.98838 WP_003416099.1.98850 WP_003416099.1.98906 WP_003416099.1.98935 WP_003416099.1.98948 WP_003416099.1.98953 WP_003416099.1.98984 WP_003416099.1.99000 WP_003416099.1.99023 WP_003416099.1.99030 WP_003416099.1.99037 WP_003416099.1.99055 WP_003416099.1.99062 WP_003416099.1.99086 WP_003416099.1.99115 WP_003416099.1.99117 WP_003416099.1.99161 WP_003416099.1.99176 WP_003416099.1.99205 WP_003416099.1.99211 WP_003416099.1.99216 WP_003416099.1.99222 WP_003416099.1.99251 WP_003416099.1.99269 WP_003416099.1.99294 WP_003416099.1.99312 WP_003416099.1.99315 WP_003416099.1.99316 WP_003416099.1.99322 WP_003416099.1.99328 WP_003416099.1.99365 WP_003416099.1.99368 WP_003416099.1.99379 WP_003416099.1.99396 WP_003416099.1.99402 WP_003416099.1.99404 WP_003416099.1.99419 WP_003416099.1.99438 WP_003416099.1.99460 WP_003416099.1.99468 WP_003416099.1.99473 WP_003416099.1.99513 WP_003416099.1.99529 WP_003416099.1.99548 WP_003416099.1.99572 WP_003416099.1.99575 WP_003416099.1.99578 WP_003416099.1.99605 WP_003416099.1.99609 WP_003416099.1.99617 WP_003416099.1.99635 WP_003416099.1.99650 WP_003416099.1.99672 WP_003416099.1.99701 WP_003416099.1.99711 WP_003416099.1.99716 WP_003416099.1.99740 WP_003416099.1.99745 WP_003416099.1.99749 WP_003416099.1.9976 WP_003416099.1.99798 WP_003416099.1.99817 WP_003416099.1.99832 WP_003416099.1.99847 WP_003416099.1.99852 WP_003416099.1.99886 WP_003416099.1.99897 WP_003416099.1.99899 WP_003416099.1.99915 WP_003416099.1.9993 WP_003416099.1.99982 WP_003416099.1.99991 gi|479316067|ref|YP_007856119.1| gi|224991472|ref|YP_002646161.1| gi|392387721|ref|YP_005309350.1| gi|340628086|ref|YP_004746538.1| gi|385999881|ref|YP_005918180.1| 233413.Mb3122 336982.TBFG_13112 410289.BCG_3120 419947.MRA_3127 478434.TBMG_00872 561275.JTY_3115 83332.Rv3095 gi|31794274|ref|NP_856767.1| gi|506927650|ref|YP_008008100.1| gi|15610232|ref|NP_217611.1| gi|15610232|ref|NP_217611.1| gi|433643288|ref|YP_007289047.1| gi|471339127|ref|YP_007611840.1| gi|494697465|ref|YP_007962968.1| gi|121638980|ref|YP_979204.1| gi|148662949|ref|YP_001284472.1| gi|197738713|ref|YP_002160028.1| gi|385992349|ref|YP_005910647.1| gi|494701541|ref|YP_007967023.1| gi|375295079|ref|YP_005099346.1| gi|479057059|ref|YP_007352865.1| gi|506927650|ref|YP_008008100.1| gi|433632183|ref|YP_007265811.1| gi|392431286|ref|YP_006472330.1| gi|525675585|ref|YP_008227191.1| gi|378772838|ref|YP_005172571.1| gi|449065187|ref|YP_007432270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]