SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197738884|ref|YP_002160199.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197738884|ref|YP_002160199.1|
Domain Number 1 Region: 405-424,464-708
Classification Level Classification E-value
Superfamily HAD-like 1.92e-54
Family Meta-cation ATPase, catalytic domain P 0.00032
Further Details:      
 
Domain Number 2 Region: 227-313
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.15e-20
Family Calcium ATPase, transduction domain A 0.0079
Further Details:      
 
Domain Number 3 Region: 162-210,315-424
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000471
Family Calcium ATPase, transmembrane domain M 0.035
Further Details:      
 
Weak hits

Sequence:  gi|197738884|ref|YP_002160199.1|
Domain Number - Region: 16-73
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000317
Family HMA, heavy metal-associated domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197738884|ref|YP_002160199.1|
Sequence length 718
Comment metal cation-transporter P-type ATPase CtpC [Mycobacterium tuberculosis str. Haarlem]
Sequence
MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTGSVVVWYSPRR
ADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMVIGGVALALLGVRRYVFARPP
LLGTTGRTVATGVTIFTGYPFLRGALRSLRSGKAGTDALVSAATVASLILRENVVALTVL
WLLNIGEYLQDLTLRRTRRAISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVQIGD
EVVVHEHVAIPVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA
VGNQTTIGRIISRVEEAQLDQAPIQTVGENFSRRFVPTSFIVSAIALLITGDVRRAMTML
LIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAGRVDAIVFDKTGTLTVGRPVV
TNIVAMHKDWEPEQVLAYAASSEIHSRHPLAEAVIRSTEERRISIPPHEECEVLVGLGMR
TWADGRTLLLGSPSLLRAEKVRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEV
RPEAAQVLTKLRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD
DGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHRLLDVGDLGER
AVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNASSVAVVANSSRLIRYRLDR
Download sequence
Identical sequences gi|197738884|ref|YP_002160199.1| WP_003900665.1.14955 WP_003900665.1.83334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]