SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197739444|ref|YP_002160758.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197739444|ref|YP_002160758.1|
Domain Number 1 Region: 19-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000257
Family DNA-binding protein Mj223 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197739444|ref|YP_002160758.1|
Sequence length 165
Comment hypothetical protein TBHG_00673 [Mycobacterium tuberculosis str. Haarlem]
Sequence
MSVNDGVDQMGAEPDIMEFVEQMGGYFESRSLTRLAGRLLGWLLVCDPERQSSEELATAL
AASSGGISTNARMLIQFGFIERLAVAGDRRTYFRLRPNAFAAGERERIRAMAELQDLADV
GLRALGDAPPQRSRRLREMRDLLAYMENVVSDALGRYSQRTGEDD
Download sequence
Identical sequences A0A045J9F1 A0A0H3L6X4 A0A0H3M257 A0A109S6G2 A0A109SUE8 A0A120IVQ9 A0A197J1E4 A0A1A9T8B7 A0A1R3XWH5 A0A1S1BGY8 A5U064 F8M344 G0TQG0 I6Y8F7 M8DKR0 O53786 R4LZR9 R4MFA1
gi|471336525|ref|YP_007609238.1| gi|494695080|ref|YP_007960583.1| gi|378770433|ref|YP_005170166.1| gi|15840081|ref|NP_335118.1| gi|479313551|ref|YP_007853603.1| gi|479054628|ref|YP_007350434.1| gi|15607818|ref|NP_215192.1| NP_215192.1.84033 WP_003403442.1.100000 WP_003403442.1.100021 WP_003403442.1.100087 WP_003403442.1.10015 WP_003403442.1.100208 WP_003403442.1.100216 WP_003403442.1.100255 WP_003403442.1.100270 WP_003403442.1.100279 WP_003403442.1.100286 WP_003403442.1.100308 WP_003403442.1.100309 WP_003403442.1.100318 WP_003403442.1.100337 WP_003403442.1.100338 WP_003403442.1.10037 WP_003403442.1.100383 WP_003403442.1.100395 WP_003403442.1.100396 WP_003403442.1.1004 WP_003403442.1.100401 WP_003403442.1.100459 WP_003403442.1.100460 WP_003403442.1.100552 WP_003403442.1.100581 WP_003403442.1.100600 WP_003403442.1.100625 WP_003403442.1.10064 WP_003403442.1.100666 WP_003403442.1.100671 WP_003403442.1.100677 WP_003403442.1.100682 WP_003403442.1.100697 WP_003403442.1.100703 WP_003403442.1.100716 WP_003403442.1.100722 WP_003403442.1.100754 WP_003403442.1.100772 WP_003403442.1.1008 WP_003403442.1.100812 WP_003403442.1.100845 WP_003403442.1.100866 WP_003403442.1.10088 WP_003403442.1.100889 WP_003403442.1.10090 WP_003403442.1.100910 WP_003403442.1.100915 WP_003403442.1.100918 WP_003403442.1.100935 WP_003403442.1.100984 WP_003403442.1.100992 WP_003403442.1.100998 WP_003403442.1.101 WP_003403442.1.101025 WP_003403442.1.101028 WP_003403442.1.10104 WP_003403442.1.101048 WP_003403442.1.101054 WP_003403442.1.101075 WP_003403442.1.101143 WP_003403442.1.101146 WP_003403442.1.10116 WP_003403442.1.10117 WP_003403442.1.101209 WP_003403442.1.10125 WP_003403442.1.101290 WP_003403442.1.101323 WP_003403442.1.101324 WP_003403442.1.101350 WP_003403442.1.101367 WP_003403442.1.101398 WP_003403442.1.101403 WP_003403442.1.101421 WP_003403442.1.10144 WP_003403442.1.101442 WP_003403442.1.101452 WP_003403442.1.101456 WP_003403442.1.101481 WP_003403442.1.101493 WP_003403442.1.101496 WP_003403442.1.101525 WP_003403442.1.101533 WP_003403442.1.101535 WP_003403442.1.101553 WP_003403442.1.101558 WP_003403442.1.10156 WP_003403442.1.101573 WP_003403442.1.101576 WP_003403442.1.10159 WP_003403442.1.101592 WP_003403442.1.101604 WP_003403442.1.101607 WP_003403442.1.101644 WP_003403442.1.101671 WP_003403442.1.101687 WP_003403442.1.101698 WP_003403442.1.10170 WP_003403442.1.101713 WP_003403442.1.101722 WP_003403442.1.101733 WP_003403442.1.101743 WP_003403442.1.101754 WP_003403442.1.101764 WP_003403442.1.101773 WP_003403442.1.101795 WP_003403442.1.101798 WP_003403442.1.101802 WP_003403442.1.101826 WP_003403442.1.101836 WP_003403442.1.101858 WP_003403442.1.101859 WP_003403442.1.101862 WP_003403442.1.101894 WP_003403442.1.101899 WP_003403442.1.1019 WP_003403442.1.101923 WP_003403442.1.101925 WP_003403442.1.10193 WP_003403442.1.101996 WP_003403442.1.102 WP_003403442.1.102017 WP_003403442.1.102053 WP_003403442.1.102055 WP_003403442.1.102063 WP_003403442.1.102099 WP_003403442.1.1021 WP_003403442.1.10211 WP_003403442.1.102119 WP_003403442.1.102121 WP_003403442.1.102143 WP_003403442.1.10216 WP_003403442.1.10224 WP_003403442.1.10253 WP_003403442.1.10262 WP_003403442.1.10272 WP_003403442.1.10277 WP_003403442.1.10350 WP_003403442.1.10362 WP_003403442.1.10366 WP_003403442.1.10376 WP_003403442.1.10396 WP_003403442.1.10410 WP_003403442.1.10414 WP_003403442.1.10421 WP_003403442.1.10430 WP_003403442.1.1044 WP_003403442.1.10440 WP_003403442.1.10445 WP_003403442.1.10471 WP_003403442.1.10472 WP_003403442.1.10489 WP_003403442.1.105 WP_003403442.1.10518 WP_003403442.1.10523 WP_003403442.1.10545 WP_003403442.1.1057 WP_003403442.1.10594 WP_003403442.1.10603 WP_003403442.1.10606 WP_003403442.1.10615 WP_003403442.1.10623 WP_003403442.1.10635 WP_003403442.1.10643 WP_003403442.1.10648 WP_003403442.1.10662 WP_003403442.1.10709 WP_003403442.1.10735 WP_003403442.1.10740 WP_003403442.1.10756 WP_003403442.1.1078 WP_003403442.1.10791 WP_003403442.1.10799 WP_003403442.1.10825 WP_003403442.1.10848 WP_003403442.1.10863 WP_003403442.1.10879 WP_003403442.1.10912 WP_003403442.1.10916 WP_003403442.1.10923 WP_003403442.1.10927 WP_003403442.1.1095 WP_003403442.1.10956 WP_003403442.1.10958 WP_003403442.1.10962 WP_003403442.1.10980 WP_003403442.1.1100 WP_003403442.1.11040 WP_003403442.1.11061 WP_003403442.1.11070 WP_003403442.1.11141 WP_003403442.1.11171 WP_003403442.1.11175 WP_003403442.1.11176 WP_003403442.1.11222 WP_003403442.1.11236 WP_003403442.1.11329 WP_003403442.1.1133 WP_003403442.1.11342 WP_003403442.1.11373 WP_003403442.1.11376 WP_003403442.1.11390 WP_003403442.1.11402 WP_003403442.1.11481 WP_003403442.1.11487 WP_003403442.1.11489 WP_003403442.1.11491 WP_003403442.1.11514 WP_003403442.1.11587 WP_003403442.1.11589 WP_003403442.1.11596 WP_003403442.1.11604 WP_003403442.1.11610 WP_003403442.1.11697 WP_003403442.1.11707 WP_003403442.1.11752 WP_003403442.1.11758 WP_003403442.1.11761 WP_003403442.1.11775 WP_003403442.1.11804 WP_003403442.1.11822 WP_003403442.1.11826 WP_003403442.1.11898 WP_003403442.1.11906 WP_003403442.1.11939 WP_003403442.1.11960 WP_003403442.1.11961 WP_003403442.1.11972 WP_003403442.1.11984 WP_003403442.1.120 WP_003403442.1.12001 WP_003403442.1.12049 WP_003403442.1.12052 WP_003403442.1.12100 WP_003403442.1.12116 WP_003403442.1.12130 WP_003403442.1.12133 WP_003403442.1.12161 WP_003403442.1.12165 WP_003403442.1.12184 WP_003403442.1.12187 WP_003403442.1.12190 WP_003403442.1.12216 WP_003403442.1.12265 WP_003403442.1.12275 WP_003403442.1.12293 WP_003403442.1.12294 WP_003403442.1.123 WP_003403442.1.1231 WP_003403442.1.12314 WP_003403442.1.12327 WP_003403442.1.12338 WP_003403442.1.1236 WP_003403442.1.12371 WP_003403442.1.12372 WP_003403442.1.12389 WP_003403442.1.12406 WP_003403442.1.1241 WP_003403442.1.12421 WP_003403442.1.12424 WP_003403442.1.12446 WP_003403442.1.12464 WP_003403442.1.12479 WP_003403442.1.12519 WP_003403442.1.12523 WP_003403442.1.12526 WP_003403442.1.1255 WP_003403442.1.12551 WP_003403442.1.12563 WP_003403442.1.12611 WP_003403442.1.12669 WP_003403442.1.1267 WP_003403442.1.12672 WP_003403442.1.12692 WP_003403442.1.1271 WP_003403442.1.12710 WP_003403442.1.1279 WP_003403442.1.12794 WP_003403442.1.12801 WP_003403442.1.12804 WP_003403442.1.12821 WP_003403442.1.12841 WP_003403442.1.12854 WP_003403442.1.12871 WP_003403442.1.12901 WP_003403442.1.12941 WP_003403442.1.12947 WP_003403442.1.12957 WP_003403442.1.12972 WP_003403442.1.13028 WP_003403442.1.13043 WP_003403442.1.13086 WP_003403442.1.13087 WP_003403442.1.13090 WP_003403442.1.13096 WP_003403442.1.13163 WP_003403442.1.13175 WP_003403442.1.13183 WP_003403442.1.132 WP_003403442.1.13249 WP_003403442.1.13282 WP_003403442.1.13284 WP_003403442.1.13296 WP_003403442.1.13298 WP_003403442.1.13302 WP_003403442.1.13306 WP_003403442.1.13312 WP_003403442.1.13313 WP_003403442.1.13321 WP_003403442.1.13345 WP_003403442.1.13358 WP_003403442.1.13370 WP_003403442.1.13375 WP_003403442.1.1338 WP_003403442.1.13420 WP_003403442.1.13433 WP_003403442.1.13435 WP_003403442.1.13438 WP_003403442.1.13461 WP_003403442.1.13466 WP_003403442.1.13489 WP_003403442.1.13526 WP_003403442.1.13551 WP_003403442.1.13561 WP_003403442.1.13564 WP_003403442.1.13579 WP_003403442.1.13647 WP_003403442.1.13667 WP_003403442.1.13687 WP_003403442.1.13697 WP_003403442.1.13719 WP_003403442.1.13763 WP_003403442.1.1377 WP_003403442.1.13774 WP_003403442.1.13786 WP_003403442.1.13793 WP_003403442.1.13794 WP_003403442.1.13817 WP_003403442.1.13834 WP_003403442.1.13866 WP_003403442.1.13880 WP_003403442.1.13899 WP_003403442.1.13909 WP_003403442.1.13910 WP_003403442.1.13919 WP_003403442.1.13920 WP_003403442.1.13952 WP_003403442.1.13953 WP_003403442.1.13962 WP_003403442.1.13988 WP_003403442.1.14027 WP_003403442.1.14046 WP_003403442.1.14115 WP_003403442.1.1415 WP_003403442.1.14152 WP_003403442.1.14158 WP_003403442.1.14162 WP_003403442.1.14175 WP_003403442.1.14178 WP_003403442.1.14194 WP_003403442.1.14195 WP_003403442.1.14208 WP_003403442.1.14238 WP_003403442.1.14266 WP_003403442.1.14273 WP_003403442.1.14303 WP_003403442.1.14306 WP_003403442.1.14307 WP_003403442.1.14310 WP_003403442.1.14341 WP_003403442.1.14382 WP_003403442.1.14416 WP_003403442.1.14428 WP_003403442.1.14441 WP_003403442.1.14469 WP_003403442.1.14477 WP_003403442.1.14504 WP_003403442.1.14514 WP_003403442.1.1452 WP_003403442.1.14527 WP_003403442.1.1454 WP_003403442.1.14544 WP_003403442.1.14548 WP_003403442.1.14561 WP_003403442.1.14573 WP_003403442.1.1462 WP_003403442.1.14658 WP_003403442.1.14667 WP_003403442.1.14668 WP_003403442.1.14675 WP_003403442.1.14694 WP_003403442.1.14695 WP_003403442.1.14709 WP_003403442.1.14766 WP_003403442.1.14783 WP_003403442.1.14865 WP_003403442.1.14872 WP_003403442.1.14905 WP_003403442.1.14926 WP_003403442.1.14951 WP_003403442.1.14955 WP_003403442.1.15003 WP_003403442.1.15009 WP_003403442.1.15028 WP_003403442.1.15040 WP_003403442.1.15052 WP_003403442.1.15065 WP_003403442.1.15072 WP_003403442.1.15089 WP_003403442.1.1509 WP_003403442.1.15126 WP_003403442.1.15131 WP_003403442.1.15168 WP_003403442.1.15172 WP_003403442.1.15174 WP_003403442.1.15187 WP_003403442.1.15196 WP_003403442.1.15210 WP_003403442.1.15216 WP_003403442.1.15217 WP_003403442.1.1523 WP_003403442.1.15232 WP_003403442.1.15238 WP_003403442.1.15240 WP_003403442.1.15253 WP_003403442.1.1527 WP_003403442.1.15292 WP_003403442.1.15299 WP_003403442.1.15302 WP_003403442.1.15322 WP_003403442.1.1534 WP_003403442.1.15345 WP_003403442.1.15365 WP_003403442.1.15372 WP_003403442.1.15386 WP_003403442.1.15387 WP_003403442.1.15442 WP_003403442.1.15447 WP_003403442.1.15449 WP_003403442.1.15477 WP_003403442.1.15481 WP_003403442.1.15492 WP_003403442.1.15512 WP_003403442.1.15558 WP_003403442.1.15559 WP_003403442.1.15566 WP_003403442.1.15599 WP_003403442.1.1560 WP_003403442.1.15611 WP_003403442.1.1563 WP_003403442.1.15633 WP_003403442.1.15643 WP_003403442.1.15688 WP_003403442.1.15763 WP_003403442.1.15774 WP_003403442.1.1578 WP_003403442.1.15780 WP_003403442.1.15827 WP_003403442.1.15834 WP_003403442.1.15842 WP_003403442.1.15848 WP_003403442.1.15853 WP_003403442.1.15870 WP_003403442.1.15877 WP_003403442.1.15893 WP_003403442.1.15896 WP_003403442.1.15926 WP_003403442.1.15933 WP_003403442.1.15946 WP_003403442.1.15958 WP_003403442.1.15973 WP_003403442.1.15987 WP_003403442.1.15993 WP_003403442.1.16009 WP_003403442.1.16025 WP_003403442.1.16043 WP_003403442.1.16055 WP_003403442.1.16066 WP_003403442.1.16069 WP_003403442.1.16077 WP_003403442.1.16106 WP_003403442.1.16108 WP_003403442.1.16110 WP_003403442.1.16130 WP_003403442.1.16136 WP_003403442.1.16139 WP_003403442.1.16141 WP_003403442.1.16143 WP_003403442.1.1630 WP_003403442.1.16318 WP_003403442.1.1632 WP_003403442.1.16327 WP_003403442.1.16334 WP_003403442.1.16341 WP_003403442.1.16345 WP_003403442.1.16384 WP_003403442.1.16386 WP_003403442.1.164 WP_003403442.1.1642 WP_003403442.1.16421 WP_003403442.1.16424 WP_003403442.1.16426 WP_003403442.1.16431 WP_003403442.1.16438 WP_003403442.1.1644 WP_003403442.1.16442 WP_003403442.1.16448 WP_003403442.1.16451 WP_003403442.1.16476 WP_003403442.1.16480 WP_003403442.1.16494 WP_003403442.1.1652 WP_003403442.1.16549 WP_003403442.1.16560 WP_003403442.1.16598 WP_003403442.1.16609 WP_003403442.1.16619 WP_003403442.1.16620 WP_003403442.1.16622 WP_003403442.1.16637 WP_003403442.1.1669 WP_003403442.1.16707 WP_003403442.1.16724 WP_003403442.1.16731 WP_003403442.1.16743 WP_003403442.1.1683 WP_003403442.1.16837 WP_003403442.1.16852 WP_003403442.1.16937 WP_003403442.1.16940 WP_003403442.1.16950 WP_003403442.1.16959 WP_003403442.1.16968 WP_003403442.1.1697 WP_003403442.1.16973 WP_003403442.1.16977 WP_003403442.1.16987 WP_003403442.1.17005 WP_003403442.1.17006 WP_003403442.1.17010 WP_003403442.1.17015 WP_003403442.1.17019 WP_003403442.1.17039 WP_003403442.1.17041 WP_003403442.1.17052 WP_003403442.1.17057 WP_003403442.1.17062 WP_003403442.1.1707 WP_003403442.1.17094 WP_003403442.1.17130 WP_003403442.1.17138 WP_003403442.1.17147 WP_003403442.1.17167 WP_003403442.1.17224 WP_003403442.1.17251 WP_003403442.1.17288 WP_003403442.1.17304 WP_003403442.1.17314 WP_003403442.1.17345 WP_003403442.1.17381 WP_003403442.1.17412 WP_003403442.1.1743 WP_003403442.1.17440 WP_003403442.1.17466 WP_003403442.1.17477 WP_003403442.1.17483 WP_003403442.1.17505 WP_003403442.1.17527 WP_003403442.1.17535 WP_003403442.1.17540 WP_003403442.1.17553 WP_003403442.1.17558 WP_003403442.1.17599 WP_003403442.1.17635 WP_003403442.1.17655 WP_003403442.1.17679 WP_003403442.1.1768 WP_003403442.1.17687 WP_003403442.1.17700 WP_003403442.1.17710 WP_003403442.1.17713 WP_003403442.1.17722 WP_003403442.1.17746 WP_003403442.1.17788 WP_003403442.1.17798 WP_003403442.1.17803 WP_003403442.1.17821 WP_003403442.1.17830 WP_003403442.1.17868 WP_003403442.1.17878 WP_003403442.1.1792 WP_003403442.1.17923 WP_003403442.1.1795 WP_003403442.1.17955 WP_003403442.1.17973 WP_003403442.1.18009 WP_003403442.1.18013 WP_003403442.1.18033 WP_003403442.1.18057 WP_003403442.1.18065 WP_003403442.1.18116 WP_003403442.1.18120 WP_003403442.1.18126 WP_003403442.1.1817 WP_003403442.1.18170 WP_003403442.1.18206 WP_003403442.1.18216 WP_003403442.1.18240 WP_003403442.1.18257 WP_003403442.1.18297 WP_003403442.1.18306 WP_003403442.1.18364 WP_003403442.1.18399 WP_003403442.1.18411 WP_003403442.1.18444 WP_003403442.1.18448 WP_003403442.1.18467 WP_003403442.1.18476 WP_003403442.1.18522 WP_003403442.1.18580 WP_003403442.1.18582 WP_003403442.1.18587 WP_003403442.1.186 WP_003403442.1.18601 WP_003403442.1.18639 WP_003403442.1.18646 WP_003403442.1.18647 WP_003403442.1.1868 WP_003403442.1.18694 WP_003403442.1.18710 WP_003403442.1.18751 WP_003403442.1.18781 WP_003403442.1.18793 WP_003403442.1.18804 WP_003403442.1.18816 WP_003403442.1.18823 WP_003403442.1.18827 WP_003403442.1.18838 WP_003403442.1.18849 WP_003403442.1.18856 WP_003403442.1.18945 WP_003403442.1.1898 WP_003403442.1.19005 WP_003403442.1.19056 WP_003403442.1.19063 WP_003403442.1.19066 WP_003403442.1.19071 WP_003403442.1.19085 WP_003403442.1.19094 WP_003403442.1.19144 WP_003403442.1.19159 WP_003403442.1.19193 WP_003403442.1.19231 WP_003403442.1.19243 WP_003403442.1.19264 WP_003403442.1.19295 WP_003403442.1.19307 WP_003403442.1.19326 WP_003403442.1.1933 WP_003403442.1.19364 WP_003403442.1.19382 WP_003403442.1.19400 WP_003403442.1.19426 WP_003403442.1.19429 WP_003403442.1.19464 WP_003403442.1.19480 WP_003403442.1.19512 WP_003403442.1.19553 WP_003403442.1.19562 WP_003403442.1.19564 WP_003403442.1.19568 WP_003403442.1.19572 WP_003403442.1.19596 WP_003403442.1.19600 WP_003403442.1.19630 WP_003403442.1.1967 WP_003403442.1.19694 WP_003403442.1.1970 WP_003403442.1.19707 WP_003403442.1.19742 WP_003403442.1.19785 WP_003403442.1.19820 WP_003403442.1.19868 WP_003403442.1.19874 WP_003403442.1.19900 WP_003403442.1.19922 WP_003403442.1.19936 WP_003403442.1.19946 WP_003403442.1.19949 WP_003403442.1.19960 WP_003403442.1.19964 WP_003403442.1.20007 WP_003403442.1.20016 WP_003403442.1.20028 WP_003403442.1.2003 WP_003403442.1.20037 WP_003403442.1.20039 WP_003403442.1.20082 WP_003403442.1.20097 WP_003403442.1.20116 WP_003403442.1.20130 WP_003403442.1.20140 WP_003403442.1.20141 WP_003403442.1.20142 WP_003403442.1.20158 WP_003403442.1.20239 WP_003403442.1.20243 WP_003403442.1.20259 WP_003403442.1.20262 WP_003403442.1.20268 WP_003403442.1.20272 WP_003403442.1.20273 WP_003403442.1.20280 WP_003403442.1.20294 WP_003403442.1.20300 WP_003403442.1.20309 WP_003403442.1.20322 WP_003403442.1.2037 WP_003403442.1.20372 WP_003403442.1.20381 WP_003403442.1.204 WP_003403442.1.20427 WP_003403442.1.20432 WP_003403442.1.20457 WP_003403442.1.20459 WP_003403442.1.20460 WP_003403442.1.20542 WP_003403442.1.20578 WP_003403442.1.20608 WP_003403442.1.20624 WP_003403442.1.2066 WP_003403442.1.20707 WP_003403442.1.20722 WP_003403442.1.20729 WP_003403442.1.20751 WP_003403442.1.20843 WP_003403442.1.20850 WP_003403442.1.2086 WP_003403442.1.20868 WP_003403442.1.20876 WP_003403442.1.20897 WP_003403442.1.20898 WP_003403442.1.2090 WP_003403442.1.20911 WP_003403442.1.20916 WP_003403442.1.20921 WP_003403442.1.20926 WP_003403442.1.20927 WP_003403442.1.20951 WP_003403442.1.20970 WP_003403442.1.2104 WP_003403442.1.21070 WP_003403442.1.21127 WP_003403442.1.21135 WP_003403442.1.21173 WP_003403442.1.21187 WP_003403442.1.212 WP_003403442.1.2120 WP_003403442.1.21218 WP_003403442.1.21219 WP_003403442.1.2123 WP_003403442.1.21231 WP_003403442.1.21234 WP_003403442.1.2126 WP_003403442.1.21292 WP_003403442.1.21307 WP_003403442.1.2131 WP_003403442.1.21311 WP_003403442.1.21321 WP_003403442.1.21365 WP_003403442.1.2137 WP_003403442.1.21392 WP_003403442.1.21397 WP_003403442.1.21403 WP_003403442.1.21418 WP_003403442.1.21430 WP_003403442.1.21434 WP_003403442.1.21444 WP_003403442.1.21468 WP_003403442.1.21498 WP_003403442.1.21509 WP_003403442.1.21560 WP_003403442.1.21565 WP_003403442.1.21586 WP_003403442.1.21591 WP_003403442.1.21594 WP_003403442.1.21602 WP_003403442.1.21615 WP_003403442.1.21638 WP_003403442.1.21639 WP_003403442.1.21658 WP_003403442.1.2168 WP_003403442.1.2174 WP_003403442.1.21741 WP_003403442.1.21742 WP_003403442.1.21777 WP_003403442.1.21786 WP_003403442.1.21795 WP_003403442.1.218 WP_003403442.1.21826 WP_003403442.1.21829 WP_003403442.1.21840 WP_003403442.1.21843 WP_003403442.1.21872 WP_003403442.1.21873 WP_003403442.1.2188 WP_003403442.1.21882 WP_003403442.1.21906 WP_003403442.1.21912 WP_003403442.1.2194 WP_003403442.1.21941 WP_003403442.1.21956 WP_003403442.1.21958 WP_003403442.1.21960 WP_003403442.1.21971 WP_003403442.1.21973 WP_003403442.1.21983 WP_003403442.1.22003 WP_003403442.1.22013 WP_003403442.1.22025 WP_003403442.1.22036 WP_003403442.1.22075 WP_003403442.1.22092 WP_003403442.1.2212 WP_003403442.1.22127 WP_003403442.1.22140 WP_003403442.1.22233 WP_003403442.1.22255 WP_003403442.1.22277 WP_003403442.1.22305 WP_003403442.1.22348 WP_003403442.1.22356 WP_003403442.1.22366 WP_003403442.1.2238 WP_003403442.1.22380 WP_003403442.1.22437 WP_003403442.1.22445 WP_003403442.1.22490 WP_003403442.1.22511 WP_003403442.1.22524 WP_003403442.1.2253 WP_003403442.1.22585 WP_003403442.1.22589 WP_003403442.1.22606 WP_003403442.1.22608 WP_003403442.1.22609 WP_003403442.1.22618 WP_003403442.1.2262 WP_003403442.1.22624 WP_003403442.1.22629 WP_003403442.1.22664 WP_003403442.1.22665 WP_003403442.1.22670 WP_003403442.1.22680 WP_003403442.1.22725 WP_003403442.1.22728 WP_003403442.1.22733 WP_003403442.1.22737 WP_003403442.1.2275 WP_003403442.1.22754 WP_003403442.1.22797 WP_003403442.1.22800 WP_003403442.1.22804 WP_003403442.1.22829 WP_003403442.1.22840 WP_003403442.1.22844 WP_003403442.1.22963 WP_003403442.1.22970 WP_003403442.1.22996 WP_003403442.1.22997 WP_003403442.1.22999 WP_003403442.1.23015 WP_003403442.1.23032 WP_003403442.1.231 WP_003403442.1.23101 WP_003403442.1.2312 WP_003403442.1.23140 WP_003403442.1.23153 WP_003403442.1.23171 WP_003403442.1.23199 WP_003403442.1.2320 WP_003403442.1.23204 WP_003403442.1.23216 WP_003403442.1.23229 WP_003403442.1.23233 WP_003403442.1.2326 WP_003403442.1.23261 WP_003403442.1.23272 WP_003403442.1.2329 WP_003403442.1.23308 WP_003403442.1.23316 WP_003403442.1.23321 WP_003403442.1.23325 WP_003403442.1.2339 WP_003403442.1.23406 WP_003403442.1.23438 WP_003403442.1.23445 WP_003403442.1.23447 WP_003403442.1.23452 WP_003403442.1.2349 WP_003403442.1.23496 WP_003403442.1.23497 WP_003403442.1.23506 WP_003403442.1.23530 WP_003403442.1.23539 WP_003403442.1.23546 WP_003403442.1.23551 WP_003403442.1.23573 WP_003403442.1.23583 WP_003403442.1.23588 WP_003403442.1.23628 WP_003403442.1.23677 WP_003403442.1.23683 WP_003403442.1.23692 WP_003403442.1.23694 WP_003403442.1.23699 WP_003403442.1.2371 WP_003403442.1.23803 WP_003403442.1.23807 WP_003403442.1.23825 WP_003403442.1.23832 WP_003403442.1.2384 WP_003403442.1.23843 WP_003403442.1.23863 WP_003403442.1.2387 WP_003403442.1.23894 WP_003403442.1.23993 WP_003403442.1.2400 WP_003403442.1.24007 WP_003403442.1.24008 WP_003403442.1.24046 WP_003403442.1.24057 WP_003403442.1.24062 WP_003403442.1.24113 WP_003403442.1.24119 WP_003403442.1.24128 WP_003403442.1.24140 WP_003403442.1.24176 WP_003403442.1.24190 WP_003403442.1.24202 WP_003403442.1.24244 WP_003403442.1.24261 WP_003403442.1.24284 WP_003403442.1.24294 WP_003403442.1.24357 WP_003403442.1.24396 WP_003403442.1.24414 WP_003403442.1.24423 WP_003403442.1.2443 WP_003403442.1.24446 WP_003403442.1.24461 WP_003403442.1.24500 WP_003403442.1.24507 WP_003403442.1.24509 WP_003403442.1.24529 WP_003403442.1.24553 WP_003403442.1.24629 WP_003403442.1.24638 WP_003403442.1.24648 WP_003403442.1.2466 WP_003403442.1.24767 WP_003403442.1.24824 WP_003403442.1.24831 WP_003403442.1.24840 WP_003403442.1.24848 WP_003403442.1.24857 WP_003403442.1.2487 WP_003403442.1.24893 WP_003403442.1.24907 WP_003403442.1.24933 WP_003403442.1.24956 WP_003403442.1.24958 WP_003403442.1.24985 WP_003403442.1.2499 WP_003403442.1.25004 WP_003403442.1.25051 WP_003403442.1.2507 WP_003403442.1.25096 WP_003403442.1.25103 WP_003403442.1.25129 WP_003403442.1.25171 WP_003403442.1.25184 WP_003403442.1.25247 WP_003403442.1.25252 WP_003403442.1.25278 WP_003403442.1.25283 WP_003403442.1.25309 WP_003403442.1.25313 WP_003403442.1.25338 WP_003403442.1.25342 WP_003403442.1.25343 WP_003403442.1.25367 WP_003403442.1.25393 WP_003403442.1.25406 WP_003403442.1.25435 WP_003403442.1.25437 WP_003403442.1.25445 WP_003403442.1.25455 WP_003403442.1.25473 WP_003403442.1.25504 WP_003403442.1.25513 WP_003403442.1.25542 WP_003403442.1.25579 WP_003403442.1.25594 WP_003403442.1.25606 WP_003403442.1.25645 WP_003403442.1.25673 WP_003403442.1.25674 WP_003403442.1.25693 WP_003403442.1.25699 WP_003403442.1.25727 WP_003403442.1.25736 WP_003403442.1.25738 WP_003403442.1.25756 WP_003403442.1.25759 WP_003403442.1.2580 WP_003403442.1.25813 WP_003403442.1.25853 WP_003403442.1.25854 WP_003403442.1.25874 WP_003403442.1.25885 WP_003403442.1.25892 WP_003403442.1.25906 WP_003403442.1.25914 WP_003403442.1.25916 WP_003403442.1.2594 WP_003403442.1.25954 WP_003403442.1.25965 WP_003403442.1.25972 WP_003403442.1.26017 WP_003403442.1.26032 WP_003403442.1.26038 WP_003403442.1.26072 WP_003403442.1.26089 WP_003403442.1.26097 WP_003403442.1.26098 WP_003403442.1.26108 WP_003403442.1.26109 WP_003403442.1.26118 WP_003403442.1.26126 WP_003403442.1.2614 WP_003403442.1.26168 WP_003403442.1.26182 WP_003403442.1.26190 WP_003403442.1.2620 WP_003403442.1.26234 WP_003403442.1.26243 WP_003403442.1.26265 WP_003403442.1.26267 WP_003403442.1.26292 WP_003403442.1.26310 WP_003403442.1.26328 WP_003403442.1.26349 WP_003403442.1.26366 WP_003403442.1.26374 WP_003403442.1.26407 WP_003403442.1.26412 WP_003403442.1.26454 WP_003403442.1.26464 WP_003403442.1.2653 WP_003403442.1.26560 WP_003403442.1.26571 WP_003403442.1.2659 WP_003403442.1.26597 WP_003403442.1.26603 WP_003403442.1.26629 WP_003403442.1.26651 WP_003403442.1.26702 WP_003403442.1.26707 WP_003403442.1.26710 WP_003403442.1.26719 WP_003403442.1.26737 WP_003403442.1.26738 WP_003403442.1.26745 WP_003403442.1.26756 WP_003403442.1.2676 WP_003403442.1.2677 WP_003403442.1.26779 WP_003403442.1.26780 WP_003403442.1.26798 WP_003403442.1.26854 WP_003403442.1.26868 WP_003403442.1.26876 WP_003403442.1.26888 WP_003403442.1.26914 WP_003403442.1.26959 WP_003403442.1.26984 WP_003403442.1.26992 WP_003403442.1.27004 WP_003403442.1.27017 WP_003403442.1.27045 WP_003403442.1.27074 WP_003403442.1.27075 WP_003403442.1.27128 WP_003403442.1.27130 WP_003403442.1.27152 WP_003403442.1.27162 WP_003403442.1.27164 WP_003403442.1.27193 WP_003403442.1.27235 WP_003403442.1.27254 WP_003403442.1.27278 WP_003403442.1.27343 WP_003403442.1.27352 WP_003403442.1.27369 WP_003403442.1.27391 WP_003403442.1.27398 WP_003403442.1.27402 WP_003403442.1.27410 WP_003403442.1.27411 WP_003403442.1.27449 WP_003403442.1.27460 WP_003403442.1.27463 WP_003403442.1.2749 WP_003403442.1.27492 WP_003403442.1.27528 WP_003403442.1.27541 WP_003403442.1.27576 WP_003403442.1.27582 WP_003403442.1.27596 WP_003403442.1.27607 WP_003403442.1.2766 WP_003403442.1.277 WP_003403442.1.27724 WP_003403442.1.27730 WP_003403442.1.27736 WP_003403442.1.27743 WP_003403442.1.27750 WP_003403442.1.27771 WP_003403442.1.27779 WP_003403442.1.27795 WP_003403442.1.27803 WP_003403442.1.27819 WP_003403442.1.27835 WP_003403442.1.27915 WP_003403442.1.27935 WP_003403442.1.27962 WP_003403442.1.28053 WP_003403442.1.28092 WP_003403442.1.28106 WP_003403442.1.28131 WP_003403442.1.28142 WP_003403442.1.28159 WP_003403442.1.2816 WP_003403442.1.28161 WP_003403442.1.28192 WP_003403442.1.28202 WP_003403442.1.28241 WP_003403442.1.28242 WP_003403442.1.28251 WP_003403442.1.28255 WP_003403442.1.28269 WP_003403442.1.28276 WP_003403442.1.28293 WP_003403442.1.28331 WP_003403442.1.28367 WP_003403442.1.28391 WP_003403442.1.2842 WP_003403442.1.28448 WP_003403442.1.2847 WP_003403442.1.28471 WP_003403442.1.28473 WP_003403442.1.28493 WP_003403442.1.28497 WP_003403442.1.28530 WP_003403442.1.28545 WP_003403442.1.28561 WP_003403442.1.28585 WP_003403442.1.286 WP_003403442.1.28610 WP_003403442.1.28617 WP_003403442.1.28634 WP_003403442.1.28642 WP_003403442.1.28671 WP_003403442.1.28682 WP_003403442.1.28698 WP_003403442.1.28703 WP_003403442.1.28739 WP_003403442.1.28758 WP_003403442.1.28781 WP_003403442.1.28787 WP_003403442.1.28827 WP_003403442.1.28839 WP_003403442.1.28847 WP_003403442.1.28851 WP_003403442.1.28865 WP_003403442.1.28897 WP_003403442.1.28914 WP_003403442.1.28935 WP_003403442.1.28936 WP_003403442.1.28939 WP_003403442.1.28943 WP_003403442.1.28952 WP_003403442.1.28975 WP_003403442.1.2899 WP_003403442.1.28993 WP_003403442.1.29000 WP_003403442.1.2901 WP_003403442.1.29028 WP_003403442.1.29033 WP_003403442.1.29058 WP_003403442.1.29078 WP_003403442.1.29102 WP_003403442.1.29115 WP_003403442.1.2916 WP_003403442.1.29217 WP_003403442.1.29223 WP_003403442.1.29234 WP_003403442.1.29264 WP_003403442.1.29275 WP_003403442.1.29306 WP_003403442.1.29339 WP_003403442.1.29348 WP_003403442.1.29364 WP_003403442.1.29367 WP_003403442.1.2938 WP_003403442.1.29399 WP_003403442.1.29426 WP_003403442.1.2944 WP_003403442.1.29449 WP_003403442.1.29450 WP_003403442.1.29452 WP_003403442.1.2949 WP_003403442.1.29515 WP_003403442.1.29525 WP_003403442.1.2953 WP_003403442.1.29559 WP_003403442.1.29587 WP_003403442.1.2959 WP_003403442.1.29592 WP_003403442.1.29599 WP_003403442.1.29611 WP_003403442.1.29632 WP_003403442.1.29649 WP_003403442.1.2965 WP_003403442.1.29659 WP_003403442.1.2969 WP_003403442.1.29696 WP_003403442.1.29698 WP_003403442.1.29718 WP_003403442.1.29742 WP_003403442.1.29745 WP_003403442.1.29747 WP_003403442.1.29769 WP_003403442.1.29825 WP_003403442.1.29830 WP_003403442.1.29847 WP_003403442.1.29861 WP_003403442.1.29869 WP_003403442.1.29883 WP_003403442.1.29890 WP_003403442.1.299 WP_003403442.1.29931 WP_003403442.1.29960 WP_003403442.1.30014 WP_003403442.1.3004 WP_003403442.1.30040 WP_003403442.1.30043 WP_003403442.1.30074 WP_003403442.1.30097 WP_003403442.1.30101 WP_003403442.1.30106 WP_003403442.1.30114 WP_003403442.1.30126 WP_003403442.1.30131 WP_003403442.1.30138 WP_003403442.1.30139 WP_003403442.1.30145 WP_003403442.1.30211 WP_003403442.1.30224 WP_003403442.1.30235 WP_003403442.1.30237 WP_003403442.1.3027 WP_003403442.1.30279 WP_003403442.1.30282 WP_003403442.1.30283 WP_003403442.1.30288 WP_003403442.1.30291 WP_003403442.1.30363 WP_003403442.1.30374 WP_003403442.1.30404 WP_003403442.1.3043 WP_003403442.1.30433 WP_003403442.1.30438 WP_003403442.1.30462 WP_003403442.1.30464 WP_003403442.1.30468 WP_003403442.1.30500 WP_003403442.1.3057 WP_003403442.1.30574 WP_003403442.1.30628 WP_003403442.1.30641 WP_003403442.1.30661 WP_003403442.1.30669 WP_003403442.1.30683 WP_003403442.1.30699 WP_003403442.1.30709 WP_003403442.1.30713 WP_003403442.1.30716 WP_003403442.1.30719 WP_003403442.1.30730 WP_003403442.1.30732 WP_003403442.1.30736 WP_003403442.1.30745 WP_003403442.1.30760 WP_003403442.1.30791 WP_003403442.1.308 WP_003403442.1.30807 WP_003403442.1.30818 WP_003403442.1.30824 WP_003403442.1.30848 WP_003403442.1.30877 WP_003403442.1.30888 WP_003403442.1.30901 WP_003403442.1.30903 WP_003403442.1.30912 WP_003403442.1.30913 WP_003403442.1.30914 WP_003403442.1.30919 WP_003403442.1.30977 WP_003403442.1.3100 WP_003403442.1.31002 WP_003403442.1.3101 WP_003403442.1.31034 WP_003403442.1.31047 WP_003403442.1.31070 WP_003403442.1.31074 WP_003403442.1.31102 WP_003403442.1.31127 WP_003403442.1.31184 WP_003403442.1.31199 WP_003403442.1.31226 WP_003403442.1.31230 WP_003403442.1.31233 WP_003403442.1.31263 WP_003403442.1.31264 WP_003403442.1.31270 WP_003403442.1.31287 WP_003403442.1.31290 WP_003403442.1.31346 WP_003403442.1.31348 WP_003403442.1.31354 WP_003403442.1.31390 WP_003403442.1.31414 WP_003403442.1.31417 WP_003403442.1.31428 WP_003403442.1.3143 WP_003403442.1.31458 WP_003403442.1.31483 WP_003403442.1.31498 WP_003403442.1.31507 WP_003403442.1.31537 WP_003403442.1.31548 WP_003403442.1.31569 WP_003403442.1.31573 WP_003403442.1.316 WP_003403442.1.31629 WP_003403442.1.31666 WP_003403442.1.31693 WP_003403442.1.31703 WP_003403442.1.31744 WP_003403442.1.31745 WP_003403442.1.31770 WP_003403442.1.31776 WP_003403442.1.31783 WP_003403442.1.318 WP_003403442.1.3184 WP_003403442.1.31840 WP_003403442.1.31880 WP_003403442.1.31911 WP_003403442.1.31930 WP_003403442.1.31932 WP_003403442.1.31955 WP_003403442.1.31985 WP_003403442.1.31991 WP_003403442.1.31995 WP_003403442.1.32004 WP_003403442.1.32039 WP_003403442.1.3204 WP_003403442.1.32045 WP_003403442.1.32071 WP_003403442.1.32132 WP_003403442.1.32157 WP_003403442.1.32164 WP_003403442.1.32179 WP_003403442.1.32198 WP_003403442.1.32297 WP_003403442.1.32383 WP_003403442.1.32400 WP_003403442.1.32403 WP_003403442.1.32416 WP_003403442.1.32421 WP_003403442.1.32433 WP_003403442.1.32461 WP_003403442.1.32482 WP_003403442.1.32503 WP_003403442.1.32556 WP_003403442.1.32562 WP_003403442.1.32569 WP_003403442.1.32592 WP_003403442.1.32620 WP_003403442.1.32647 WP_003403442.1.32653 WP_003403442.1.32654 WP_003403442.1.3268 WP_003403442.1.32695 WP_003403442.1.32706 WP_003403442.1.32716 WP_003403442.1.32738 WP_003403442.1.32752 WP_003403442.1.32780 WP_003403442.1.32781 WP_003403442.1.32793 WP_003403442.1.32799 WP_003403442.1.32822 WP_003403442.1.32833 WP_003403442.1.32862 WP_003403442.1.32880 WP_003403442.1.32897 WP_003403442.1.32909 WP_003403442.1.32935 WP_003403442.1.32974 WP_003403442.1.33007 WP_003403442.1.3302 WP_003403442.1.33028 WP_003403442.1.33035 WP_003403442.1.33044 WP_003403442.1.33054 WP_003403442.1.33082 WP_003403442.1.33141 WP_003403442.1.33148 WP_003403442.1.33155 WP_003403442.1.33168 WP_003403442.1.3321 WP_003403442.1.33215 WP_003403442.1.3325 WP_003403442.1.3327 WP_003403442.1.33278 WP_003403442.1.33288 WP_003403442.1.33305 WP_003403442.1.3331 WP_003403442.1.33319 WP_003403442.1.3333 WP_003403442.1.33393 WP_003403442.1.33403 WP_003403442.1.33452 WP_003403442.1.33467 WP_003403442.1.33477 WP_003403442.1.3349 WP_003403442.1.33519 WP_003403442.1.33542 WP_003403442.1.33601 WP_003403442.1.33602 WP_003403442.1.33633 WP_003403442.1.33646 WP_003403442.1.33673 WP_003403442.1.3369 WP_003403442.1.33705 WP_003403442.1.33762 WP_003403442.1.33783 WP_003403442.1.33789 WP_003403442.1.3383 WP_003403442.1.33832 WP_003403442.1.33839 WP_003403442.1.33848 WP_003403442.1.3387 WP_003403442.1.33886 WP_003403442.1.33895 WP_003403442.1.33912 WP_003403442.1.33954 WP_003403442.1.3399 WP_003403442.1.34042 WP_003403442.1.3405 WP_003403442.1.34055 WP_003403442.1.34056 WP_003403442.1.34065 WP_003403442.1.3408 WP_003403442.1.34090 WP_003403442.1.34109 WP_003403442.1.34111 WP_003403442.1.34131 WP_003403442.1.34152 WP_003403442.1.34153 WP_003403442.1.34163 WP_003403442.1.34181 WP_003403442.1.34197 WP_003403442.1.34198 WP_003403442.1.34215 WP_003403442.1.34219 WP_003403442.1.34255 WP_003403442.1.34260 WP_003403442.1.34275 WP_003403442.1.343 WP_003403442.1.34347 WP_003403442.1.34358 WP_003403442.1.34392 WP_003403442.1.344 WP_003403442.1.34428 WP_003403442.1.3443 WP_003403442.1.34435 WP_003403442.1.34446 WP_003403442.1.34499 WP_003403442.1.34505 WP_003403442.1.34516 WP_003403442.1.34529 WP_003403442.1.34551 WP_003403442.1.34563 WP_003403442.1.34576 WP_003403442.1.34581 WP_003403442.1.34588 WP_003403442.1.34596 WP_003403442.1.34599 WP_003403442.1.34639 WP_003403442.1.34673 WP_003403442.1.34724 WP_003403442.1.34740 WP_003403442.1.34755 WP_003403442.1.34777 WP_003403442.1.34783 WP_003403442.1.34841 WP_003403442.1.34908 WP_003403442.1.34919 WP_003403442.1.3492 WP_003403442.1.34933 WP_003403442.1.34945 WP_003403442.1.34946 WP_003403442.1.34954 WP_003403442.1.34960 WP_003403442.1.34961 WP_003403442.1.34963 WP_003403442.1.34965 WP_003403442.1.34968 WP_003403442.1.35023 WP_003403442.1.35069 WP_003403442.1.35072 WP_003403442.1.35078 WP_003403442.1.35100 WP_003403442.1.35146 WP_003403442.1.35156 WP_003403442.1.35160 WP_003403442.1.35162 WP_003403442.1.35173 WP_003403442.1.35176 WP_003403442.1.35213 WP_003403442.1.35221 WP_003403442.1.35246 WP_003403442.1.35278 WP_003403442.1.35301 WP_003403442.1.35311 WP_003403442.1.35312 WP_003403442.1.35317 WP_003403442.1.35319 WP_003403442.1.35347 WP_003403442.1.35363 WP_003403442.1.35382 WP_003403442.1.35385 WP_003403442.1.35396 WP_003403442.1.35397 WP_003403442.1.35426 WP_003403442.1.35439 WP_003403442.1.35455 WP_003403442.1.3548 WP_003403442.1.35484 WP_003403442.1.35492 WP_003403442.1.3553 WP_003403442.1.35553 WP_003403442.1.35555 WP_003403442.1.35561 WP_003403442.1.35602 WP_003403442.1.35610 WP_003403442.1.35635 WP_003403442.1.35657 WP_003403442.1.35680 WP_003403442.1.35687 WP_003403442.1.35689 WP_003403442.1.35707 WP_003403442.1.35732 WP_003403442.1.35754 WP_003403442.1.35767 WP_003403442.1.35770 WP_003403442.1.35771 WP_003403442.1.35780 WP_003403442.1.35805 WP_003403442.1.35811 WP_003403442.1.35821 WP_003403442.1.3584 WP_003403442.1.35848 WP_003403442.1.35864 WP_003403442.1.35874 WP_003403442.1.35876 WP_003403442.1.35897 WP_003403442.1.35899 WP_003403442.1.35923 WP_003403442.1.3593 WP_003403442.1.35954 WP_003403442.1.36005 WP_003403442.1.36014 WP_003403442.1.36023 WP_003403442.1.36051 WP_003403442.1.36053 WP_003403442.1.36075 WP_003403442.1.36089 WP_003403442.1.36097 WP_003403442.1.36098 WP_003403442.1.36116 WP_003403442.1.36145 WP_003403442.1.36156 WP_003403442.1.36205 WP_003403442.1.36228 WP_003403442.1.36246 WP_003403442.1.36252 WP_003403442.1.36260 WP_003403442.1.36270 WP_003403442.1.36271 WP_003403442.1.36303 WP_003403442.1.36309 WP_003403442.1.36315 WP_003403442.1.36319 WP_003403442.1.36321 WP_003403442.1.36326 WP_003403442.1.3634 WP_003403442.1.36356 WP_003403442.1.36357 WP_003403442.1.3636 WP_003403442.1.36385 WP_003403442.1.36399 WP_003403442.1.36436 WP_003403442.1.36465 WP_003403442.1.36469 WP_003403442.1.36473 WP_003403442.1.36485 WP_003403442.1.36508 WP_003403442.1.36540 WP_003403442.1.36561 WP_003403442.1.36571 WP_003403442.1.36573 WP_003403442.1.36578 WP_003403442.1.36585 WP_003403442.1.36597 WP_003403442.1.36614 WP_003403442.1.36657 WP_003403442.1.36674 WP_003403442.1.36720 WP_003403442.1.36727 WP_003403442.1.36733 WP_003403442.1.36785 WP_003403442.1.36810 WP_003403442.1.36844 WP_003403442.1.36851 WP_003403442.1.36862 WP_003403442.1.36893 WP_003403442.1.36901 WP_003403442.1.36921 WP_003403442.1.36935 WP_003403442.1.36941 WP_003403442.1.3695 WP_003403442.1.36951 WP_003403442.1.36968 WP_003403442.1.3700 WP_003403442.1.37004 WP_003403442.1.37012 WP_003403442.1.37071 WP_003403442.1.37088 WP_003403442.1.37131 WP_003403442.1.37157 WP_003403442.1.37175 WP_003403442.1.37188 WP_003403442.1.37213 WP_003403442.1.37229 WP_003403442.1.3724 WP_003403442.1.37277 WP_003403442.1.37305 WP_003403442.1.37330 WP_003403442.1.37389 WP_003403442.1.37400 WP_003403442.1.37440 WP_003403442.1.37459 WP_003403442.1.37468 WP_003403442.1.37475 WP_003403442.1.37484 WP_003403442.1.37601 WP_003403442.1.37612 WP_003403442.1.37632 WP_003403442.1.37643 WP_003403442.1.37655 WP_003403442.1.37660 WP_003403442.1.37674 WP_003403442.1.37700 WP_003403442.1.37701 WP_003403442.1.37709 WP_003403442.1.37711 WP_003403442.1.37721 WP_003403442.1.37722 WP_003403442.1.37747 WP_003403442.1.37765 WP_003403442.1.37772 WP_003403442.1.37804 WP_003403442.1.37809 WP_003403442.1.37859 WP_003403442.1.37877 WP_003403442.1.37912 WP_003403442.1.37913 WP_003403442.1.37943 WP_003403442.1.37950 WP_003403442.1.37973 WP_003403442.1.37975 WP_003403442.1.37983 WP_003403442.1.38 WP_003403442.1.38002 WP_003403442.1.3802 WP_003403442.1.38039 WP_003403442.1.38040 WP_003403442.1.38067 WP_003403442.1.38068 WP_003403442.1.38135 WP_003403442.1.38144 WP_003403442.1.38158 WP_003403442.1.38210 WP_003403442.1.38233 WP_003403442.1.38240 WP_003403442.1.38299 WP_003403442.1.38332 WP_003403442.1.38347 WP_003403442.1.38354 WP_003403442.1.38380 WP_003403442.1.38384 WP_003403442.1.38389 WP_003403442.1.38398 WP_003403442.1.38402 WP_003403442.1.38418 WP_003403442.1.38421 WP_003403442.1.38466 WP_003403442.1.38477 WP_003403442.1.38483 WP_003403442.1.3849 WP_003403442.1.385 WP_003403442.1.38530 WP_003403442.1.38535 WP_003403442.1.38539 WP_003403442.1.38594 WP_003403442.1.38601 WP_003403442.1.38611 WP_003403442.1.38638 WP_003403442.1.38639 WP_003403442.1.38646 WP_003403442.1.38648 WP_003403442.1.38654 WP_003403442.1.38659 WP_003403442.1.38660 WP_003403442.1.38666 WP_003403442.1.38671 WP_003403442.1.38672 WP_003403442.1.38677 WP_003403442.1.38750 WP_003403442.1.38772 WP_003403442.1.38812 WP_003403442.1.38821 WP_003403442.1.38844 WP_003403442.1.38863 WP_003403442.1.38865 WP_003403442.1.38873 WP_003403442.1.3889 WP_003403442.1.38894 WP_003403442.1.38909 WP_003403442.1.38939 WP_003403442.1.38974 WP_003403442.1.38975 WP_003403442.1.38991 WP_003403442.1.39025 WP_003403442.1.39070 WP_003403442.1.39072 WP_003403442.1.39095 WP_003403442.1.39106 WP_003403442.1.39165 WP_003403442.1.39174 WP_003403442.1.39176 WP_003403442.1.39178 WP_003403442.1.39190 WP_003403442.1.39201 WP_003403442.1.39207 WP_003403442.1.39211 WP_003403442.1.39236 WP_003403442.1.39252 WP_003403442.1.39288 WP_003403442.1.39295 WP_003403442.1.39306 WP_003403442.1.39359 WP_003403442.1.39364 WP_003403442.1.39400 WP_003403442.1.39447 WP_003403442.1.3945 WP_003403442.1.39450 WP_003403442.1.39455 WP_003403442.1.3949 WP_003403442.1.39521 WP_003403442.1.39560 WP_003403442.1.39592 WP_003403442.1.39593 WP_003403442.1.396 WP_003403442.1.3960 WP_003403442.1.39616 WP_003403442.1.39654 WP_003403442.1.39657 WP_003403442.1.39661 WP_003403442.1.39674 WP_003403442.1.39678 WP_003403442.1.3968 WP_003403442.1.39694 WP_003403442.1.3971 WP_003403442.1.39718 WP_003403442.1.39728 WP_003403442.1.39739 WP_003403442.1.39748 WP_003403442.1.39751 WP_003403442.1.39759 WP_003403442.1.39801 WP_003403442.1.39804 WP_003403442.1.39848 WP_003403442.1.39877 WP_003403442.1.39925 WP_003403442.1.39959 WP_003403442.1.3996 WP_003403442.1.39960 WP_003403442.1.3997 WP_003403442.1.39980 WP_003403442.1.40000 WP_003403442.1.40028 WP_003403442.1.40029 WP_003403442.1.4003 WP_003403442.1.40094 WP_003403442.1.40096 WP_003403442.1.40150 WP_003403442.1.40156 WP_003403442.1.40174 WP_003403442.1.40186 WP_003403442.1.40276 WP_003403442.1.40277 WP_003403442.1.40323 WP_003403442.1.40336 WP_003403442.1.40353 WP_003403442.1.4036 WP_003403442.1.40372 WP_003403442.1.40402 WP_003403442.1.40413 WP_003403442.1.40440 WP_003403442.1.40446 WP_003403442.1.40451 WP_003403442.1.40455 WP_003403442.1.40523 WP_003403442.1.40641 WP_003403442.1.40646 WP_003403442.1.40651 WP_003403442.1.40653 WP_003403442.1.4067 WP_003403442.1.40705 WP_003403442.1.40723 WP_003403442.1.40735 WP_003403442.1.40795 WP_003403442.1.40799 WP_003403442.1.40852 WP_003403442.1.40876 WP_003403442.1.40881 WP_003403442.1.40922 WP_003403442.1.40948 WP_003403442.1.4095 WP_003403442.1.40956 WP_003403442.1.40957 WP_003403442.1.40964 WP_003403442.1.4097 WP_003403442.1.410 WP_003403442.1.41000 WP_003403442.1.41055 WP_003403442.1.41108 WP_003403442.1.41123 WP_003403442.1.41177 WP_003403442.1.41219 WP_003403442.1.41231 WP_003403442.1.41249 WP_003403442.1.4127 WP_003403442.1.41296 WP_003403442.1.41355 WP_003403442.1.41376 WP_003403442.1.41430 WP_003403442.1.41447 WP_003403442.1.41469 WP_003403442.1.41504 WP_003403442.1.41553 WP_003403442.1.41564 WP_003403442.1.41583 WP_003403442.1.41616 WP_003403442.1.41632 WP_003403442.1.41635 WP_003403442.1.41636 WP_003403442.1.41648 WP_003403442.1.41660 WP_003403442.1.41685 WP_003403442.1.41695 WP_003403442.1.41704 WP_003403442.1.41719 WP_003403442.1.41733 WP_003403442.1.41744 WP_003403442.1.41774 WP_003403442.1.41791 WP_003403442.1.41803 WP_003403442.1.41820 WP_003403442.1.41828 WP_003403442.1.41829 WP_003403442.1.41860 WP_003403442.1.41912 WP_003403442.1.41921 WP_003403442.1.41933 WP_003403442.1.41944 WP_003403442.1.42043 WP_003403442.1.42075 WP_003403442.1.42078 WP_003403442.1.42094 WP_003403442.1.42112 WP_003403442.1.42122 WP_003403442.1.42134 WP_003403442.1.42183 WP_003403442.1.42188 WP_003403442.1.42201 WP_003403442.1.42202 WP_003403442.1.42208 WP_003403442.1.42247 WP_003403442.1.42255 WP_003403442.1.42273 WP_003403442.1.42278 WP_003403442.1.42304 WP_003403442.1.42309 WP_003403442.1.42370 WP_003403442.1.42385 WP_003403442.1.42400 WP_003403442.1.42409 WP_003403442.1.42414 WP_003403442.1.42417 WP_003403442.1.42430 WP_003403442.1.42461 WP_003403442.1.42465 WP_003403442.1.42467 WP_003403442.1.42473 WP_003403442.1.42474 WP_003403442.1.4248 WP_003403442.1.42494 WP_003403442.1.42519 WP_003403442.1.42534 WP_003403442.1.4255 WP_003403442.1.42562 WP_003403442.1.42568 WP_003403442.1.42570 WP_003403442.1.42618 WP_003403442.1.42660 WP_003403442.1.42695 WP_003403442.1.42704 WP_003403442.1.42705 WP_003403442.1.42722 WP_003403442.1.42777 WP_003403442.1.42782 WP_003403442.1.42835 WP_003403442.1.42839 WP_003403442.1.42842 WP_003403442.1.42905 WP_003403442.1.42916 WP_003403442.1.42930 WP_003403442.1.42971 WP_003403442.1.43005 WP_003403442.1.43009 WP_003403442.1.43053 WP_003403442.1.43082 WP_003403442.1.43087 WP_003403442.1.43098 WP_003403442.1.43208 WP_003403442.1.43236 WP_003403442.1.43246 WP_003403442.1.43255 WP_003403442.1.43266 WP_003403442.1.43273 WP_003403442.1.43296 WP_003403442.1.4335 WP_003403442.1.43368 WP_003403442.1.43395 WP_003403442.1.43457 WP_003403442.1.43462 WP_003403442.1.43475 WP_003403442.1.43478 WP_003403442.1.43484 WP_003403442.1.43557 WP_003403442.1.43578 WP_003403442.1.43588 WP_003403442.1.43643 WP_003403442.1.43664 WP_003403442.1.43684 WP_003403442.1.43686 WP_003403442.1.43706 WP_003403442.1.43716 WP_003403442.1.4377 WP_003403442.1.43781 WP_003403442.1.43794 WP_003403442.1.43815 WP_003403442.1.43846 WP_003403442.1.43861 WP_003403442.1.43863 WP_003403442.1.43866 WP_003403442.1.43872 WP_003403442.1.43885 WP_003403442.1.43897 WP_003403442.1.4390 WP_003403442.1.43902 WP_003403442.1.43921 WP_003403442.1.43936 WP_003403442.1.43937 WP_003403442.1.43960 WP_003403442.1.43965 WP_003403442.1.4399 WP_003403442.1.43993 WP_003403442.1.43996 WP_003403442.1.44 WP_003403442.1.44008 WP_003403442.1.44016 WP_003403442.1.44033 WP_003403442.1.44037 WP_003403442.1.44041 WP_003403442.1.44070 WP_003403442.1.44071 WP_003403442.1.44076 WP_003403442.1.44104 WP_003403442.1.44111 WP_003403442.1.44124 WP_003403442.1.44169 WP_003403442.1.44219 WP_003403442.1.44237 WP_003403442.1.44277 WP_003403442.1.44279 WP_003403442.1.44336 WP_003403442.1.44355 WP_003403442.1.44358 WP_003403442.1.4438 WP_003403442.1.44390 WP_003403442.1.44392 WP_003403442.1.4441 WP_003403442.1.44415 WP_003403442.1.44464 WP_003403442.1.44466 WP_003403442.1.44489 WP_003403442.1.44492 WP_003403442.1.44494 WP_003403442.1.44500 WP_003403442.1.44519 WP_003403442.1.44526 WP_003403442.1.44532 WP_003403442.1.44534 WP_003403442.1.44562 WP_003403442.1.44589 WP_003403442.1.44597 WP_003403442.1.44600 WP_003403442.1.44602 WP_003403442.1.44615 WP_003403442.1.4464 WP_003403442.1.44651 WP_003403442.1.44659 WP_003403442.1.44665 WP_003403442.1.44694 WP_003403442.1.44700 WP_003403442.1.44713 WP_003403442.1.44735 WP_003403442.1.44740 WP_003403442.1.44757 WP_003403442.1.4476 WP_003403442.1.44761 WP_003403442.1.44767 WP_003403442.1.44776 WP_003403442.1.44786 WP_003403442.1.44864 WP_003403442.1.44901 WP_003403442.1.44908 WP_003403442.1.44913 WP_003403442.1.4492 WP_003403442.1.44939 WP_003403442.1.44979 WP_003403442.1.44981 WP_003403442.1.45002 WP_003403442.1.45011 WP_003403442.1.4504 WP_003403442.1.45062 WP_003403442.1.45066 WP_003403442.1.45081 WP_003403442.1.45113 WP_003403442.1.45129 WP_003403442.1.45135 WP_003403442.1.45147 WP_003403442.1.45168 WP_003403442.1.4517 WP_003403442.1.45181 WP_003403442.1.45185 WP_003403442.1.45192 WP_003403442.1.45200 WP_003403442.1.45205 WP_003403442.1.45211 WP_003403442.1.45249 WP_003403442.1.4526 WP_003403442.1.45286 WP_003403442.1.45326 WP_003403442.1.45347 WP_003403442.1.45374 WP_003403442.1.45390 WP_003403442.1.454 WP_003403442.1.45407 WP_003403442.1.45451 WP_003403442.1.45453 WP_003403442.1.45460 WP_003403442.1.45463 WP_003403442.1.45470 WP_003403442.1.45474 WP_003403442.1.45491 WP_003403442.1.45510 WP_003403442.1.45563 WP_003403442.1.45584 WP_003403442.1.45590 WP_003403442.1.45619 WP_003403442.1.45626 WP_003403442.1.45631 WP_003403442.1.45666 WP_003403442.1.45697 WP_003403442.1.4571 WP_003403442.1.45731 WP_003403442.1.45765 WP_003403442.1.45776 WP_003403442.1.45783 WP_003403442.1.45805 WP_003403442.1.45815 WP_003403442.1.45849 WP_003403442.1.45867 WP_003403442.1.45884 WP_003403442.1.4590 WP_003403442.1.45923 WP_003403442.1.45926 WP_003403442.1.45989 WP_003403442.1.45992 WP_003403442.1.46083 WP_003403442.1.46090 WP_003403442.1.46092 WP_003403442.1.46100 WP_003403442.1.46101 WP_003403442.1.46103 WP_003403442.1.46107 WP_003403442.1.46128 WP_003403442.1.46129 WP_003403442.1.46141 WP_003403442.1.46150 WP_003403442.1.46201 WP_003403442.1.46226 WP_003403442.1.4624 WP_003403442.1.46253 WP_003403442.1.46268 WP_003403442.1.46285 WP_003403442.1.46300 WP_003403442.1.46313 WP_003403442.1.46336 WP_003403442.1.46365 WP_003403442.1.46370 WP_003403442.1.46381 WP_003403442.1.46402 WP_003403442.1.46411 WP_003403442.1.4644 WP_003403442.1.46442 WP_003403442.1.46453 WP_003403442.1.46463 WP_003403442.1.46478 WP_003403442.1.46492 WP_003403442.1.46521 WP_003403442.1.4653 WP_003403442.1.46532 WP_003403442.1.46539 WP_003403442.1.46568 WP_003403442.1.46585 WP_003403442.1.46609 WP_003403442.1.46613 WP_003403442.1.46625 WP_003403442.1.46642 WP_003403442.1.46647 WP_003403442.1.46674 WP_003403442.1.46724 WP_003403442.1.46758 WP_003403442.1.46773 WP_003403442.1.46777 WP_003403442.1.46786 WP_003403442.1.46792 WP_003403442.1.46847 WP_003403442.1.46851 WP_003403442.1.4687 WP_003403442.1.46897 WP_003403442.1.46936 WP_003403442.1.47011 WP_003403442.1.47012 WP_003403442.1.47066 WP_003403442.1.47077 WP_003403442.1.47083 WP_003403442.1.47106 WP_003403442.1.47142 WP_003403442.1.47147 WP_003403442.1.47166 WP_003403442.1.47178 WP_003403442.1.47179 WP_003403442.1.47194 WP_003403442.1.47207 WP_003403442.1.47210 WP_003403442.1.47261 WP_003403442.1.47262 WP_003403442.1.47402 WP_003403442.1.47423 WP_003403442.1.47467 WP_003403442.1.47468 WP_003403442.1.47502 WP_003403442.1.4751 WP_003403442.1.47511 WP_003403442.1.47537 WP_003403442.1.47540 WP_003403442.1.47568 WP_003403442.1.47572 WP_003403442.1.47588 WP_003403442.1.47636 WP_003403442.1.4764 WP_003403442.1.47653 WP_003403442.1.47679 WP_003403442.1.47681 WP_003403442.1.47690 WP_003403442.1.4771 WP_003403442.1.47717 WP_003403442.1.47754 WP_003403442.1.47773 WP_003403442.1.47776 WP_003403442.1.47780 WP_003403442.1.47805 WP_003403442.1.47832 WP_003403442.1.47847 WP_003403442.1.47861 WP_003403442.1.47868 WP_003403442.1.47893 WP_003403442.1.47899 WP_003403442.1.479 WP_003403442.1.47912 WP_003403442.1.47913 WP_003403442.1.47926 WP_003403442.1.4794 WP_003403442.1.47943 WP_003403442.1.47944 WP_003403442.1.47959 WP_003403442.1.47974 WP_003403442.1.47993 WP_003403442.1.48004 WP_003403442.1.48039 WP_003403442.1.48050 WP_003403442.1.48084 WP_003403442.1.48097 WP_003403442.1.48101 WP_003403442.1.48109 WP_003403442.1.4813 WP_003403442.1.48130 WP_003403442.1.48135 WP_003403442.1.48143 WP_003403442.1.48152 WP_003403442.1.48155 WP_003403442.1.48170 WP_003403442.1.48173 WP_003403442.1.48177 WP_003403442.1.48185 WP_003403442.1.48204 WP_003403442.1.48219 WP_003403442.1.4823 WP_003403442.1.48240 WP_003403442.1.48256 WP_003403442.1.48264 WP_003403442.1.48287 WP_003403442.1.48330 WP_003403442.1.48333 WP_003403442.1.48348 WP_003403442.1.48354 WP_003403442.1.48372 WP_003403442.1.48383 WP_003403442.1.48388 WP_003403442.1.48419 WP_003403442.1.48423 WP_003403442.1.48443 WP_003403442.1.48450 WP_003403442.1.48462 WP_003403442.1.48543 WP_003403442.1.48550 WP_003403442.1.48605 WP_003403442.1.48618 WP_003403442.1.4863 WP_003403442.1.48648 WP_003403442.1.48658 WP_003403442.1.48666 WP_003403442.1.48687 WP_003403442.1.48779 WP_003403442.1.4878 WP_003403442.1.48798 WP_003403442.1.48802 WP_003403442.1.48826 WP_003403442.1.48831 WP_003403442.1.48843 WP_003403442.1.48857 WP_003403442.1.4890 WP_003403442.1.48946 WP_003403442.1.48979 WP_003403442.1.49017 WP_003403442.1.49048 WP_003403442.1.49059 WP_003403442.1.4906 WP_003403442.1.4907 WP_003403442.1.49103 WP_003403442.1.49110 WP_003403442.1.49111 WP_003403442.1.49112 WP_003403442.1.4919 WP_003403442.1.49251 WP_003403442.1.49254 WP_003403442.1.49263 WP_003403442.1.49291 WP_003403442.1.49296 WP_003403442.1.49335 WP_003403442.1.49337 WP_003403442.1.49419 WP_003403442.1.49426 WP_003403442.1.49437 WP_003403442.1.49439 WP_003403442.1.49474 WP_003403442.1.49506 WP_003403442.1.49516 WP_003403442.1.49523 WP_003403442.1.49526 WP_003403442.1.49532 WP_003403442.1.49588 WP_003403442.1.4959 WP_003403442.1.49678 WP_003403442.1.49687 WP_003403442.1.49699 WP_003403442.1.49709 WP_003403442.1.4971 WP_003403442.1.4972 WP_003403442.1.49736 WP_003403442.1.49746 WP_003403442.1.49764 WP_003403442.1.49773 WP_003403442.1.49796 WP_003403442.1.49814 WP_003403442.1.49815 WP_003403442.1.49816 WP_003403442.1.49839 WP_003403442.1.49857 WP_003403442.1.49878 WP_003403442.1.49880 WP_003403442.1.49944 WP_003403442.1.4999 WP_003403442.1.49990 WP_003403442.1.50068 WP_003403442.1.50077 WP_003403442.1.5008 WP_003403442.1.50081 WP_003403442.1.50122 WP_003403442.1.50126 WP_003403442.1.50149 WP_003403442.1.50162 WP_003403442.1.5018 WP_003403442.1.50194 WP_003403442.1.50218 WP_003403442.1.50235 WP_003403442.1.50249 WP_003403442.1.50265 WP_003403442.1.50271 WP_003403442.1.50324 WP_003403442.1.50347 WP_003403442.1.50372 WP_003403442.1.50398 WP_003403442.1.50407 WP_003403442.1.50444 WP_003403442.1.50466 WP_003403442.1.50472 WP_003403442.1.5048 WP_003403442.1.50498 WP_003403442.1.5050 WP_003403442.1.50540 WP_003403442.1.50554 WP_003403442.1.50557 WP_003403442.1.50601 WP_003403442.1.50610 WP_003403442.1.50632 WP_003403442.1.50633 WP_003403442.1.50642 WP_003403442.1.50655 WP_003403442.1.50659 WP_003403442.1.50683 WP_003403442.1.50689 WP_003403442.1.50692 WP_003403442.1.50714 WP_003403442.1.50729 WP_003403442.1.50756 WP_003403442.1.50784 WP_003403442.1.50794 WP_003403442.1.50841 WP_003403442.1.50860 WP_003403442.1.50868 WP_003403442.1.50877 WP_003403442.1.5096 WP_003403442.1.50981 WP_003403442.1.50987 WP_003403442.1.51003 WP_003403442.1.51009 WP_003403442.1.51037 WP_003403442.1.51074 WP_003403442.1.51082 WP_003403442.1.51101 WP_003403442.1.51116 WP_003403442.1.51149 WP_003403442.1.51156 WP_003403442.1.51157 WP_003403442.1.51213 WP_003403442.1.51232 WP_003403442.1.51239 WP_003403442.1.51247 WP_003403442.1.51266 WP_003403442.1.51279 WP_003403442.1.51291 WP_003403442.1.51294 WP_003403442.1.51301 WP_003403442.1.51329 WP_003403442.1.51391 WP_003403442.1.51422 WP_003403442.1.51445 WP_003403442.1.51455 WP_003403442.1.51466 WP_003403442.1.51468 WP_003403442.1.51478 WP_003403442.1.51497 WP_003403442.1.51520 WP_003403442.1.51593 WP_003403442.1.51628 WP_003403442.1.5164 WP_003403442.1.51647 WP_003403442.1.51660 WP_003403442.1.51696 WP_003403442.1.51721 WP_003403442.1.51795 WP_003403442.1.51801 WP_003403442.1.51817 WP_003403442.1.51819 WP_003403442.1.51854 WP_003403442.1.51923 WP_003403442.1.51942 WP_003403442.1.51948 WP_003403442.1.51963 WP_003403442.1.51969 WP_003403442.1.52000 WP_003403442.1.52001 WP_003403442.1.52003 WP_003403442.1.52006 WP_003403442.1.52036 WP_003403442.1.52038 WP_003403442.1.52046 WP_003403442.1.52059 WP_003403442.1.52069 WP_003403442.1.52082 WP_003403442.1.52102 WP_003403442.1.52106 WP_003403442.1.52166 WP_003403442.1.52168 WP_003403442.1.52178 WP_003403442.1.52206 WP_003403442.1.52216 WP_003403442.1.52238 WP_003403442.1.52241 WP_003403442.1.52280 WP_003403442.1.52314 WP_003403442.1.52385 WP_003403442.1.52390 WP_003403442.1.524 WP_003403442.1.52460 WP_003403442.1.52485 WP_003403442.1.52486 WP_003403442.1.52495 WP_003403442.1.52504 WP_003403442.1.52522 WP_003403442.1.52531 WP_003403442.1.52533 WP_003403442.1.52545 WP_003403442.1.52553 WP_003403442.1.52563 WP_003403442.1.52564 WP_003403442.1.52574 WP_003403442.1.52641 WP_003403442.1.52673 WP_003403442.1.52674 WP_003403442.1.52708 WP_003403442.1.52713 WP_003403442.1.52761 WP_003403442.1.52778 WP_003403442.1.52791 WP_003403442.1.52797 WP_003403442.1.52872 WP_003403442.1.52873 WP_003403442.1.52891 WP_003403442.1.52892 WP_003403442.1.52909 WP_003403442.1.52970 WP_003403442.1.52998 WP_003403442.1.53053 WP_003403442.1.53056 WP_003403442.1.5306 WP_003403442.1.53088 WP_003403442.1.5309 WP_003403442.1.531 WP_003403442.1.53117 WP_003403442.1.53118 WP_003403442.1.53142 WP_003403442.1.53143 WP_003403442.1.53157 WP_003403442.1.53167 WP_003403442.1.53200 WP_003403442.1.53204 WP_003403442.1.53213 WP_003403442.1.53217 WP_003403442.1.53226 WP_003403442.1.53230 WP_003403442.1.53237 WP_003403442.1.53254 WP_003403442.1.53257 WP_003403442.1.5327 WP_003403442.1.53276 WP_003403442.1.53278 WP_003403442.1.533 WP_003403442.1.53302 WP_003403442.1.53306 WP_003403442.1.5334 WP_003403442.1.5335 WP_003403442.1.53353 WP_003403442.1.53381 WP_003403442.1.53413 WP_003403442.1.53458 WP_003403442.1.53460 WP_003403442.1.53480 WP_003403442.1.53517 WP_003403442.1.53522 WP_003403442.1.53525 WP_003403442.1.53526 WP_003403442.1.53553 WP_003403442.1.53606 WP_003403442.1.53609 WP_003403442.1.53628 WP_003403442.1.53643 WP_003403442.1.53667 WP_003403442.1.53679 WP_003403442.1.53715 WP_003403442.1.53730 WP_003403442.1.53742 WP_003403442.1.53743 WP_003403442.1.53754 WP_003403442.1.53775 WP_003403442.1.53787 WP_003403442.1.53803 WP_003403442.1.53818 WP_003403442.1.53822 WP_003403442.1.53853 WP_003403442.1.53865 WP_003403442.1.53888 WP_003403442.1.53900 WP_003403442.1.53912 WP_003403442.1.53914 WP_003403442.1.53952 WP_003403442.1.5398 WP_003403442.1.5408 WP_003403442.1.54089 WP_003403442.1.54093 WP_003403442.1.54112 WP_003403442.1.54125 WP_003403442.1.54141 WP_003403442.1.54162 WP_003403442.1.54179 WP_003403442.1.54206 WP_003403442.1.54218 WP_003403442.1.54225 WP_003403442.1.54227 WP_003403442.1.54232 WP_003403442.1.54241 WP_003403442.1.54245 WP_003403442.1.54247 WP_003403442.1.54260 WP_003403442.1.54275 WP_003403442.1.54280 WP_003403442.1.54294 WP_003403442.1.54314 WP_003403442.1.54347 WP_003403442.1.54351 WP_003403442.1.54370 WP_003403442.1.54428 WP_003403442.1.54449 WP_003403442.1.54494 WP_003403442.1.54502 WP_003403442.1.54514 WP_003403442.1.54519 WP_003403442.1.5452 WP_003403442.1.54531 WP_003403442.1.54537 WP_003403442.1.54553 WP_003403442.1.54555 WP_003403442.1.54575 WP_003403442.1.54633 WP_003403442.1.54686 WP_003403442.1.54687 WP_003403442.1.54705 WP_003403442.1.54730 WP_003403442.1.54732 WP_003403442.1.5475 WP_003403442.1.54797 WP_003403442.1.54807 WP_003403442.1.54836 WP_003403442.1.54838 WP_003403442.1.54860 WP_003403442.1.54888 WP_003403442.1.54897 WP_003403442.1.54905 WP_003403442.1.54909 WP_003403442.1.54937 WP_003403442.1.54939 WP_003403442.1.54944 WP_003403442.1.54945 WP_003403442.1.54953 WP_003403442.1.54964 WP_003403442.1.55015 WP_003403442.1.55022 WP_003403442.1.55023 WP_003403442.1.55051 WP_003403442.1.55072 WP_003403442.1.55088 WP_003403442.1.55106 WP_003403442.1.55126 WP_003403442.1.55140 WP_003403442.1.55150 WP_003403442.1.55210 WP_003403442.1.55227 WP_003403442.1.55248 WP_003403442.1.55257 WP_003403442.1.55258 WP_003403442.1.55267 WP_003403442.1.55279 WP_003403442.1.55307 WP_003403442.1.55326 WP_003403442.1.55328 WP_003403442.1.5533 WP_003403442.1.55345 WP_003403442.1.55396 WP_003403442.1.55398 WP_003403442.1.55459 WP_003403442.1.55501 WP_003403442.1.55504 WP_003403442.1.55578 WP_003403442.1.55626 WP_003403442.1.55641 WP_003403442.1.5569 WP_003403442.1.55723 WP_003403442.1.55735 WP_003403442.1.5574 WP_003403442.1.55772 WP_003403442.1.55802 WP_003403442.1.55807 WP_003403442.1.55819 WP_003403442.1.55821 WP_003403442.1.5583 WP_003403442.1.55849 WP_003403442.1.55856 WP_003403442.1.55860 WP_003403442.1.55882 WP_003403442.1.55883 WP_003403442.1.55894 WP_003403442.1.55902 WP_003403442.1.55909 WP_003403442.1.5591 WP_003403442.1.55961 WP_003403442.1.55977 WP_003403442.1.55983 WP_003403442.1.56028 WP_003403442.1.56057 WP_003403442.1.56060 WP_003403442.1.56107 WP_003403442.1.56132 WP_003403442.1.56163 WP_003403442.1.56167 WP_003403442.1.56178 WP_003403442.1.56287 WP_003403442.1.56292 WP_003403442.1.56327 WP_003403442.1.56341 WP_003403442.1.56359 WP_003403442.1.56365 WP_003403442.1.56394 WP_003403442.1.56443 WP_003403442.1.56473 WP_003403442.1.56478 WP_003403442.1.56500 WP_003403442.1.56517 WP_003403442.1.56534 WP_003403442.1.5656 WP_003403442.1.56577 WP_003403442.1.56593 WP_003403442.1.56625 WP_003403442.1.56637 WP_003403442.1.56670 WP_003403442.1.56697 WP_003403442.1.567 WP_003403442.1.56701 WP_003403442.1.56709 WP_003403442.1.56729 WP_003403442.1.56743 WP_003403442.1.56755 WP_003403442.1.56764 WP_003403442.1.56769 WP_003403442.1.56770 WP_003403442.1.56795 WP_003403442.1.5681 WP_003403442.1.56827 WP_003403442.1.56839 WP_003403442.1.56863 WP_003403442.1.56869 WP_003403442.1.56915 WP_003403442.1.56926 WP_003403442.1.56961 WP_003403442.1.56971 WP_003403442.1.56972 WP_003403442.1.57023 WP_003403442.1.57077 WP_003403442.1.57087 WP_003403442.1.57094 WP_003403442.1.57134 WP_003403442.1.57151 WP_003403442.1.57169 WP_003403442.1.57208 WP_003403442.1.57212 WP_003403442.1.57230 WP_003403442.1.5724 WP_003403442.1.5725 WP_003403442.1.5727 WP_003403442.1.57273 WP_003403442.1.573 WP_003403442.1.57314 WP_003403442.1.57326 WP_003403442.1.57328 WP_003403442.1.57331 WP_003403442.1.57340 WP_003403442.1.57351 WP_003403442.1.57352 WP_003403442.1.57380 WP_003403442.1.57430 WP_003403442.1.5744 WP_003403442.1.57440 WP_003403442.1.5745 WP_003403442.1.57461 WP_003403442.1.57489 WP_003403442.1.575 WP_003403442.1.57509 WP_003403442.1.57519 WP_003403442.1.57525 WP_003403442.1.57551 WP_003403442.1.5758 WP_003403442.1.57596 WP_003403442.1.57604 WP_003403442.1.57616 WP_003403442.1.57617 WP_003403442.1.57619 WP_003403442.1.57627 WP_003403442.1.57642 WP_003403442.1.57658 WP_003403442.1.57667 WP_003403442.1.57675 WP_003403442.1.57689 WP_003403442.1.57708 WP_003403442.1.57794 WP_003403442.1.57821 WP_003403442.1.57825 WP_003403442.1.57843 WP_003403442.1.57906 WP_003403442.1.57924 WP_003403442.1.57926 WP_003403442.1.57930 WP_003403442.1.57957 WP_003403442.1.57960 WP_003403442.1.57964 WP_003403442.1.57991 WP_003403442.1.58000 WP_003403442.1.58086 WP_003403442.1.58101 WP_003403442.1.58103 WP_003403442.1.58108 WP_003403442.1.58121 WP_003403442.1.58145 WP_003403442.1.58164 WP_003403442.1.58174 WP_003403442.1.582 WP_003403442.1.58202 WP_003403442.1.58209 WP_003403442.1.58215 WP_003403442.1.5824 WP_003403442.1.58250 WP_003403442.1.58259 WP_003403442.1.58283 WP_003403442.1.58288 WP_003403442.1.5830 WP_003403442.1.58303 WP_003403442.1.58311 WP_003403442.1.58330 WP_003403442.1.58359 WP_003403442.1.58386 WP_003403442.1.58393 WP_003403442.1.58431 WP_003403442.1.5844 WP_003403442.1.58457 WP_003403442.1.58488 WP_003403442.1.58518 WP_003403442.1.58534 WP_003403442.1.58559 WP_003403442.1.58567 WP_003403442.1.58573 WP_003403442.1.58602 WP_003403442.1.58612 WP_003403442.1.58619 WP_003403442.1.58630 WP_003403442.1.5865 WP_003403442.1.58671 WP_003403442.1.58690 WP_003403442.1.58702 WP_003403442.1.58743 WP_003403442.1.5879 WP_003403442.1.5881 WP_003403442.1.58824 WP_003403442.1.58848 WP_003403442.1.58857 WP_003403442.1.58891 WP_003403442.1.58892 WP_003403442.1.5890 WP_003403442.1.58921 WP_003403442.1.58930 WP_003403442.1.58939 WP_003403442.1.58941 WP_003403442.1.58953 WP_003403442.1.58961 WP_003403442.1.5898 WP_003403442.1.59025 WP_003403442.1.59029 WP_003403442.1.59037 WP_003403442.1.59044 WP_003403442.1.59085 WP_003403442.1.59088 WP_003403442.1.59112 WP_003403442.1.59130 WP_003403442.1.5914 WP_003403442.1.59147 WP_003403442.1.59166 WP_003403442.1.59205 WP_003403442.1.59209 WP_003403442.1.59237 WP_003403442.1.59240 WP_003403442.1.59253 WP_003403442.1.59254 WP_003403442.1.59262 WP_003403442.1.59270 WP_003403442.1.5928 WP_003403442.1.59304 WP_003403442.1.59305 WP_003403442.1.59309 WP_003403442.1.59316 WP_003403442.1.59326 WP_003403442.1.59328 WP_003403442.1.59333 WP_003403442.1.59338 WP_003403442.1.59388 WP_003403442.1.59428 WP_003403442.1.59487 WP_003403442.1.59537 WP_003403442.1.59561 WP_003403442.1.59677 WP_003403442.1.59722 WP_003403442.1.59727 WP_003403442.1.59732 WP_003403442.1.59738 WP_003403442.1.59750 WP_003403442.1.59761 WP_003403442.1.59808 WP_003403442.1.59850 WP_003403442.1.59856 WP_003403442.1.59860 WP_003403442.1.59861 WP_003403442.1.5987 WP_003403442.1.59878 WP_003403442.1.59888 WP_003403442.1.59952 WP_003403442.1.5996 WP_003403442.1.59961 WP_003403442.1.59974 WP_003403442.1.6000 WP_003403442.1.60007 WP_003403442.1.60016 WP_003403442.1.6003 WP_003403442.1.60047 WP_003403442.1.6007 WP_003403442.1.60121 WP_003403442.1.60125 WP_003403442.1.60135 WP_003403442.1.60139 WP_003403442.1.60152 WP_003403442.1.60171 WP_003403442.1.60197 WP_003403442.1.6020 WP_003403442.1.60205 WP_003403442.1.60207 WP_003403442.1.60215 WP_003403442.1.60217 WP_003403442.1.60267 WP_003403442.1.60288 WP_003403442.1.60291 WP_003403442.1.60305 WP_003403442.1.60312 WP_003403442.1.60313 WP_003403442.1.60314 WP_003403442.1.60367 WP_003403442.1.60376 WP_003403442.1.60403 WP_003403442.1.60413 WP_003403442.1.60421 WP_003403442.1.60451 WP_003403442.1.60460 WP_003403442.1.60487 WP_003403442.1.60512 WP_003403442.1.60573 WP_003403442.1.60583 WP_003403442.1.60632 WP_003403442.1.60657 WP_003403442.1.60687 WP_003403442.1.60689 WP_003403442.1.60727 WP_003403442.1.60738 WP_003403442.1.60763 WP_003403442.1.6077 WP_003403442.1.60791 WP_003403442.1.60834 WP_003403442.1.60870 WP_003403442.1.60878 WP_003403442.1.60879 WP_003403442.1.60978 WP_003403442.1.61000 WP_003403442.1.61012 WP_003403442.1.61014 WP_003403442.1.61015 WP_003403442.1.61037 WP_003403442.1.61052 WP_003403442.1.61065 WP_003403442.1.61100 WP_003403442.1.61101 WP_003403442.1.61138 WP_003403442.1.61142 WP_003403442.1.61198 WP_003403442.1.612 WP_003403442.1.61234 WP_003403442.1.61256 WP_003403442.1.61281 WP_003403442.1.61314 WP_003403442.1.61321 WP_003403442.1.61326 WP_003403442.1.61328 WP_003403442.1.61368 WP_003403442.1.61391 WP_003403442.1.61406 WP_003403442.1.61409 WP_003403442.1.61420 WP_003403442.1.61422 WP_003403442.1.61425 WP_003403442.1.61428 WP_003403442.1.61469 WP_003403442.1.61494 WP_003403442.1.61522 WP_003403442.1.61552 WP_003403442.1.61557 WP_003403442.1.61567 WP_003403442.1.61571 WP_003403442.1.61573 WP_003403442.1.61584 WP_003403442.1.61586 WP_003403442.1.6159 WP_003403442.1.61592 WP_003403442.1.6160 WP_003403442.1.61614 WP_003403442.1.6163 WP_003403442.1.61655 WP_003403442.1.61665 WP_003403442.1.61669 WP_003403442.1.61682 WP_003403442.1.61692 WP_003403442.1.61719 WP_003403442.1.61728 WP_003403442.1.61750 WP_003403442.1.61754 WP_003403442.1.61755 WP_003403442.1.61757 WP_003403442.1.61778 WP_003403442.1.6179 WP_003403442.1.61793 WP_003403442.1.61816 WP_003403442.1.61842 WP_003403442.1.61850 WP_003403442.1.61862 WP_003403442.1.61865 WP_003403442.1.61868 WP_003403442.1.61911 WP_003403442.1.61925 WP_003403442.1.61941 WP_003403442.1.61953 WP_003403442.1.61979 WP_003403442.1.61986 WP_003403442.1.61987 WP_003403442.1.61998 WP_003403442.1.62021 WP_003403442.1.62087 WP_003403442.1.62089 WP_003403442.1.62101 WP_003403442.1.62104 WP_003403442.1.6211 WP_003403442.1.62132 WP_003403442.1.62162 WP_003403442.1.62225 WP_003403442.1.62230 WP_003403442.1.62238 WP_003403442.1.62249 WP_003403442.1.62270 WP_003403442.1.62281 WP_003403442.1.62307 WP_003403442.1.6231 WP_003403442.1.62359 WP_003403442.1.62360 WP_003403442.1.62371 WP_003403442.1.62379 WP_003403442.1.62395 WP_003403442.1.62408 WP_003403442.1.62449 WP_003403442.1.62468 WP_003403442.1.6248 WP_003403442.1.62508 WP_003403442.1.62594 WP_003403442.1.62606 WP_003403442.1.62616 WP_003403442.1.62666 WP_003403442.1.62687 WP_003403442.1.62715 WP_003403442.1.62730 WP_003403442.1.62761 WP_003403442.1.62766 WP_003403442.1.62786 WP_003403442.1.62813 WP_003403442.1.62839 WP_003403442.1.62841 WP_003403442.1.62909 WP_003403442.1.62936 WP_003403442.1.6294 WP_003403442.1.6295 WP_003403442.1.62962 WP_003403442.1.63007 WP_003403442.1.63019 WP_003403442.1.63032 WP_003403442.1.63037 WP_003403442.1.63064 WP_003403442.1.63066 WP_003403442.1.63072 WP_003403442.1.6308 WP_003403442.1.63081 WP_003403442.1.63096 WP_003403442.1.63106 WP_003403442.1.6314 WP_003403442.1.63144 WP_003403442.1.63154 WP_003403442.1.63160 WP_003403442.1.63161 WP_003403442.1.63166 WP_003403442.1.63175 WP_003403442.1.63194 WP_003403442.1.6322 WP_003403442.1.63222 WP_003403442.1.63247 WP_003403442.1.6328 WP_003403442.1.63291 WP_003403442.1.63312 WP_003403442.1.63317 WP_003403442.1.63331 WP_003403442.1.63373 WP_003403442.1.63384 WP_003403442.1.63403 WP_003403442.1.63424 WP_003403442.1.63428 WP_003403442.1.6345 WP_003403442.1.63464 WP_003403442.1.63483 WP_003403442.1.63502 WP_003403442.1.63504 WP_003403442.1.63522 WP_003403442.1.63530 WP_003403442.1.63538 WP_003403442.1.63564 WP_003403442.1.63567 WP_003403442.1.63596 WP_003403442.1.63600 WP_003403442.1.63623 WP_003403442.1.63624 WP_003403442.1.63625 WP_003403442.1.63627 WP_003403442.1.63654 WP_003403442.1.63662 WP_003403442.1.63711 WP_003403442.1.63734 WP_003403442.1.63807 WP_003403442.1.63819 WP_003403442.1.63844 WP_003403442.1.63888 WP_003403442.1.63913 WP_003403442.1.63915 WP_003403442.1.63918 WP_003403442.1.63961 WP_003403442.1.63970 WP_003403442.1.64000 WP_003403442.1.64027 WP_003403442.1.64058 WP_003403442.1.6407 WP_003403442.1.64082 WP_003403442.1.64091 WP_003403442.1.64102 WP_003403442.1.64104 WP_003403442.1.64119 WP_003403442.1.64169 WP_003403442.1.64219 WP_003403442.1.6422 WP_003403442.1.64222 WP_003403442.1.64223 WP_003403442.1.64228 WP_003403442.1.64235 WP_003403442.1.64249 WP_003403442.1.6427 WP_003403442.1.64278 WP_003403442.1.64287 WP_003403442.1.64414 WP_003403442.1.64419 WP_003403442.1.6443 WP_003403442.1.64463 WP_003403442.1.64480 WP_003403442.1.64497 WP_003403442.1.64506 WP_003403442.1.64511 WP_003403442.1.64513 WP_003403442.1.64514 WP_003403442.1.64515 WP_003403442.1.64522 WP_003403442.1.64526 WP_003403442.1.64543 WP_003403442.1.64567 WP_003403442.1.64588 WP_003403442.1.64589 WP_003403442.1.64594 WP_003403442.1.64595 WP_003403442.1.64608 WP_003403442.1.64619 WP_003403442.1.64629 WP_003403442.1.6464 WP_003403442.1.64664 WP_003403442.1.64669 WP_003403442.1.64672 WP_003403442.1.64680 WP_003403442.1.64682 WP_003403442.1.64727 WP_003403442.1.64729 WP_003403442.1.64774 WP_003403442.1.64776 WP_003403442.1.64802 WP_003403442.1.64832 WP_003403442.1.6486 WP_003403442.1.64870 WP_003403442.1.64898 WP_003403442.1.64922 WP_003403442.1.64924 WP_003403442.1.6493 WP_003403442.1.64937 WP_003403442.1.64941 WP_003403442.1.64966 WP_003403442.1.64973 WP_003403442.1.65001 WP_003403442.1.65026 WP_003403442.1.65053 WP_003403442.1.65070 WP_003403442.1.65079 WP_003403442.1.65102 WP_003403442.1.65157 WP_003403442.1.65181 WP_003403442.1.65212 WP_003403442.1.65229 WP_003403442.1.6523 WP_003403442.1.65253 WP_003403442.1.65289 WP_003403442.1.65291 WP_003403442.1.65315 WP_003403442.1.65329 WP_003403442.1.65359 WP_003403442.1.6536 WP_003403442.1.65374 WP_003403442.1.65386 WP_003403442.1.65414 WP_003403442.1.65416 WP_003403442.1.65433 WP_003403442.1.65455 WP_003403442.1.65467 WP_003403442.1.65488 WP_003403442.1.65529 WP_003403442.1.65539 WP_003403442.1.65583 WP_003403442.1.65612 WP_003403442.1.65623 WP_003403442.1.65635 WP_003403442.1.65637 WP_003403442.1.65648 WP_003403442.1.65683 WP_003403442.1.65686 WP_003403442.1.65688 WP_003403442.1.65707 WP_003403442.1.65733 WP_003403442.1.65746 WP_003403442.1.65747 WP_003403442.1.65759 WP_003403442.1.65816 WP_003403442.1.65830 WP_003403442.1.65858 WP_003403442.1.65862 WP_003403442.1.65869 WP_003403442.1.65893 WP_003403442.1.65929 WP_003403442.1.65932 WP_003403442.1.65958 WP_003403442.1.66004 WP_003403442.1.66013 WP_003403442.1.6606 WP_003403442.1.66089 WP_003403442.1.66149 WP_003403442.1.66151 WP_003403442.1.66229 WP_003403442.1.66276 WP_003403442.1.66297 WP_003403442.1.66323 WP_003403442.1.66325 WP_003403442.1.6633 WP_003403442.1.66334 WP_003403442.1.66355 WP_003403442.1.66367 WP_003403442.1.66394 WP_003403442.1.66396 WP_003403442.1.66451 WP_003403442.1.66455 WP_003403442.1.66457 WP_003403442.1.66460 WP_003403442.1.66464 WP_003403442.1.66487 WP_003403442.1.66504 WP_003403442.1.66544 WP_003403442.1.66580 WP_003403442.1.66582 WP_003403442.1.66612 WP_003403442.1.66615 WP_003403442.1.66617 WP_003403442.1.66635 WP_003403442.1.66656 WP_003403442.1.66663 WP_003403442.1.66675 WP_003403442.1.66715 WP_003403442.1.66718 WP_003403442.1.66762 WP_003403442.1.66776 WP_003403442.1.66808 WP_003403442.1.66817 WP_003403442.1.66819 WP_003403442.1.66826 WP_003403442.1.66842 WP_003403442.1.66868 WP_003403442.1.66878 WP_003403442.1.66880 WP_003403442.1.66893 WP_003403442.1.66961 WP_003403442.1.67005 WP_003403442.1.6704 WP_003403442.1.67044 WP_003403442.1.67061 WP_003403442.1.67089 WP_003403442.1.67098 WP_003403442.1.67146 WP_003403442.1.67170 WP_003403442.1.67197 WP_003403442.1.67198 WP_003403442.1.67207 WP_003403442.1.67218 WP_003403442.1.67220 WP_003403442.1.67225 WP_003403442.1.67231 WP_003403442.1.6724 WP_003403442.1.67257 WP_003403442.1.67298 WP_003403442.1.67307 WP_003403442.1.67324 WP_003403442.1.67332 WP_003403442.1.67346 WP_003403442.1.67354 WP_003403442.1.67360 WP_003403442.1.67381 WP_003403442.1.67396 WP_003403442.1.67417 WP_003403442.1.67422 WP_003403442.1.67453 WP_003403442.1.67459 WP_003403442.1.6746 WP_003403442.1.67473 WP_003403442.1.67481 WP_003403442.1.67482 WP_003403442.1.67496 WP_003403442.1.67499 WP_003403442.1.67516 WP_003403442.1.67536 WP_003403442.1.67575 WP_003403442.1.67587 WP_003403442.1.67598 WP_003403442.1.67600 WP_003403442.1.67602 WP_003403442.1.67630 WP_003403442.1.67679 WP_003403442.1.67692 WP_003403442.1.67744 WP_003403442.1.6775 WP_003403442.1.67750 WP_003403442.1.6777 WP_003403442.1.67809 WP_003403442.1.67816 WP_003403442.1.67844 WP_003403442.1.67848 WP_003403442.1.67870 WP_003403442.1.67888 WP_003403442.1.67915 WP_003403442.1.67945 WP_003403442.1.67949 WP_003403442.1.67980 WP_003403442.1.67982 WP_003403442.1.68022 WP_003403442.1.68029 WP_003403442.1.68037 WP_003403442.1.68038 WP_003403442.1.68045 WP_003403442.1.68057 WP_003403442.1.68083 WP_003403442.1.68088 WP_003403442.1.68106 WP_003403442.1.68110 WP_003403442.1.68153 WP_003403442.1.68164 WP_003403442.1.68169 WP_003403442.1.68212 WP_003403442.1.68227 WP_003403442.1.68243 WP_003403442.1.6825 WP_003403442.1.68297 WP_003403442.1.68309 WP_003403442.1.68325 WP_003403442.1.68329 WP_003403442.1.68340 WP_003403442.1.68384 WP_003403442.1.68388 WP_003403442.1.68429 WP_003403442.1.6843 WP_003403442.1.68433 WP_003403442.1.68444 WP_003403442.1.68465 WP_003403442.1.68484 WP_003403442.1.68569 WP_003403442.1.68576 WP_003403442.1.68580 WP_003403442.1.68586 WP_003403442.1.68623 WP_003403442.1.68624 WP_003403442.1.68637 WP_003403442.1.68646 WP_003403442.1.68669 WP_003403442.1.68672 WP_003403442.1.68684 WP_003403442.1.68704 WP_003403442.1.68708 WP_003403442.1.6872 WP_003403442.1.68730 WP_003403442.1.68734 WP_003403442.1.68754 WP_003403442.1.6876 WP_003403442.1.68761 WP_003403442.1.68763 WP_003403442.1.68766 WP_003403442.1.68774 WP_003403442.1.68796 WP_003403442.1.68824 WP_003403442.1.68832 WP_003403442.1.68833 WP_003403442.1.68841 WP_003403442.1.68859 WP_003403442.1.68876 WP_003403442.1.68906 WP_003403442.1.68916 WP_003403442.1.68923 WP_003403442.1.68945 WP_003403442.1.6896 WP_003403442.1.68981 WP_003403442.1.68984 WP_003403442.1.68997 WP_003403442.1.69008 WP_003403442.1.69076 WP_003403442.1.69079 WP_003403442.1.6908 WP_003403442.1.69082 WP_003403442.1.69178 WP_003403442.1.69181 WP_003403442.1.69208 WP_003403442.1.69231 WP_003403442.1.69256 WP_003403442.1.69311 WP_003403442.1.69315 WP_003403442.1.69322 WP_003403442.1.69342 WP_003403442.1.6935 WP_003403442.1.6936 WP_003403442.1.69369 WP_003403442.1.69374 WP_003403442.1.69398 WP_003403442.1.69401 WP_003403442.1.69426 WP_003403442.1.69427 WP_003403442.1.69429 WP_003403442.1.6949 WP_003403442.1.6951 WP_003403442.1.69511 WP_003403442.1.69526 WP_003403442.1.69528 WP_003403442.1.69547 WP_003403442.1.69573 WP_003403442.1.69581 WP_003403442.1.6960 WP_003403442.1.69617 WP_003403442.1.69634 WP_003403442.1.69647 WP_003403442.1.69659 WP_003403442.1.69673 WP_003403442.1.69682 WP_003403442.1.69684 WP_003403442.1.69686 WP_003403442.1.69707 WP_003403442.1.69709 WP_003403442.1.69736 WP_003403442.1.69778 WP_003403442.1.69800 WP_003403442.1.69802 WP_003403442.1.69845 WP_003403442.1.69870 WP_003403442.1.69873 WP_003403442.1.69898 WP_003403442.1.69913 WP_003403442.1.69925 WP_003403442.1.69931 WP_003403442.1.69938 WP_003403442.1.69955 WP_003403442.1.69957 WP_003403442.1.69981 WP_003403442.1.69990 WP_003403442.1.70000 WP_003403442.1.70017 WP_003403442.1.70032 WP_003403442.1.70055 WP_003403442.1.70062 WP_003403442.1.70072 WP_003403442.1.70131 WP_003403442.1.70132 WP_003403442.1.7022 WP_003403442.1.70227 WP_003403442.1.70255 WP_003403442.1.70271 WP_003403442.1.70274 WP_003403442.1.7029 WP_003403442.1.70325 WP_003403442.1.70328 WP_003403442.1.70356 WP_003403442.1.70364 WP_003403442.1.70368 WP_003403442.1.70369 WP_003403442.1.70418 WP_003403442.1.70422 WP_003403442.1.70435 WP_003403442.1.70444 WP_003403442.1.70463 WP_003403442.1.70471 WP_003403442.1.70480 WP_003403442.1.70494 WP_003403442.1.70498 WP_003403442.1.70505 WP_003403442.1.70525 WP_003403442.1.70573 WP_003403442.1.70577 WP_003403442.1.70610 WP_003403442.1.70615 WP_003403442.1.70618 WP_003403442.1.70622 WP_003403442.1.70626 WP_003403442.1.70668 WP_003403442.1.70699 WP_003403442.1.70704 WP_003403442.1.70729 WP_003403442.1.70757 WP_003403442.1.70782 WP_003403442.1.70796 WP_003403442.1.70830 WP_003403442.1.70834 WP_003403442.1.70840 WP_003403442.1.70864 WP_003403442.1.70871 WP_003403442.1.70915 WP_003403442.1.70955 WP_003403442.1.70958 WP_003403442.1.70964 WP_003403442.1.70976 WP_003403442.1.71015 WP_003403442.1.71026 WP_003403442.1.71063 WP_003403442.1.71076 WP_003403442.1.71083 WP_003403442.1.7111 WP_003403442.1.71118 WP_003403442.1.71128 WP_003403442.1.7113 WP_003403442.1.71187 WP_003403442.1.71191 WP_003403442.1.71255 WP_003403442.1.71258 WP_003403442.1.71259 WP_003403442.1.71289 WP_003403442.1.71326 WP_003403442.1.71329 WP_003403442.1.71331 WP_003403442.1.71344 WP_003403442.1.71390 WP_003403442.1.71414 WP_003403442.1.71440 WP_003403442.1.71457 WP_003403442.1.7146 WP_003403442.1.71464 WP_003403442.1.71490 WP_003403442.1.71492 WP_003403442.1.71509 WP_003403442.1.71516 WP_003403442.1.71517 WP_003403442.1.71527 WP_003403442.1.71532 WP_003403442.1.71546 WP_003403442.1.71569 WP_003403442.1.71604 WP_003403442.1.71621 WP_003403442.1.71630 WP_003403442.1.71638 WP_003403442.1.71654 WP_003403442.1.71664 WP_003403442.1.71665 WP_003403442.1.71683 WP_003403442.1.71701 WP_003403442.1.71718 WP_003403442.1.71731 WP_003403442.1.71778 WP_003403442.1.71781 WP_003403442.1.71803 WP_003403442.1.71820 WP_003403442.1.71847 WP_003403442.1.7185 WP_003403442.1.71851 WP_003403442.1.71871 WP_003403442.1.71909 WP_003403442.1.71957 WP_003403442.1.71970 WP_003403442.1.72047 WP_003403442.1.72061 WP_003403442.1.72062 WP_003403442.1.72072 WP_003403442.1.72111 WP_003403442.1.72122 WP_003403442.1.72128 WP_003403442.1.72143 WP_003403442.1.7216 WP_003403442.1.72168 WP_003403442.1.72179 WP_003403442.1.72209 WP_003403442.1.72218 WP_003403442.1.72219 WP_003403442.1.72227 WP_003403442.1.7224 WP_003403442.1.72268 WP_003403442.1.72332 WP_003403442.1.72380 WP_003403442.1.72401 WP_003403442.1.72405 WP_003403442.1.72420 WP_003403442.1.72441 WP_003403442.1.72451 WP_003403442.1.72452 WP_003403442.1.72457 WP_003403442.1.72459 WP_003403442.1.72460 WP_003403442.1.72466 WP_003403442.1.72487 WP_003403442.1.72488 WP_003403442.1.72492 WP_003403442.1.72506 WP_003403442.1.72543 WP_003403442.1.7256 WP_003403442.1.72576 WP_003403442.1.72578 WP_003403442.1.72585 WP_003403442.1.72591 WP_003403442.1.72592 WP_003403442.1.72640 WP_003403442.1.7266 WP_003403442.1.72661 WP_003403442.1.72684 WP_003403442.1.72739 WP_003403442.1.72744 WP_003403442.1.72755 WP_003403442.1.72759 WP_003403442.1.72784 WP_003403442.1.72792 WP_003403442.1.72826 WP_003403442.1.72831 WP_003403442.1.72852 WP_003403442.1.72853 WP_003403442.1.72879 WP_003403442.1.72880 WP_003403442.1.72938 WP_003403442.1.72954 WP_003403442.1.72957 WP_003403442.1.72959 WP_003403442.1.72973 WP_003403442.1.7298 WP_003403442.1.72982 WP_003403442.1.72988 WP_003403442.1.72993 WP_003403442.1.73006 WP_003403442.1.73013 WP_003403442.1.73025 WP_003403442.1.73028 WP_003403442.1.73042 WP_003403442.1.73045 WP_003403442.1.73092 WP_003403442.1.73118 WP_003403442.1.7312 WP_003403442.1.73127 WP_003403442.1.73134 WP_003403442.1.73150 WP_003403442.1.73154 WP_003403442.1.73163 WP_003403442.1.73182 WP_003403442.1.73205 WP_003403442.1.7321 WP_003403442.1.73310 WP_003403442.1.73365 WP_003403442.1.73404 WP_003403442.1.73424 WP_003403442.1.73436 WP_003403442.1.73445 WP_003403442.1.73453 WP_003403442.1.73466 WP_003403442.1.73470 WP_003403442.1.73471 WP_003403442.1.73478 WP_003403442.1.73482 WP_003403442.1.73507 WP_003403442.1.73532 WP_003403442.1.73550 WP_003403442.1.73564 WP_003403442.1.73623 WP_003403442.1.73629 WP_003403442.1.73644 WP_003403442.1.73661 WP_003403442.1.7368 WP_003403442.1.73688 WP_003403442.1.73723 WP_003403442.1.73744 WP_003403442.1.73750 WP_003403442.1.73760 WP_003403442.1.7379 WP_003403442.1.73813 WP_003403442.1.73840 WP_003403442.1.73876 WP_003403442.1.7389 WP_003403442.1.73986 WP_003403442.1.74016 WP_003403442.1.74039 WP_003403442.1.74083 WP_003403442.1.74101 WP_003403442.1.74107 WP_003403442.1.74120 WP_003403442.1.74129 WP_003403442.1.74144 WP_003403442.1.7417 WP_003403442.1.74190 WP_003403442.1.74210 WP_003403442.1.7423 WP_003403442.1.74259 WP_003403442.1.74262 WP_003403442.1.74269 WP_003403442.1.74282 WP_003403442.1.74291 WP_003403442.1.74296 WP_003403442.1.74304 WP_003403442.1.7432 WP_003403442.1.74347 WP_003403442.1.7436 WP_003403442.1.74378 WP_003403442.1.74382 WP_003403442.1.74395 WP_003403442.1.74400 WP_003403442.1.74401 WP_003403442.1.74432 WP_003403442.1.74442 WP_003403442.1.74477 WP_003403442.1.74487 WP_003403442.1.74499 WP_003403442.1.74504 WP_003403442.1.74511 WP_003403442.1.74523 WP_003403442.1.74525 WP_003403442.1.74551 WP_003403442.1.74555 WP_003403442.1.74628 WP_003403442.1.74641 WP_003403442.1.74653 WP_003403442.1.74660 WP_003403442.1.74683 WP_003403442.1.7469 WP_003403442.1.74725 WP_003403442.1.74760 WP_003403442.1.74786 WP_003403442.1.74809 WP_003403442.1.74820 WP_003403442.1.74870 WP_003403442.1.74881 WP_003403442.1.74888 WP_003403442.1.74952 WP_003403442.1.7496 WP_003403442.1.74988 WP_003403442.1.75043 WP_003403442.1.75045 WP_003403442.1.75055 WP_003403442.1.75078 WP_003403442.1.75081 WP_003403442.1.75120 WP_003403442.1.75188 WP_003403442.1.75200 WP_003403442.1.75202 WP_003403442.1.75234 WP_003403442.1.75239 WP_003403442.1.75250 WP_003403442.1.75263 WP_003403442.1.75281 WP_003403442.1.75342 WP_003403442.1.75376 WP_003403442.1.75395 WP_003403442.1.75441 WP_003403442.1.75510 WP_003403442.1.75598 WP_003403442.1.75635 WP_003403442.1.75645 WP_003403442.1.75665 WP_003403442.1.75671 WP_003403442.1.75741 WP_003403442.1.75749 WP_003403442.1.75772 WP_003403442.1.75774 WP_003403442.1.75811 WP_003403442.1.75833 WP_003403442.1.7585 WP_003403442.1.75864 WP_003403442.1.75868 WP_003403442.1.75878 WP_003403442.1.75927 WP_003403442.1.75946 WP_003403442.1.75968 WP_003403442.1.76007 WP_003403442.1.76016 WP_003403442.1.76032 WP_003403442.1.7604 WP_003403442.1.76045 WP_003403442.1.76052 WP_003403442.1.76058 WP_003403442.1.76064 WP_003403442.1.76110 WP_003403442.1.76126 WP_003403442.1.76133 WP_003403442.1.76138 WP_003403442.1.76157 WP_003403442.1.76172 WP_003403442.1.76177 WP_003403442.1.76183 WP_003403442.1.76209 WP_003403442.1.76239 WP_003403442.1.76272 WP_003403442.1.76277 WP_003403442.1.76280 WP_003403442.1.76281 WP_003403442.1.76291 WP_003403442.1.76297 WP_003403442.1.76360 WP_003403442.1.76379 WP_003403442.1.76403 WP_003403442.1.76413 WP_003403442.1.76414 WP_003403442.1.76427 WP_003403442.1.76436 WP_003403442.1.76442 WP_003403442.1.76443 WP_003403442.1.76456 WP_003403442.1.76521 WP_003403442.1.76533 WP_003403442.1.76616 WP_003403442.1.76625 WP_003403442.1.76629 WP_003403442.1.76635 WP_003403442.1.76638 WP_003403442.1.76639 WP_003403442.1.76640 WP_003403442.1.76644 WP_003403442.1.76677 WP_003403442.1.76678 WP_003403442.1.76679 WP_003403442.1.76734 WP_003403442.1.76744 WP_003403442.1.76750 WP_003403442.1.76754 WP_003403442.1.76757 WP_003403442.1.76781 WP_003403442.1.76818 WP_003403442.1.76824 WP_003403442.1.76835 WP_003403442.1.76873 WP_003403442.1.76881 WP_003403442.1.76888 WP_003403442.1.76900 WP_003403442.1.7691 WP_003403442.1.76947 WP_003403442.1.76954 WP_003403442.1.76955 WP_003403442.1.76963 WP_003403442.1.76976 WP_003403442.1.770 WP_003403442.1.77000 WP_003403442.1.77008 WP_003403442.1.77021 WP_003403442.1.77056 WP_003403442.1.77065 WP_003403442.1.77075 WP_003403442.1.77093 WP_003403442.1.77107 WP_003403442.1.77115 WP_003403442.1.77118 WP_003403442.1.77125 WP_003403442.1.77141 WP_003403442.1.77142 WP_003403442.1.77166 WP_003403442.1.77250 WP_003403442.1.77252 WP_003403442.1.77260 WP_003403442.1.77266 WP_003403442.1.77280 WP_003403442.1.77285 WP_003403442.1.77312 WP_003403442.1.77348 WP_003403442.1.77351 WP_003403442.1.77352 WP_003403442.1.77361 WP_003403442.1.774 WP_003403442.1.7740 WP_003403442.1.77404 WP_003403442.1.77425 WP_003403442.1.77463 WP_003403442.1.77474 WP_003403442.1.7748 WP_003403442.1.77484 WP_003403442.1.77491 WP_003403442.1.77499 WP_003403442.1.77510 WP_003403442.1.77530 WP_003403442.1.77554 WP_003403442.1.77559 WP_003403442.1.77599 WP_003403442.1.77605 WP_003403442.1.7762 WP_003403442.1.77627 WP_003403442.1.77649 WP_003403442.1.77654 WP_003403442.1.7766 WP_003403442.1.77667 WP_003403442.1.77704 WP_003403442.1.77706 WP_003403442.1.77726 WP_003403442.1.7778 WP_003403442.1.77790 WP_003403442.1.77809 WP_003403442.1.77820 WP_003403442.1.77843 WP_003403442.1.77855 WP_003403442.1.77865 WP_003403442.1.77868 WP_003403442.1.77879 WP_003403442.1.77890 WP_003403442.1.77909 WP_003403442.1.77911 WP_003403442.1.77931 WP_003403442.1.77984 WP_003403442.1.78020 WP_003403442.1.78024 WP_003403442.1.78075 WP_003403442.1.78084 WP_003403442.1.78086 WP_003403442.1.7809 WP_003403442.1.78098 WP_003403442.1.78105 WP_003403442.1.78113 WP_003403442.1.78162 WP_003403442.1.7817 WP_003403442.1.78200 WP_003403442.1.78216 WP_003403442.1.78236 WP_003403442.1.78238 WP_003403442.1.78322 WP_003403442.1.78338 WP_003403442.1.7836 WP_003403442.1.78360 WP_003403442.1.78386 WP_003403442.1.78429 WP_003403442.1.78435 WP_003403442.1.7844 WP_003403442.1.78459 WP_003403442.1.78488 WP_003403442.1.7849 WP_003403442.1.78499 WP_003403442.1.785 WP_003403442.1.78516 WP_003403442.1.78524 WP_003403442.1.78526 WP_003403442.1.78538 WP_003403442.1.78544 WP_003403442.1.78545 WP_003403442.1.78547 WP_003403442.1.78574 WP_003403442.1.78580 WP_003403442.1.7860 WP_003403442.1.78620 WP_003403442.1.78646 WP_003403442.1.78648 WP_003403442.1.78649 WP_003403442.1.78655 WP_003403442.1.78657 WP_003403442.1.78659 WP_003403442.1.7869 WP_003403442.1.78692 WP_003403442.1.78760 WP_003403442.1.78766 WP_003403442.1.78776 WP_003403442.1.78778 WP_003403442.1.78784 WP_003403442.1.78788 WP_003403442.1.78790 WP_003403442.1.78793 WP_003403442.1.78848 WP_003403442.1.78860 WP_003403442.1.7887 WP_003403442.1.78884 WP_003403442.1.78932 WP_003403442.1.78969 WP_003403442.1.78977 WP_003403442.1.78980 WP_003403442.1.79005 WP_003403442.1.79016 WP_003403442.1.79033 WP_003403442.1.79064 WP_003403442.1.79066 WP_003403442.1.79068 WP_003403442.1.79077 WP_003403442.1.79095 WP_003403442.1.79112 WP_003403442.1.79122 WP_003403442.1.79145 WP_003403442.1.79152 WP_003403442.1.79163 WP_003403442.1.79182 WP_003403442.1.79198 WP_003403442.1.79213 WP_003403442.1.79218 WP_003403442.1.79268 WP_003403442.1.79273 WP_003403442.1.79278 WP_003403442.1.79290 WP_003403442.1.79319 WP_003403442.1.79325 WP_003403442.1.79326 WP_003403442.1.7933 WP_003403442.1.79330 WP_003403442.1.79339 WP_003403442.1.79394 WP_003403442.1.79399 WP_003403442.1.79413 WP_003403442.1.79422 WP_003403442.1.79445 WP_003403442.1.79447 WP_003403442.1.79455 WP_003403442.1.79471 WP_003403442.1.79480 WP_003403442.1.79482 WP_003403442.1.79488 WP_003403442.1.79500 WP_003403442.1.79502 WP_003403442.1.79508 WP_003403442.1.79514 WP_003403442.1.79561 WP_003403442.1.79565 WP_003403442.1.79578 WP_003403442.1.79588 WP_003403442.1.79598 WP_003403442.1.79615 WP_003403442.1.79684 WP_003403442.1.79698 WP_003403442.1.797 WP_003403442.1.79784 WP_003403442.1.79802 WP_003403442.1.79806 WP_003403442.1.79819 WP_003403442.1.79826 WP_003403442.1.79828 WP_003403442.1.79851 WP_003403442.1.79853 WP_003403442.1.79863 WP_003403442.1.79881 WP_003403442.1.79885 WP_003403442.1.79898 WP_003403442.1.7990 WP_003403442.1.79900 WP_003403442.1.79913 WP_003403442.1.79918 WP_003403442.1.79947 WP_003403442.1.79948 WP_003403442.1.7995 WP_003403442.1.7997 WP_003403442.1.80004 WP_003403442.1.80015 WP_003403442.1.80022 WP_003403442.1.80030 WP_003403442.1.80054 WP_003403442.1.80084 WP_003403442.1.80099 WP_003403442.1.80129 WP_003403442.1.80177 WP_003403442.1.80234 WP_003403442.1.8026 WP_003403442.1.80275 WP_003403442.1.8029 WP_003403442.1.80299 WP_003403442.1.80300 WP_003403442.1.80304 WP_003403442.1.80326 WP_003403442.1.80351 WP_003403442.1.8037 WP_003403442.1.80370 WP_003403442.1.80387 WP_003403442.1.80399 WP_003403442.1.8044 WP_003403442.1.80451 WP_003403442.1.80458 WP_003403442.1.80461 WP_003403442.1.80490 WP_003403442.1.80503 WP_003403442.1.80507 WP_003403442.1.80552 WP_003403442.1.80576 WP_003403442.1.80588 WP_003403442.1.80599 WP_003403442.1.8060 WP_003403442.1.80624 WP_003403442.1.80636 WP_003403442.1.80673 WP_003403442.1.80711 WP_003403442.1.80743 WP_003403442.1.80784 WP_003403442.1.80815 WP_003403442.1.80853 WP_003403442.1.80918 WP_003403442.1.8093 WP_003403442.1.80967 WP_003403442.1.8097 WP_003403442.1.80988 WP_003403442.1.81007 WP_003403442.1.81013 WP_003403442.1.8105 WP_003403442.1.81059 WP_003403442.1.81063 WP_003403442.1.81066 WP_003403442.1.81075 WP_003403442.1.81091 WP_003403442.1.81119 WP_003403442.1.81125 WP_003403442.1.81136 WP_003403442.1.8114 WP_003403442.1.81189 WP_003403442.1.81192 WP_003403442.1.812 WP_003403442.1.81230 WP_003403442.1.81249 WP_003403442.1.81250 WP_003403442.1.81264 WP_003403442.1.8128 WP_003403442.1.81287 WP_003403442.1.81297 WP_003403442.1.8138 WP_003403442.1.81407 WP_003403442.1.8143 WP_003403442.1.81439 WP_003403442.1.81465 WP_003403442.1.81505 WP_003403442.1.81529 WP_003403442.1.81541 WP_003403442.1.81560 WP_003403442.1.81561 WP_003403442.1.81567 WP_003403442.1.81583 WP_003403442.1.81686 WP_003403442.1.81712 WP_003403442.1.81720 WP_003403442.1.81731 WP_003403442.1.81774 WP_003403442.1.81788 WP_003403442.1.81809 WP_003403442.1.81820 WP_003403442.1.81850 WP_003403442.1.81883 WP_003403442.1.81891 WP_003403442.1.81911 WP_003403442.1.81918 WP_003403442.1.82011 WP_003403442.1.82048 WP_003403442.1.82069 WP_003403442.1.82071 WP_003403442.1.82108 WP_003403442.1.82136 WP_003403442.1.82142 WP_003403442.1.8215 WP_003403442.1.82158 WP_003403442.1.8217 WP_003403442.1.82209 WP_003403442.1.82210 WP_003403442.1.82228 WP_003403442.1.82236 WP_003403442.1.82251 WP_003403442.1.82271 WP_003403442.1.82305 WP_003403442.1.82307 WP_003403442.1.82309 WP_003403442.1.82317 WP_003403442.1.8232 WP_003403442.1.82346 WP_003403442.1.82374 WP_003403442.1.82385 WP_003403442.1.82429 WP_003403442.1.82460 WP_003403442.1.82462 WP_003403442.1.82483 WP_003403442.1.82494 WP_003403442.1.82531 WP_003403442.1.82546 WP_003403442.1.82547 WP_003403442.1.82577 WP_003403442.1.82592 WP_003403442.1.82597 WP_003403442.1.82598 WP_003403442.1.82625 WP_003403442.1.82642 WP_003403442.1.82651 WP_003403442.1.82653 WP_003403442.1.82681 WP_003403442.1.82685 WP_003403442.1.8271 WP_003403442.1.82712 WP_003403442.1.8273 WP_003403442.1.82743 WP_003403442.1.82757 WP_003403442.1.82774 WP_003403442.1.82836 WP_003403442.1.82860 WP_003403442.1.82871 WP_003403442.1.82892 WP_003403442.1.82935 WP_003403442.1.82957 WP_003403442.1.82973 WP_003403442.1.82981 WP_003403442.1.82983 WP_003403442.1.83004 WP_003403442.1.83009 WP_003403442.1.83044 WP_003403442.1.83065 WP_003403442.1.83074 WP_003403442.1.83110 WP_003403442.1.83146 WP_003403442.1.83149 WP_003403442.1.83159 WP_003403442.1.8317 WP_003403442.1.83173 WP_003403442.1.83181 WP_003403442.1.83191 WP_003403442.1.83197 WP_003403442.1.83212 WP_003403442.1.8326 WP_003403442.1.83262 WP_003403442.1.83268 WP_003403442.1.83273 WP_003403442.1.83309 WP_003403442.1.83332 WP_003403442.1.83334 WP_003403442.1.83341 WP_003403442.1.83349 WP_003403442.1.8335 WP_003403442.1.83353 WP_003403442.1.83367 WP_003403442.1.83380 WP_003403442.1.83381 WP_003403442.1.83389 WP_003403442.1.83408 WP_003403442.1.83409 WP_003403442.1.83435 WP_003403442.1.83470 WP_003403442.1.83524 WP_003403442.1.83526 WP_003403442.1.8358 WP_003403442.1.83589 WP_003403442.1.83601 WP_003403442.1.83611 WP_003403442.1.83638 WP_003403442.1.83648 WP_003403442.1.83656 WP_003403442.1.83667 WP_003403442.1.83689 WP_003403442.1.83692 WP_003403442.1.83704 WP_003403442.1.83705 WP_003403442.1.83766 WP_003403442.1.83793 WP_003403442.1.83802 WP_003403442.1.83805 WP_003403442.1.83839 WP_003403442.1.83842 WP_003403442.1.83850 WP_003403442.1.83861 WP_003403442.1.83884 WP_003403442.1.83920 WP_003403442.1.83929 WP_003403442.1.83930 WP_003403442.1.83975 WP_003403442.1.83991 WP_003403442.1.8400 WP_003403442.1.84027 WP_003403442.1.8404 WP_003403442.1.84057 WP_003403442.1.84070 WP_003403442.1.8409 WP_003403442.1.84112 WP_003403442.1.84146 WP_003403442.1.8415 WP_003403442.1.84176 WP_003403442.1.84186 WP_003403442.1.84192 WP_003403442.1.84228 WP_003403442.1.8424 WP_003403442.1.84244 WP_003403442.1.84259 WP_003403442.1.8426 WP_003403442.1.84277 WP_003403442.1.84287 WP_003403442.1.8434 WP_003403442.1.84388 WP_003403442.1.84408 WP_003403442.1.84409 WP_003403442.1.84438 WP_003403442.1.84460 WP_003403442.1.84488 WP_003403442.1.84504 WP_003403442.1.84620 WP_003403442.1.84623 WP_003403442.1.84641 WP_003403442.1.84655 WP_003403442.1.84666 WP_003403442.1.84670 WP_003403442.1.84739 WP_003403442.1.84748 WP_003403442.1.84766 WP_003403442.1.84772 WP_003403442.1.84774 WP_003403442.1.848 WP_003403442.1.84812 WP_003403442.1.84836 WP_003403442.1.84839 WP_003403442.1.84846 WP_003403442.1.84873 WP_003403442.1.84911 WP_003403442.1.84938 WP_003403442.1.84968 WP_003403442.1.84973 WP_003403442.1.84981 WP_003403442.1.84985 WP_003403442.1.8503 WP_003403442.1.85038 WP_003403442.1.85041 WP_003403442.1.85043 WP_003403442.1.8505 WP_003403442.1.85074 WP_003403442.1.8509 WP_003403442.1.8512 WP_003403442.1.85148 WP_003403442.1.8522 WP_003403442.1.85242 WP_003403442.1.85276 WP_003403442.1.85281 WP_003403442.1.85284 WP_003403442.1.85314 WP_003403442.1.85319 WP_003403442.1.85330 WP_003403442.1.85341 WP_003403442.1.85346 WP_003403442.1.8535 WP_003403442.1.85363 WP_003403442.1.85371 WP_003403442.1.85377 WP_003403442.1.85387 WP_003403442.1.85399 WP_003403442.1.85458 WP_003403442.1.8546 WP_003403442.1.85464 WP_003403442.1.85478 WP_003403442.1.85480 WP_003403442.1.85488 WP_003403442.1.85495 WP_003403442.1.85551 WP_003403442.1.85557 WP_003403442.1.85577 WP_003403442.1.85597 WP_003403442.1.85599 WP_003403442.1.85610 WP_003403442.1.8563 WP_003403442.1.85648 WP_003403442.1.85679 WP_003403442.1.85704 WP_003403442.1.85717 WP_003403442.1.85727 WP_003403442.1.85737 WP_003403442.1.85763 WP_003403442.1.85808 WP_003403442.1.85819 WP_003403442.1.85820 WP_003403442.1.85823 WP_003403442.1.85832 WP_003403442.1.8586 WP_003403442.1.85872 WP_003403442.1.85894 WP_003403442.1.85909 WP_003403442.1.85913 WP_003403442.1.85953 WP_003403442.1.85986 WP_003403442.1.86000 WP_003403442.1.86024 WP_003403442.1.86025 WP_003403442.1.86032 WP_003403442.1.86048 WP_003403442.1.86052 WP_003403442.1.86067 WP_003403442.1.86103 WP_003403442.1.86122 WP_003403442.1.86124 WP_003403442.1.86160 WP_003403442.1.86164 WP_003403442.1.86168 WP_003403442.1.86190 WP_003403442.1.86204 WP_003403442.1.86208 WP_003403442.1.86235 WP_003403442.1.86249 WP_003403442.1.86260 WP_003403442.1.86290 WP_003403442.1.863 WP_003403442.1.86327 WP_003403442.1.86334 WP_003403442.1.86337 WP_003403442.1.86368 WP_003403442.1.86377 WP_003403442.1.86425 WP_003403442.1.86459 WP_003403442.1.86499 WP_003403442.1.86520 WP_003403442.1.86561 WP_003403442.1.86568 WP_003403442.1.86575 WP_003403442.1.86584 WP_003403442.1.86626 WP_003403442.1.86648 WP_003403442.1.8666 WP_003403442.1.86684 WP_003403442.1.86696 WP_003403442.1.86705 WP_003403442.1.86718 WP_003403442.1.86725 WP_003403442.1.86757 WP_003403442.1.86766 WP_003403442.1.86801 WP_003403442.1.86814 WP_003403442.1.86820 WP_003403442.1.86825 WP_003403442.1.86834 WP_003403442.1.8685 WP_003403442.1.86851 WP_003403442.1.86855 WP_003403442.1.86867 WP_003403442.1.86877 WP_003403442.1.86883 WP_003403442.1.8689 WP_003403442.1.86892 WP_003403442.1.86933 WP_003403442.1.86941 WP_003403442.1.86950 WP_003403442.1.86962 WP_003403442.1.86963 WP_003403442.1.86979 WP_003403442.1.8700 WP_003403442.1.87001 WP_003403442.1.87002 WP_003403442.1.87116 WP_003403442.1.8714 WP_003403442.1.87162 WP_003403442.1.87178 WP_003403442.1.87191 WP_003403442.1.87201 WP_003403442.1.87209 WP_003403442.1.87240 WP_003403442.1.87266 WP_003403442.1.87273 WP_003403442.1.87275 WP_003403442.1.8733 WP_003403442.1.87345 WP_003403442.1.87369 WP_003403442.1.8737 WP_003403442.1.87401 WP_003403442.1.87404 WP_003403442.1.87406 WP_003403442.1.87409 WP_003403442.1.87444 WP_003403442.1.87446 WP_003403442.1.87459 WP_003403442.1.87472 WP_003403442.1.87489 WP_003403442.1.87494 WP_003403442.1.87496 WP_003403442.1.87582 WP_003403442.1.87588 WP_003403442.1.87617 WP_003403442.1.87619 WP_003403442.1.87620 WP_003403442.1.87634 WP_003403442.1.87643 WP_003403442.1.8765 WP_003403442.1.87650 WP_003403442.1.87654 WP_003403442.1.87658 WP_003403442.1.87665 WP_003403442.1.87676 WP_003403442.1.87677 WP_003403442.1.87684 WP_003403442.1.87692 WP_003403442.1.87707 WP_003403442.1.87732 WP_003403442.1.87784 WP_003403442.1.87796 WP_003403442.1.87809 WP_003403442.1.87817 WP_003403442.1.87827 WP_003403442.1.87831 WP_003403442.1.87835 WP_003403442.1.87837 WP_003403442.1.87866 WP_003403442.1.8789 WP_003403442.1.87911 WP_003403442.1.87924 WP_003403442.1.87951 WP_003403442.1.87955 WP_003403442.1.87956 WP_003403442.1.87991 WP_003403442.1.88002 WP_003403442.1.88037 WP_003403442.1.88039 WP_003403442.1.88072 WP_003403442.1.88077 WP_003403442.1.88121 WP_003403442.1.88180 WP_003403442.1.88191 WP_003403442.1.88205 WP_003403442.1.88217 WP_003403442.1.88219 WP_003403442.1.88253 WP_003403442.1.88294 WP_003403442.1.88315 WP_003403442.1.88316 WP_003403442.1.88320 WP_003403442.1.88338 WP_003403442.1.8840 WP_003403442.1.88437 WP_003403442.1.88453 WP_003403442.1.88469 WP_003403442.1.88489 WP_003403442.1.88507 WP_003403442.1.88521 WP_003403442.1.88530 WP_003403442.1.88537 WP_003403442.1.88541 WP_003403442.1.88592 WP_003403442.1.88616 WP_003403442.1.88618 WP_003403442.1.8862 WP_003403442.1.88625 WP_003403442.1.88632 WP_003403442.1.88634 WP_003403442.1.88649 WP_003403442.1.8870 WP_003403442.1.88737 WP_003403442.1.88756 WP_003403442.1.888 WP_003403442.1.88824 WP_003403442.1.88886 WP_003403442.1.88965 WP_003403442.1.88985 WP_003403442.1.8902 WP_003403442.1.89025 WP_003403442.1.89041 WP_003403442.1.89046 WP_003403442.1.89082 WP_003403442.1.89162 WP_003403442.1.89168 WP_003403442.1.8917 WP_003403442.1.89193 WP_003403442.1.89205 WP_003403442.1.89207 WP_003403442.1.89225 WP_003403442.1.8925 WP_003403442.1.89277 WP_003403442.1.89286 WP_003403442.1.89293 WP_003403442.1.89320 WP_003403442.1.8935 WP_003403442.1.89371 WP_003403442.1.89378 WP_003403442.1.89392 WP_003403442.1.89406 WP_003403442.1.8943 WP_003403442.1.89451 WP_003403442.1.89473 WP_003403442.1.89475 WP_003403442.1.89483 WP_003403442.1.895 WP_003403442.1.89513 WP_003403442.1.89517 WP_003403442.1.89522 WP_003403442.1.8954 WP_003403442.1.89543 WP_003403442.1.89567 WP_003403442.1.8957 WP_003403442.1.89572 WP_003403442.1.89589 WP_003403442.1.89607 WP_003403442.1.89613 WP_003403442.1.89625 WP_003403442.1.89648 WP_003403442.1.8967 WP_003403442.1.89670 WP_003403442.1.89676 WP_003403442.1.89729 WP_003403442.1.89739 WP_003403442.1.89762 WP_003403442.1.8977 WP_003403442.1.89802 WP_003403442.1.89808 WP_003403442.1.8982 WP_003403442.1.89829 WP_003403442.1.89831 WP_003403442.1.89844 WP_003403442.1.89849 WP_003403442.1.8989 WP_003403442.1.89901 WP_003403442.1.89903 WP_003403442.1.89909 WP_003403442.1.89922 WP_003403442.1.89926 WP_003403442.1.89963 WP_003403442.1.89971 WP_003403442.1.8998 WP_003403442.1.89987 WP_003403442.1.900 WP_003403442.1.90048 WP_003403442.1.9007 WP_003403442.1.90080 WP_003403442.1.90130 WP_003403442.1.90134 WP_003403442.1.90137 WP_003403442.1.90184 WP_003403442.1.90199 WP_003403442.1.90231 WP_003403442.1.90245 WP_003403442.1.90308 WP_003403442.1.90322 WP_003403442.1.90328 WP_003403442.1.90372 WP_003403442.1.90439 WP_003403442.1.90481 WP_003403442.1.90499 WP_003403442.1.9050 WP_003403442.1.90527 WP_003403442.1.90550 WP_003403442.1.90560 WP_003403442.1.90612 WP_003403442.1.90640 WP_003403442.1.90687 WP_003403442.1.90691 WP_003403442.1.90711 WP_003403442.1.90722 WP_003403442.1.90744 WP_003403442.1.9075 WP_003403442.1.90756 WP_003403442.1.90767 WP_003403442.1.90771 WP_003403442.1.90785 WP_003403442.1.90788 WP_003403442.1.90800 WP_003403442.1.90810 WP_003403442.1.90816 WP_003403442.1.90819 WP_003403442.1.9082 WP_003403442.1.90831 WP_003403442.1.90884 WP_003403442.1.90899 WP_003403442.1.90906 WP_003403442.1.90958 WP_003403442.1.90976 WP_003403442.1.90977 WP_003403442.1.90987 WP_003403442.1.9102 WP_003403442.1.91026 WP_003403442.1.91032 WP_003403442.1.91043 WP_003403442.1.91053 WP_003403442.1.91082 WP_003403442.1.91106 WP_003403442.1.91112 WP_003403442.1.91144 WP_003403442.1.91151 WP_003403442.1.91157 WP_003403442.1.91167 WP_003403442.1.91169 WP_003403442.1.91192 WP_003403442.1.91201 WP_003403442.1.91207 WP_003403442.1.91208 WP_003403442.1.91211 WP_003403442.1.91214 WP_003403442.1.91230 WP_003403442.1.91251 WP_003403442.1.91260 WP_003403442.1.91265 WP_003403442.1.9128 WP_003403442.1.91284 WP_003403442.1.91294 WP_003403442.1.91322 WP_003403442.1.91352 WP_003403442.1.91386 WP_003403442.1.9139 WP_003403442.1.91398 WP_003403442.1.91411 WP_003403442.1.91430 WP_003403442.1.91436 WP_003403442.1.91483 WP_003403442.1.91507 WP_003403442.1.91508 WP_003403442.1.91576 WP_003403442.1.91589 WP_003403442.1.91694 WP_003403442.1.91695 WP_003403442.1.91713 WP_003403442.1.91716 WP_003403442.1.91717 WP_003403442.1.91728 WP_003403442.1.91743 WP_003403442.1.91759 WP_003403442.1.91784 WP_003403442.1.91785 WP_003403442.1.91786 WP_003403442.1.91802 WP_003403442.1.91822 WP_003403442.1.91828 WP_003403442.1.9189 WP_003403442.1.91896 WP_003403442.1.9190 WP_003403442.1.91915 WP_003403442.1.91931 WP_003403442.1.91937 WP_003403442.1.91953 WP_003403442.1.91957 WP_003403442.1.91976 WP_003403442.1.91978 WP_003403442.1.92021 WP_003403442.1.92083 WP_003403442.1.92127 WP_003403442.1.92144 WP_003403442.1.92150 WP_003403442.1.92153 WP_003403442.1.92190 WP_003403442.1.92192 WP_003403442.1.92200 WP_003403442.1.92220 WP_003403442.1.92222 WP_003403442.1.92273 WP_003403442.1.92289 WP_003403442.1.9229 WP_003403442.1.92294 WP_003403442.1.92317 WP_003403442.1.92334 WP_003403442.1.92338 WP_003403442.1.92345 WP_003403442.1.92356 WP_003403442.1.92364 WP_003403442.1.92380 WP_003403442.1.92416 WP_003403442.1.92428 WP_003403442.1.92447 WP_003403442.1.92456 WP_003403442.1.92467 WP_003403442.1.92471 WP_003403442.1.92490 WP_003403442.1.92508 WP_003403442.1.9251 WP_003403442.1.92511 WP_003403442.1.92523 WP_003403442.1.92527 WP_003403442.1.92536 WP_003403442.1.92592 WP_003403442.1.92597 WP_003403442.1.92603 WP_003403442.1.92606 WP_003403442.1.92610 WP_003403442.1.9263 WP_003403442.1.9265 WP_003403442.1.92650 WP_003403442.1.92660 WP_003403442.1.92677 WP_003403442.1.92685 WP_003403442.1.92689 WP_003403442.1.92706 WP_003403442.1.92714 WP_003403442.1.92736 WP_003403442.1.9274 WP_003403442.1.92752 WP_003403442.1.92760 WP_003403442.1.92777 WP_003403442.1.92803 WP_003403442.1.92833 WP_003403442.1.92856 WP_003403442.1.92881 WP_003403442.1.92892 WP_003403442.1.92907 WP_003403442.1.92908 WP_003403442.1.9291 WP_003403442.1.92917 WP_003403442.1.92996 WP_003403442.1.93006 WP_003403442.1.93008 WP_003403442.1.93009 WP_003403442.1.93015 WP_003403442.1.93043 WP_003403442.1.9307 WP_003403442.1.93083 WP_003403442.1.93097 WP_003403442.1.93192 WP_003403442.1.93199 WP_003403442.1.93203 WP_003403442.1.93212 WP_003403442.1.93234 WP_003403442.1.93245 WP_003403442.1.93257 WP_003403442.1.93265 WP_003403442.1.93297 WP_003403442.1.93320 WP_003403442.1.93328 WP_003403442.1.93337 WP_003403442.1.93343 WP_003403442.1.93349 WP_003403442.1.93363 WP_003403442.1.93377 WP_003403442.1.9338 WP_003403442.1.93407 WP_003403442.1.93417 WP_003403442.1.93419 WP_003403442.1.93426 WP_003403442.1.9344 WP_003403442.1.93443 WP_003403442.1.93447 WP_003403442.1.93470 WP_003403442.1.93483 WP_003403442.1.93487 WP_003403442.1.93495 WP_003403442.1.93499 WP_003403442.1.93516 WP_003403442.1.93536 WP_003403442.1.93544 WP_003403442.1.93555 WP_003403442.1.93560 WP_003403442.1.93564 WP_003403442.1.9357 WP_003403442.1.93573 WP_003403442.1.93576 WP_003403442.1.9363 WP_003403442.1.93645 WP_003403442.1.93649 WP_003403442.1.93659 WP_003403442.1.93677 WP_003403442.1.9368 WP_003403442.1.93689 WP_003403442.1.93693 WP_003403442.1.93698 WP_003403442.1.93706 WP_003403442.1.9371 WP_003403442.1.93792 WP_003403442.1.93823 WP_003403442.1.93871 WP_003403442.1.9388 WP_003403442.1.93894 WP_003403442.1.93903 WP_003403442.1.93907 WP_003403442.1.93913 WP_003403442.1.93946 WP_003403442.1.93950 WP_003403442.1.93953 WP_003403442.1.93954 WP_003403442.1.93988 WP_003403442.1.9407 WP_003403442.1.94143 WP_003403442.1.94154 WP_003403442.1.94184 WP_003403442.1.94204 WP_003403442.1.94205 WP_003403442.1.94226 WP_003403442.1.94231 WP_003403442.1.94256 WP_003403442.1.94261 WP_003403442.1.94281 WP_003403442.1.94292 WP_003403442.1.94297 WP_003403442.1.9431 WP_003403442.1.94326 WP_003403442.1.94339 WP_003403442.1.94392 WP_003403442.1.94416 WP_003403442.1.94421 WP_003403442.1.94456 WP_003403442.1.94470 WP_003403442.1.94480 WP_003403442.1.94495 WP_003403442.1.94511 WP_003403442.1.94512 WP_003403442.1.94525 WP_003403442.1.94528 WP_003403442.1.94564 WP_003403442.1.946 WP_003403442.1.94602 WP_003403442.1.94623 WP_003403442.1.94629 WP_003403442.1.9465 WP_003403442.1.94673 WP_003403442.1.94730 WP_003403442.1.94736 WP_003403442.1.94776 WP_003403442.1.9478 WP_003403442.1.94834 WP_003403442.1.94852 WP_003403442.1.94872 WP_003403442.1.9488 WP_003403442.1.94902 WP_003403442.1.94916 WP_003403442.1.94979 WP_003403442.1.94994 WP_003403442.1.94996 WP_003403442.1.94998 WP_003403442.1.95007 WP_003403442.1.95010 WP_003403442.1.95015 WP_003403442.1.95034 WP_003403442.1.95068 WP_003403442.1.95081 WP_003403442.1.95082 WP_003403442.1.9509 WP_003403442.1.95096 WP_003403442.1.95112 WP_003403442.1.95138 WP_003403442.1.9514 WP_003403442.1.95179 WP_003403442.1.95188 WP_003403442.1.95190 WP_003403442.1.95234 WP_003403442.1.95241 WP_003403442.1.95245 WP_003403442.1.95257 WP_003403442.1.95279 WP_003403442.1.9531 WP_003403442.1.95335 WP_003403442.1.95344 WP_003403442.1.9535 WP_003403442.1.95370 WP_003403442.1.95392 WP_003403442.1.95416 WP_003403442.1.95417 WP_003403442.1.95454 WP_003403442.1.95455 WP_003403442.1.95491 WP_003403442.1.95497 WP_003403442.1.95508 WP_003403442.1.95509 WP_003403442.1.95529 WP_003403442.1.95556 WP_003403442.1.95557 WP_003403442.1.95565 WP_003403442.1.95578 WP_003403442.1.95580 WP_003403442.1.95585 WP_003403442.1.95643 WP_003403442.1.95679 WP_003403442.1.95685 WP_003403442.1.957 WP_003403442.1.95724 WP_003403442.1.95727 WP_003403442.1.95730 WP_003403442.1.95735 WP_003403442.1.95758 WP_003403442.1.95772 WP_003403442.1.95797 WP_003403442.1.95839 WP_003403442.1.9585 WP_003403442.1.9590 WP_003403442.1.95902 WP_003403442.1.95908 WP_003403442.1.95924 WP_003403442.1.95926 WP_003403442.1.95953 WP_003403442.1.95958 WP_003403442.1.95964 WP_003403442.1.95973 WP_003403442.1.96006 WP_003403442.1.9602 WP_003403442.1.96036 WP_003403442.1.96062 WP_003403442.1.96065 WP_003403442.1.96098 WP_003403442.1.96146 WP_003403442.1.96166 WP_003403442.1.96171 WP_003403442.1.96182 WP_003403442.1.96204 WP_003403442.1.96230 WP_003403442.1.96235 WP_003403442.1.96242 WP_003403442.1.96245 WP_003403442.1.96254 WP_003403442.1.96259 WP_003403442.1.96286 WP_003403442.1.96313 WP_003403442.1.96318 WP_003403442.1.96345 WP_003403442.1.96360 WP_003403442.1.96373 WP_003403442.1.96456 WP_003403442.1.96486 WP_003403442.1.96560 WP_003403442.1.96569 WP_003403442.1.96573 WP_003403442.1.96575 WP_003403442.1.96576 WP_003403442.1.96611 WP_003403442.1.9667 WP_003403442.1.96681 WP_003403442.1.96726 WP_003403442.1.96733 WP_003403442.1.96754 WP_003403442.1.9678 WP_003403442.1.96832 WP_003403442.1.9685 WP_003403442.1.97008 WP_003403442.1.97009 WP_003403442.1.97056 WP_003403442.1.97084 WP_003403442.1.97087 WP_003403442.1.97094 WP_003403442.1.97096 WP_003403442.1.97099 WP_003403442.1.97108 WP_003403442.1.97113 WP_003403442.1.97122 WP_003403442.1.97127 WP_003403442.1.97129 WP_003403442.1.97136 WP_003403442.1.9716 WP_003403442.1.97176 WP_003403442.1.97222 WP_003403442.1.97223 WP_003403442.1.97237 WP_003403442.1.97242 WP_003403442.1.97270 WP_003403442.1.97283 WP_003403442.1.97296 WP_003403442.1.97321 WP_003403442.1.97325 WP_003403442.1.97330 WP_003403442.1.97366 WP_003403442.1.97376 WP_003403442.1.97380 WP_003403442.1.9739 WP_003403442.1.97462 WP_003403442.1.97519 WP_003403442.1.97535 WP_003403442.1.97540 WP_003403442.1.97545 WP_003403442.1.97546 WP_003403442.1.97550 WP_003403442.1.97568 WP_003403442.1.97577 WP_003403442.1.97584 WP_003403442.1.9759 WP_003403442.1.97591 WP_003403442.1.97596 WP_003403442.1.97609 WP_003403442.1.97618 WP_003403442.1.9763 WP_003403442.1.97669 WP_003403442.1.97673 WP_003403442.1.97700 WP_003403442.1.97701 WP_003403442.1.9773 WP_003403442.1.97730 WP_003403442.1.97740 WP_003403442.1.97751 WP_003403442.1.97754 WP_003403442.1.97797 WP_003403442.1.9782 WP_003403442.1.9784 WP_003403442.1.97888 WP_003403442.1.9790 WP_003403442.1.9795 WP_003403442.1.97951 WP_003403442.1.97958 WP_003403442.1.97966 WP_003403442.1.97977 WP_003403442.1.97979 WP_003403442.1.97995 WP_003403442.1.98018 WP_003403442.1.98034 WP_003403442.1.98052 WP_003403442.1.98071 WP_003403442.1.98072 WP_003403442.1.98113 WP_003403442.1.98114 WP_003403442.1.98128 WP_003403442.1.98181 WP_003403442.1.98188 WP_003403442.1.98189 WP_003403442.1.98213 WP_003403442.1.98225 WP_003403442.1.98291 WP_003403442.1.98335 WP_003403442.1.98350 WP_003403442.1.98395 WP_003403442.1.98412 WP_003403442.1.98441 WP_003403442.1.98443 WP_003403442.1.98462 WP_003403442.1.9848 WP_003403442.1.98482 WP_003403442.1.98486 WP_003403442.1.98488 WP_003403442.1.98503 WP_003403442.1.98516 WP_003403442.1.98524 WP_003403442.1.98536 WP_003403442.1.98541 WP_003403442.1.98566 WP_003403442.1.98576 WP_003403442.1.98590 WP_003403442.1.98594 WP_003403442.1.98599 WP_003403442.1.98629 WP_003403442.1.98645 WP_003403442.1.98646 WP_003403442.1.98649 WP_003403442.1.98656 WP_003403442.1.9867 WP_003403442.1.98674 WP_003403442.1.98697 WP_003403442.1.98701 WP_003403442.1.98739 WP_003403442.1.98749 WP_003403442.1.98765 WP_003403442.1.98770 WP_003403442.1.98777 WP_003403442.1.98802 WP_003403442.1.98838 WP_003403442.1.98850 WP_003403442.1.98906 WP_003403442.1.98935 WP_003403442.1.98948 WP_003403442.1.98953 WP_003403442.1.98984 WP_003403442.1.99000 WP_003403442.1.99023 WP_003403442.1.99030 WP_003403442.1.99037 WP_003403442.1.99055 WP_003403442.1.99062 WP_003403442.1.99086 WP_003403442.1.99115 WP_003403442.1.99117 WP_003403442.1.99161 WP_003403442.1.99176 WP_003403442.1.99205 WP_003403442.1.99211 WP_003403442.1.99216 WP_003403442.1.99222 WP_003403442.1.99251 WP_003403442.1.99269 WP_003403442.1.99294 WP_003403442.1.99322 WP_003403442.1.99328 WP_003403442.1.99365 WP_003403442.1.99368 WP_003403442.1.99379 WP_003403442.1.99396 WP_003403442.1.99402 WP_003403442.1.99404 WP_003403442.1.99419 WP_003403442.1.99438 WP_003403442.1.99460 WP_003403442.1.99468 WP_003403442.1.99473 WP_003403442.1.99513 WP_003403442.1.99529 WP_003403442.1.99548 WP_003403442.1.99572 WP_003403442.1.99575 WP_003403442.1.99578 WP_003403442.1.99605 WP_003403442.1.99609 WP_003403442.1.99635 WP_003403442.1.99650 WP_003403442.1.99672 WP_003403442.1.99701 WP_003403442.1.99711 WP_003403442.1.99716 WP_003403442.1.99740 WP_003403442.1.99745 WP_003403442.1.99749 WP_003403442.1.9976 WP_003403442.1.99798 WP_003403442.1.99817 WP_003403442.1.99832 WP_003403442.1.99847 WP_003403442.1.99852 WP_003403442.1.99886 WP_003403442.1.99897 WP_003403442.1.99899 WP_003403442.1.99915 WP_003403442.1.9993 WP_003403442.1.99982 WP_003403442.1.99991 Rv0678 gi|494699061|ref|YP_007964543.1| gi|386003711|ref|YP_005921990.1| gi|392431106|ref|YP_006472150.1| gi|253797620|ref|YP_003030621.1| gi|148821883|ref|YP_001286637.1| gi|525673486|ref|YP_008224773.1| gi|121636599|ref|YP_976822.1| gi|148660453|ref|YP_001281976.1| gi|494691314|ref|YP_007956857.1| gi|392385398|ref|YP_005307027.1| gi|339630748|ref|YP_004722390.1| gi|31791862|ref|NP_854355.1| gi|449062698|ref|YP_007429781.1| gi|385997457|ref|YP_005915755.1| gi|375294896|ref|YP_005099163.1| gi|340625697|ref|YP_004744149.1| 233413.Mb0697 336982.TBFG_10692 410289.BCG_0727 419947.MRA_0687A 478434.TBMG_00691 561275.JTY_0697 83331.MT0706.1 83332.Rv0678 gi|224989071|ref|YP_002643758.1| gi|197739444|ref|YP_002160758.1| gi|15607818|ref|NP_215192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]