SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197739500|ref|YP_002160814.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197739500|ref|YP_002160814.1|
Domain Number 1 Region: 24-162
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-24
Family MarR-like transcriptional regulators 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197739500|ref|YP_002160814.1|
Sequence length 165
Comment transcriptional regulator [Mycobacterium tuberculosis str. Haarlem]
Sequence
MASDNRDPIAAARANWERSGWGDVSLGMVAVTSVMRAHQILLARVETALRPYDLSFSRFE
LLRLLAFSRIGALPITKASDRLQVHVTSVTHAIRRLEADGLVRRVPHPTDGRTTLVQITE
LGRSTVEDATVTLNEQVFANVGMGAEESQALVSAVETLRRNAGDF
Download sequence
Identical sequences A0A0H3L752 A0A0H3M4B3 A0A197J3E0 A0A1R3XWB9 A0A1S1BF73 A0A2C5SN08 A5U0C4 F8M3A4 I3NI76 I6Y8K3 L0T7K2 M8DK38 Q7D9D2
gi|148660513|ref|YP_001282036.1| gi|479054688|ref|YP_007350494.1| gi|385997516|ref|YP_005915814.1| gi|15607877|ref|NP_215251.1| gi|392385457|ref|YP_005307086.1| gi|15840145|ref|NP_335182.1| gi|15607877|ref|NP_215251.1| gi|494699123|ref|YP_007964605.1| gi|506925160|ref|YP_008005610.1| gi|31791923|ref|NP_854416.1| gi|339630806|ref|YP_004722448.1| 233413.Mb0758 336982.TBFG_10751 410289.BCG_0787 419947.MRA_0746 478434.TBMG_00751 561275.JTY_0757 83331.MT0762 83332.Rv0737 gi|378770493|ref|YP_005170226.1| gi|433625832|ref|YP_007259461.1| gi|479313613|ref|YP_007853665.1| gi|383306638|ref|YP_005359449.1| NP_215251.1.84033 WP_003403738.1.100000 WP_003403738.1.100021 WP_003403738.1.100069 WP_003403738.1.100087 WP_003403738.1.10015 WP_003403738.1.100208 WP_003403738.1.100216 WP_003403738.1.10022 WP_003403738.1.100255 WP_003403738.1.100260 WP_003403738.1.100270 WP_003403738.1.100279 WP_003403738.1.100286 WP_003403738.1.100308 WP_003403738.1.100309 WP_003403738.1.100318 WP_003403738.1.100337 WP_003403738.1.100338 WP_003403738.1.10037 WP_003403738.1.100383 WP_003403738.1.100395 WP_003403738.1.100396 WP_003403738.1.1004 WP_003403738.1.100401 WP_003403738.1.100459 WP_003403738.1.100460 WP_003403738.1.100552 WP_003403738.1.100581 WP_003403738.1.100600 WP_003403738.1.100625 WP_003403738.1.10064 WP_003403738.1.100666 WP_003403738.1.100671 WP_003403738.1.100677 WP_003403738.1.100682 WP_003403738.1.100697 WP_003403738.1.100716 WP_003403738.1.100754 WP_003403738.1.100757 WP_003403738.1.100772 WP_003403738.1.1008 WP_003403738.1.100812 WP_003403738.1.100845 WP_003403738.1.100866 WP_003403738.1.10088 WP_003403738.1.100889 WP_003403738.1.10090 WP_003403738.1.100910 WP_003403738.1.100915 WP_003403738.1.100918 WP_003403738.1.100935 WP_003403738.1.100984 WP_003403738.1.100992 WP_003403738.1.100998 WP_003403738.1.101 WP_003403738.1.101025 WP_003403738.1.101028 WP_003403738.1.10104 WP_003403738.1.101048 WP_003403738.1.101054 WP_003403738.1.101075 WP_003403738.1.101143 WP_003403738.1.10116 WP_003403738.1.10117 WP_003403738.1.101209 WP_003403738.1.10125 WP_003403738.1.101290 WP_003403738.1.101323 WP_003403738.1.101324 WP_003403738.1.101350 WP_003403738.1.101367 WP_003403738.1.101398 WP_003403738.1.101403 WP_003403738.1.101421 WP_003403738.1.10144 WP_003403738.1.101442 WP_003403738.1.10145 WP_003403738.1.101452 WP_003403738.1.101456 WP_003403738.1.101481 WP_003403738.1.101493 WP_003403738.1.101496 WP_003403738.1.101525 WP_003403738.1.101533 WP_003403738.1.101535 WP_003403738.1.101553 WP_003403738.1.101558 WP_003403738.1.10156 WP_003403738.1.101576 WP_003403738.1.10159 WP_003403738.1.101592 WP_003403738.1.101604 WP_003403738.1.101607 WP_003403738.1.101622 WP_003403738.1.101644 WP_003403738.1.101659 WP_003403738.1.101671 WP_003403738.1.101687 WP_003403738.1.101698 WP_003403738.1.10170 WP_003403738.1.101713 WP_003403738.1.101722 WP_003403738.1.101733 WP_003403738.1.101743 WP_003403738.1.101753 WP_003403738.1.101764 WP_003403738.1.101773 WP_003403738.1.101795 WP_003403738.1.101797 WP_003403738.1.101798 WP_003403738.1.101802 WP_003403738.1.101826 WP_003403738.1.101836 WP_003403738.1.101858 WP_003403738.1.101859 WP_003403738.1.101862 WP_003403738.1.101888 WP_003403738.1.101894 WP_003403738.1.101899 WP_003403738.1.1019 WP_003403738.1.101923 WP_003403738.1.101925 WP_003403738.1.10193 WP_003403738.1.101996 WP_003403738.1.102 WP_003403738.1.102008 WP_003403738.1.102017 WP_003403738.1.102053 WP_003403738.1.102055 WP_003403738.1.102063 WP_003403738.1.102099 WP_003403738.1.1021 WP_003403738.1.10211 WP_003403738.1.102119 WP_003403738.1.102121 WP_003403738.1.102143 WP_003403738.1.10216 WP_003403738.1.10224 WP_003403738.1.10253 WP_003403738.1.10262 WP_003403738.1.10272 WP_003403738.1.10277 WP_003403738.1.1033 WP_003403738.1.10350 WP_003403738.1.10362 WP_003403738.1.10366 WP_003403738.1.10376 WP_003403738.1.10410 WP_003403738.1.10414 WP_003403738.1.10421 WP_003403738.1.10430 WP_003403738.1.1044 WP_003403738.1.10440 WP_003403738.1.10471 WP_003403738.1.10472 WP_003403738.1.10489 WP_003403738.1.105 WP_003403738.1.10518 WP_003403738.1.10523 WP_003403738.1.10545 WP_003403738.1.1057 WP_003403738.1.10594 WP_003403738.1.10603 WP_003403738.1.10606 WP_003403738.1.10615 WP_003403738.1.10623 WP_003403738.1.10635 WP_003403738.1.10643 WP_003403738.1.10648 WP_003403738.1.10662 WP_003403738.1.10709 WP_003403738.1.10735 WP_003403738.1.10740 WP_003403738.1.10756 WP_003403738.1.1078 WP_003403738.1.10791 WP_003403738.1.10799 WP_003403738.1.10825 WP_003403738.1.10848 WP_003403738.1.10863 WP_003403738.1.10879 WP_003403738.1.10912 WP_003403738.1.10916 WP_003403738.1.10923 WP_003403738.1.10927 WP_003403738.1.1095 WP_003403738.1.10956 WP_003403738.1.10958 WP_003403738.1.10962 WP_003403738.1.10980 WP_003403738.1.10981 WP_003403738.1.10993 WP_003403738.1.1100 WP_003403738.1.11040 WP_003403738.1.11061 WP_003403738.1.11070 WP_003403738.1.11141 WP_003403738.1.11171 WP_003403738.1.11175 WP_003403738.1.11176 WP_003403738.1.11222 WP_003403738.1.11236 WP_003403738.1.11329 WP_003403738.1.1133 WP_003403738.1.11342 WP_003403738.1.11373 WP_003403738.1.11376 WP_003403738.1.11390 WP_003403738.1.11402 WP_003403738.1.11481 WP_003403738.1.11487 WP_003403738.1.11489 WP_003403738.1.11491 WP_003403738.1.11514 WP_003403738.1.11587 WP_003403738.1.11589 WP_003403738.1.11596 WP_003403738.1.11604 WP_003403738.1.11610 WP_003403738.1.11697 WP_003403738.1.11707 WP_003403738.1.11752 WP_003403738.1.11758 WP_003403738.1.11761 WP_003403738.1.11775 WP_003403738.1.11804 WP_003403738.1.11822 WP_003403738.1.11826 WP_003403738.1.11856 WP_003403738.1.11898 WP_003403738.1.11906 WP_003403738.1.11939 WP_003403738.1.11960 WP_003403738.1.11961 WP_003403738.1.11972 WP_003403738.1.11984 WP_003403738.1.120 WP_003403738.1.12001 WP_003403738.1.12049 WP_003403738.1.12052 WP_003403738.1.12100 WP_003403738.1.12130 WP_003403738.1.12133 WP_003403738.1.12161 WP_003403738.1.12165 WP_003403738.1.12184 WP_003403738.1.12187 WP_003403738.1.12190 WP_003403738.1.12216 WP_003403738.1.12265 WP_003403738.1.12275 WP_003403738.1.12293 WP_003403738.1.12294 WP_003403738.1.123 WP_003403738.1.1231 WP_003403738.1.12314 WP_003403738.1.12327 WP_003403738.1.12338 WP_003403738.1.1236 WP_003403738.1.12371 WP_003403738.1.12372 WP_003403738.1.12389 WP_003403738.1.12406 WP_003403738.1.1241 WP_003403738.1.12421 WP_003403738.1.12424 WP_003403738.1.12446 WP_003403738.1.12464 WP_003403738.1.12479 WP_003403738.1.12519 WP_003403738.1.12523 WP_003403738.1.12526 WP_003403738.1.1255 WP_003403738.1.12550 WP_003403738.1.12551 WP_003403738.1.12563 WP_003403738.1.12611 WP_003403738.1.12669 WP_003403738.1.1267 WP_003403738.1.12672 WP_003403738.1.12692 WP_003403738.1.1271 WP_003403738.1.12710 WP_003403738.1.12768 WP_003403738.1.1279 WP_003403738.1.12794 WP_003403738.1.12801 WP_003403738.1.12804 WP_003403738.1.12821 WP_003403738.1.12841 WP_003403738.1.12854 WP_003403738.1.12871 WP_003403738.1.12901 WP_003403738.1.12941 WP_003403738.1.12947 WP_003403738.1.12957 WP_003403738.1.12972 WP_003403738.1.13028 WP_003403738.1.13043 WP_003403738.1.13086 WP_003403738.1.13087 WP_003403738.1.13090 WP_003403738.1.13096 WP_003403738.1.13163 WP_003403738.1.13175 WP_003403738.1.13183 WP_003403738.1.132 WP_003403738.1.13249 WP_003403738.1.13282 WP_003403738.1.13284 WP_003403738.1.13296 WP_003403738.1.13298 WP_003403738.1.13302 WP_003403738.1.13306 WP_003403738.1.13312 WP_003403738.1.13313 WP_003403738.1.13321 WP_003403738.1.13345 WP_003403738.1.13358 WP_003403738.1.13370 WP_003403738.1.13375 WP_003403738.1.1338 WP_003403738.1.13420 WP_003403738.1.13433 WP_003403738.1.13435 WP_003403738.1.13438 WP_003403738.1.13461 WP_003403738.1.13466 WP_003403738.1.13489 WP_003403738.1.13526 WP_003403738.1.13551 WP_003403738.1.13561 WP_003403738.1.13564 WP_003403738.1.13579 WP_003403738.1.13647 WP_003403738.1.13667 WP_003403738.1.13687 WP_003403738.1.13697 WP_003403738.1.13719 WP_003403738.1.13763 WP_003403738.1.1377 WP_003403738.1.13774 WP_003403738.1.13786 WP_003403738.1.13793 WP_003403738.1.13794 WP_003403738.1.13817 WP_003403738.1.13834 WP_003403738.1.13866 WP_003403738.1.13880 WP_003403738.1.13899 WP_003403738.1.13909 WP_003403738.1.13910 WP_003403738.1.13919 WP_003403738.1.13920 WP_003403738.1.13952 WP_003403738.1.13953 WP_003403738.1.13962 WP_003403738.1.1398 WP_003403738.1.13988 WP_003403738.1.14046 WP_003403738.1.14115 WP_003403738.1.1415 WP_003403738.1.14152 WP_003403738.1.14158 WP_003403738.1.14162 WP_003403738.1.14175 WP_003403738.1.14178 WP_003403738.1.14194 WP_003403738.1.14195 WP_003403738.1.14238 WP_003403738.1.14266 WP_003403738.1.14273 WP_003403738.1.14303 WP_003403738.1.14306 WP_003403738.1.14307 WP_003403738.1.14310 WP_003403738.1.14341 WP_003403738.1.14382 WP_003403738.1.14416 WP_003403738.1.14428 WP_003403738.1.14441 WP_003403738.1.14469 WP_003403738.1.14477 WP_003403738.1.14504 WP_003403738.1.14514 WP_003403738.1.1452 WP_003403738.1.14527 WP_003403738.1.1454 WP_003403738.1.14544 WP_003403738.1.14548 WP_003403738.1.14551 WP_003403738.1.14561 WP_003403738.1.14573 WP_003403738.1.1462 WP_003403738.1.14658 WP_003403738.1.14667 WP_003403738.1.14668 WP_003403738.1.14675 WP_003403738.1.14694 WP_003403738.1.14695 WP_003403738.1.14709 WP_003403738.1.14766 WP_003403738.1.14783 WP_003403738.1.14865 WP_003403738.1.14872 WP_003403738.1.14905 WP_003403738.1.14926 WP_003403738.1.14951 WP_003403738.1.14955 WP_003403738.1.15003 WP_003403738.1.15009 WP_003403738.1.15028 WP_003403738.1.15040 WP_003403738.1.15052 WP_003403738.1.15065 WP_003403738.1.15072 WP_003403738.1.15089 WP_003403738.1.1509 WP_003403738.1.15126 WP_003403738.1.15131 WP_003403738.1.15168 WP_003403738.1.15172 WP_003403738.1.15174 WP_003403738.1.15187 WP_003403738.1.15196 WP_003403738.1.15210 WP_003403738.1.15216 WP_003403738.1.15217 WP_003403738.1.1523 WP_003403738.1.15232 WP_003403738.1.15238 WP_003403738.1.15240 WP_003403738.1.15253 WP_003403738.1.15267 WP_003403738.1.1527 WP_003403738.1.15292 WP_003403738.1.15299 WP_003403738.1.15302 WP_003403738.1.15322 WP_003403738.1.1534 WP_003403738.1.15345 WP_003403738.1.15365 WP_003403738.1.15372 WP_003403738.1.15386 WP_003403738.1.15387 WP_003403738.1.15442 WP_003403738.1.15447 WP_003403738.1.15449 WP_003403738.1.15477 WP_003403738.1.15481 WP_003403738.1.15492 WP_003403738.1.15511 WP_003403738.1.15512 WP_003403738.1.15558 WP_003403738.1.15559 WP_003403738.1.15566 WP_003403738.1.15599 WP_003403738.1.1560 WP_003403738.1.15611 WP_003403738.1.1563 WP_003403738.1.15633 WP_003403738.1.15643 WP_003403738.1.15688 WP_003403738.1.15755 WP_003403738.1.15763 WP_003403738.1.15774 WP_003403738.1.1578 WP_003403738.1.15780 WP_003403738.1.15827 WP_003403738.1.15834 WP_003403738.1.15853 WP_003403738.1.15870 WP_003403738.1.15877 WP_003403738.1.15893 WP_003403738.1.15896 WP_003403738.1.15926 WP_003403738.1.15933 WP_003403738.1.15946 WP_003403738.1.15958 WP_003403738.1.15973 WP_003403738.1.15987 WP_003403738.1.15993 WP_003403738.1.16009 WP_003403738.1.16025 WP_003403738.1.16043 WP_003403738.1.16055 WP_003403738.1.16066 WP_003403738.1.16069 WP_003403738.1.16077 WP_003403738.1.16106 WP_003403738.1.16108 WP_003403738.1.16110 WP_003403738.1.16130 WP_003403738.1.16136 WP_003403738.1.16139 WP_003403738.1.16141 WP_003403738.1.16143 WP_003403738.1.1630 WP_003403738.1.16318 WP_003403738.1.1632 WP_003403738.1.16327 WP_003403738.1.16334 WP_003403738.1.16341 WP_003403738.1.16345 WP_003403738.1.16374 WP_003403738.1.16384 WP_003403738.1.16386 WP_003403738.1.164 WP_003403738.1.1642 WP_003403738.1.16421 WP_003403738.1.16424 WP_003403738.1.16426 WP_003403738.1.16431 WP_003403738.1.16438 WP_003403738.1.1644 WP_003403738.1.16442 WP_003403738.1.16448 WP_003403738.1.16451 WP_003403738.1.16476 WP_003403738.1.16480 WP_003403738.1.16494 WP_003403738.1.1652 WP_003403738.1.16549 WP_003403738.1.16560 WP_003403738.1.16598 WP_003403738.1.16609 WP_003403738.1.16619 WP_003403738.1.16620 WP_003403738.1.16622 WP_003403738.1.16637 WP_003403738.1.1669 WP_003403738.1.16707 WP_003403738.1.16724 WP_003403738.1.16731 WP_003403738.1.16743 WP_003403738.1.1683 WP_003403738.1.16837 WP_003403738.1.16852 WP_003403738.1.16937 WP_003403738.1.16940 WP_003403738.1.16959 WP_003403738.1.16968 WP_003403738.1.1697 WP_003403738.1.16973 WP_003403738.1.16977 WP_003403738.1.16987 WP_003403738.1.17005 WP_003403738.1.17006 WP_003403738.1.17010 WP_003403738.1.17015 WP_003403738.1.17019 WP_003403738.1.17039 WP_003403738.1.17041 WP_003403738.1.17052 WP_003403738.1.17057 WP_003403738.1.17062 WP_003403738.1.1707 WP_003403738.1.17094 WP_003403738.1.17130 WP_003403738.1.17138 WP_003403738.1.17147 WP_003403738.1.17167 WP_003403738.1.17224 WP_003403738.1.17251 WP_003403738.1.17288 WP_003403738.1.17304 WP_003403738.1.17314 WP_003403738.1.17345 WP_003403738.1.17381 WP_003403738.1.17391 WP_003403738.1.17412 WP_003403738.1.1743 WP_003403738.1.17440 WP_003403738.1.17466 WP_003403738.1.17477 WP_003403738.1.17483 WP_003403738.1.17505 WP_003403738.1.17527 WP_003403738.1.17535 WP_003403738.1.17540 WP_003403738.1.17553 WP_003403738.1.17558 WP_003403738.1.17599 WP_003403738.1.17635 WP_003403738.1.17655 WP_003403738.1.17679 WP_003403738.1.1768 WP_003403738.1.17687 WP_003403738.1.17700 WP_003403738.1.17710 WP_003403738.1.17713 WP_003403738.1.17722 WP_003403738.1.17746 WP_003403738.1.17788 WP_003403738.1.17798 WP_003403738.1.17803 WP_003403738.1.17816 WP_003403738.1.17821 WP_003403738.1.17830 WP_003403738.1.17868 WP_003403738.1.17878 WP_003403738.1.1792 WP_003403738.1.17923 WP_003403738.1.1795 WP_003403738.1.17955 WP_003403738.1.17973 WP_003403738.1.18009 WP_003403738.1.18013 WP_003403738.1.18033 WP_003403738.1.18057 WP_003403738.1.18065 WP_003403738.1.18070 WP_003403738.1.18116 WP_003403738.1.18120 WP_003403738.1.18126 WP_003403738.1.1817 WP_003403738.1.18170 WP_003403738.1.18206 WP_003403738.1.18216 WP_003403738.1.18240 WP_003403738.1.18257 WP_003403738.1.18297 WP_003403738.1.18306 WP_003403738.1.18364 WP_003403738.1.18399 WP_003403738.1.18411 WP_003403738.1.18444 WP_003403738.1.18448 WP_003403738.1.18467 WP_003403738.1.18476 WP_003403738.1.18522 WP_003403738.1.18580 WP_003403738.1.18582 WP_003403738.1.18587 WP_003403738.1.186 WP_003403738.1.18601 WP_003403738.1.18639 WP_003403738.1.18646 WP_003403738.1.18647 WP_003403738.1.1868 WP_003403738.1.18694 WP_003403738.1.18710 WP_003403738.1.18751 WP_003403738.1.18781 WP_003403738.1.18793 WP_003403738.1.18804 WP_003403738.1.18816 WP_003403738.1.18823 WP_003403738.1.18827 WP_003403738.1.18838 WP_003403738.1.18849 WP_003403738.1.18856 WP_003403738.1.18945 WP_003403738.1.1898 WP_003403738.1.19005 WP_003403738.1.19056 WP_003403738.1.19063 WP_003403738.1.19066 WP_003403738.1.19071 WP_003403738.1.19085 WP_003403738.1.19094 WP_003403738.1.19144 WP_003403738.1.19159 WP_003403738.1.19193 WP_003403738.1.19231 WP_003403738.1.19243 WP_003403738.1.19264 WP_003403738.1.19295 WP_003403738.1.19307 WP_003403738.1.19326 WP_003403738.1.1933 WP_003403738.1.19364 WP_003403738.1.19382 WP_003403738.1.19400 WP_003403738.1.19426 WP_003403738.1.19429 WP_003403738.1.19464 WP_003403738.1.19480 WP_003403738.1.19512 WP_003403738.1.19553 WP_003403738.1.19562 WP_003403738.1.19564 WP_003403738.1.19568 WP_003403738.1.19572 WP_003403738.1.19595 WP_003403738.1.19596 WP_003403738.1.19600 WP_003403738.1.19630 WP_003403738.1.1967 WP_003403738.1.19694 WP_003403738.1.1970 WP_003403738.1.19707 WP_003403738.1.19742 WP_003403738.1.19785 WP_003403738.1.19820 WP_003403738.1.19868 WP_003403738.1.19874 WP_003403738.1.19890 WP_003403738.1.19900 WP_003403738.1.19922 WP_003403738.1.19936 WP_003403738.1.19946 WP_003403738.1.19949 WP_003403738.1.19960 WP_003403738.1.19964 WP_003403738.1.20007 WP_003403738.1.20016 WP_003403738.1.20028 WP_003403738.1.2003 WP_003403738.1.20037 WP_003403738.1.20039 WP_003403738.1.20082 WP_003403738.1.20085 WP_003403738.1.20097 WP_003403738.1.20116 WP_003403738.1.20130 WP_003403738.1.20140 WP_003403738.1.20141 WP_003403738.1.20142 WP_003403738.1.20158 WP_003403738.1.20239 WP_003403738.1.20243 WP_003403738.1.20259 WP_003403738.1.20268 WP_003403738.1.20272 WP_003403738.1.20273 WP_003403738.1.20280 WP_003403738.1.20294 WP_003403738.1.20300 WP_003403738.1.20309 WP_003403738.1.20322 WP_003403738.1.2037 WP_003403738.1.20372 WP_003403738.1.20381 WP_003403738.1.204 WP_003403738.1.20427 WP_003403738.1.20432 WP_003403738.1.20457 WP_003403738.1.20459 WP_003403738.1.20460 WP_003403738.1.20542 WP_003403738.1.20578 WP_003403738.1.20608 WP_003403738.1.20624 WP_003403738.1.20628 WP_003403738.1.2066 WP_003403738.1.20707 WP_003403738.1.20722 WP_003403738.1.20742 WP_003403738.1.20751 WP_003403738.1.20776 WP_003403738.1.20843 WP_003403738.1.20850 WP_003403738.1.2086 WP_003403738.1.20868 WP_003403738.1.20876 WP_003403738.1.20897 WP_003403738.1.20898 WP_003403738.1.2090 WP_003403738.1.20911 WP_003403738.1.20916 WP_003403738.1.20921 WP_003403738.1.20926 WP_003403738.1.20927 WP_003403738.1.20951 WP_003403738.1.20970 WP_003403738.1.2104 WP_003403738.1.21135 WP_003403738.1.21173 WP_003403738.1.21187 WP_003403738.1.212 WP_003403738.1.2120 WP_003403738.1.21218 WP_003403738.1.2123 WP_003403738.1.21231 WP_003403738.1.21234 WP_003403738.1.2126 WP_003403738.1.21292 WP_003403738.1.21307 WP_003403738.1.2131 WP_003403738.1.21311 WP_003403738.1.21321 WP_003403738.1.21365 WP_003403738.1.2137 WP_003403738.1.21392 WP_003403738.1.21397 WP_003403738.1.21403 WP_003403738.1.21415 WP_003403738.1.21418 WP_003403738.1.21430 WP_003403738.1.21434 WP_003403738.1.21444 WP_003403738.1.21468 WP_003403738.1.21498 WP_003403738.1.21509 WP_003403738.1.21513 WP_003403738.1.21560 WP_003403738.1.21565 WP_003403738.1.21586 WP_003403738.1.21591 WP_003403738.1.21594 WP_003403738.1.21602 WP_003403738.1.21615 WP_003403738.1.21638 WP_003403738.1.21639 WP_003403738.1.21655 WP_003403738.1.21658 WP_003403738.1.2168 WP_003403738.1.2174 WP_003403738.1.21741 WP_003403738.1.21742 WP_003403738.1.21777 WP_003403738.1.21786 WP_003403738.1.21795 WP_003403738.1.218 WP_003403738.1.21826 WP_003403738.1.21829 WP_003403738.1.21840 WP_003403738.1.21843 WP_003403738.1.21872 WP_003403738.1.21873 WP_003403738.1.2188 WP_003403738.1.21882 WP_003403738.1.21906 WP_003403738.1.21912 WP_003403738.1.2194 WP_003403738.1.21941 WP_003403738.1.21956 WP_003403738.1.21958 WP_003403738.1.21960 WP_003403738.1.21971 WP_003403738.1.21973 WP_003403738.1.21983 WP_003403738.1.22003 WP_003403738.1.22013 WP_003403738.1.22025 WP_003403738.1.22036 WP_003403738.1.22075 WP_003403738.1.22092 WP_003403738.1.2212 WP_003403738.1.22127 WP_003403738.1.22140 WP_003403738.1.22233 WP_003403738.1.22255 WP_003403738.1.22277 WP_003403738.1.22305 WP_003403738.1.22348 WP_003403738.1.22356 WP_003403738.1.22366 WP_003403738.1.2238 WP_003403738.1.22380 WP_003403738.1.22437 WP_003403738.1.22438 WP_003403738.1.22445 WP_003403738.1.22490 WP_003403738.1.22511 WP_003403738.1.22524 WP_003403738.1.2253 WP_003403738.1.22585 WP_003403738.1.22589 WP_003403738.1.22606 WP_003403738.1.22608 WP_003403738.1.22609 WP_003403738.1.22618 WP_003403738.1.2262 WP_003403738.1.22624 WP_003403738.1.22629 WP_003403738.1.22647 WP_003403738.1.22664 WP_003403738.1.22665 WP_003403738.1.22670 WP_003403738.1.22674 WP_003403738.1.22680 WP_003403738.1.22725 WP_003403738.1.22728 WP_003403738.1.22733 WP_003403738.1.22737 WP_003403738.1.2275 WP_003403738.1.22754 WP_003403738.1.22797 WP_003403738.1.22800 WP_003403738.1.22804 WP_003403738.1.22829 WP_003403738.1.22840 WP_003403738.1.22844 WP_003403738.1.22963 WP_003403738.1.22970 WP_003403738.1.22996 WP_003403738.1.22997 WP_003403738.1.22999 WP_003403738.1.23015 WP_003403738.1.23032 WP_003403738.1.231 WP_003403738.1.23101 WP_003403738.1.2312 WP_003403738.1.23140 WP_003403738.1.23153 WP_003403738.1.23171 WP_003403738.1.23199 WP_003403738.1.2320 WP_003403738.1.23204 WP_003403738.1.23216 WP_003403738.1.23229 WP_003403738.1.23233 WP_003403738.1.2326 WP_003403738.1.23261 WP_003403738.1.23272 WP_003403738.1.23289 WP_003403738.1.2329 WP_003403738.1.23308 WP_003403738.1.23316 WP_003403738.1.23321 WP_003403738.1.23325 WP_003403738.1.2339 WP_003403738.1.23406 WP_003403738.1.23438 WP_003403738.1.23445 WP_003403738.1.23447 WP_003403738.1.23452 WP_003403738.1.23461 WP_003403738.1.2349 WP_003403738.1.23496 WP_003403738.1.23497 WP_003403738.1.23506 WP_003403738.1.23530 WP_003403738.1.23539 WP_003403738.1.23546 WP_003403738.1.23551 WP_003403738.1.23573 WP_003403738.1.23583 WP_003403738.1.23588 WP_003403738.1.23628 WP_003403738.1.23677 WP_003403738.1.23683 WP_003403738.1.23692 WP_003403738.1.23694 WP_003403738.1.23699 WP_003403738.1.2371 WP_003403738.1.23803 WP_003403738.1.23807 WP_003403738.1.23825 WP_003403738.1.23832 WP_003403738.1.2384 WP_003403738.1.23843 WP_003403738.1.23863 WP_003403738.1.2387 WP_003403738.1.23894 WP_003403738.1.23993 WP_003403738.1.2400 WP_003403738.1.24007 WP_003403738.1.24008 WP_003403738.1.24046 WP_003403738.1.24057 WP_003403738.1.24113 WP_003403738.1.24119 WP_003403738.1.24128 WP_003403738.1.24140 WP_003403738.1.24176 WP_003403738.1.24190 WP_003403738.1.24202 WP_003403738.1.24244 WP_003403738.1.24261 WP_003403738.1.24284 WP_003403738.1.24294 WP_003403738.1.24357 WP_003403738.1.24396 WP_003403738.1.24414 WP_003403738.1.24423 WP_003403738.1.2443 WP_003403738.1.24446 WP_003403738.1.24461 WP_003403738.1.24500 WP_003403738.1.24507 WP_003403738.1.24509 WP_003403738.1.24529 WP_003403738.1.24553 WP_003403738.1.24599 WP_003403738.1.24629 WP_003403738.1.24638 WP_003403738.1.24648 WP_003403738.1.2466 WP_003403738.1.24767 WP_003403738.1.24824 WP_003403738.1.24831 WP_003403738.1.24840 WP_003403738.1.24848 WP_003403738.1.24857 WP_003403738.1.2487 WP_003403738.1.24893 WP_003403738.1.24907 WP_003403738.1.24933 WP_003403738.1.24956 WP_003403738.1.24958 WP_003403738.1.24985 WP_003403738.1.2499 WP_003403738.1.25004 WP_003403738.1.2505 WP_003403738.1.25051 WP_003403738.1.2507 WP_003403738.1.25096 WP_003403738.1.25103 WP_003403738.1.25129 WP_003403738.1.25171 WP_003403738.1.25184 WP_003403738.1.25247 WP_003403738.1.25252 WP_003403738.1.25278 WP_003403738.1.25283 WP_003403738.1.25309 WP_003403738.1.25313 WP_003403738.1.25338 WP_003403738.1.25342 WP_003403738.1.25343 WP_003403738.1.25367 WP_003403738.1.25393 WP_003403738.1.25406 WP_003403738.1.25435 WP_003403738.1.25437 WP_003403738.1.25445 WP_003403738.1.25455 WP_003403738.1.25473 WP_003403738.1.25504 WP_003403738.1.25513 WP_003403738.1.25542 WP_003403738.1.25579 WP_003403738.1.25594 WP_003403738.1.25606 WP_003403738.1.25645 WP_003403738.1.2566 WP_003403738.1.25673 WP_003403738.1.25674 WP_003403738.1.25693 WP_003403738.1.25699 WP_003403738.1.25727 WP_003403738.1.25736 WP_003403738.1.25738 WP_003403738.1.25756 WP_003403738.1.25759 WP_003403738.1.2580 WP_003403738.1.25813 WP_003403738.1.25853 WP_003403738.1.25854 WP_003403738.1.25874 WP_003403738.1.25885 WP_003403738.1.25892 WP_003403738.1.25906 WP_003403738.1.25914 WP_003403738.1.25916 WP_003403738.1.2594 WP_003403738.1.25954 WP_003403738.1.25965 WP_003403738.1.25972 WP_003403738.1.26017 WP_003403738.1.26032 WP_003403738.1.26038 WP_003403738.1.26072 WP_003403738.1.26089 WP_003403738.1.26097 WP_003403738.1.26098 WP_003403738.1.26108 WP_003403738.1.26109 WP_003403738.1.26118 WP_003403738.1.26126 WP_003403738.1.2614 WP_003403738.1.26168 WP_003403738.1.26182 WP_003403738.1.26190 WP_003403738.1.2620 WP_003403738.1.26234 WP_003403738.1.26243 WP_003403738.1.26265 WP_003403738.1.26267 WP_003403738.1.26292 WP_003403738.1.26310 WP_003403738.1.26328 WP_003403738.1.26349 WP_003403738.1.26366 WP_003403738.1.26374 WP_003403738.1.26407 WP_003403738.1.26412 WP_003403738.1.26454 WP_003403738.1.26464 WP_003403738.1.2653 WP_003403738.1.26560 WP_003403738.1.26571 WP_003403738.1.2659 WP_003403738.1.26597 WP_003403738.1.26603 WP_003403738.1.26629 WP_003403738.1.26651 WP_003403738.1.26702 WP_003403738.1.26707 WP_003403738.1.26710 WP_003403738.1.26719 WP_003403738.1.26737 WP_003403738.1.26738 WP_003403738.1.26756 WP_003403738.1.2676 WP_003403738.1.2677 WP_003403738.1.26779 WP_003403738.1.26780 WP_003403738.1.26798 WP_003403738.1.26854 WP_003403738.1.26868 WP_003403738.1.26876 WP_003403738.1.26888 WP_003403738.1.26914 WP_003403738.1.26945 WP_003403738.1.26959 WP_003403738.1.26969 WP_003403738.1.26984 WP_003403738.1.26992 WP_003403738.1.27004 WP_003403738.1.27017 WP_003403738.1.27045 WP_003403738.1.27074 WP_003403738.1.27075 WP_003403738.1.27128 WP_003403738.1.27130 WP_003403738.1.27139 WP_003403738.1.27152 WP_003403738.1.27162 WP_003403738.1.27164 WP_003403738.1.27193 WP_003403738.1.27235 WP_003403738.1.27254 WP_003403738.1.27278 WP_003403738.1.27343 WP_003403738.1.27352 WP_003403738.1.27369 WP_003403738.1.27391 WP_003403738.1.27398 WP_003403738.1.27402 WP_003403738.1.27410 WP_003403738.1.27411 WP_003403738.1.27449 WP_003403738.1.27460 WP_003403738.1.27463 WP_003403738.1.2749 WP_003403738.1.27492 WP_003403738.1.27528 WP_003403738.1.27541 WP_003403738.1.27576 WP_003403738.1.27582 WP_003403738.1.27596 WP_003403738.1.27607 WP_003403738.1.2766 WP_003403738.1.277 WP_003403738.1.27724 WP_003403738.1.27730 WP_003403738.1.27736 WP_003403738.1.27743 WP_003403738.1.27771 WP_003403738.1.27779 WP_003403738.1.27803 WP_003403738.1.27819 WP_003403738.1.27835 WP_003403738.1.27915 WP_003403738.1.27935 WP_003403738.1.27962 WP_003403738.1.28053 WP_003403738.1.28092 WP_003403738.1.28106 WP_003403738.1.28131 WP_003403738.1.28142 WP_003403738.1.28159 WP_003403738.1.2816 WP_003403738.1.28161 WP_003403738.1.28192 WP_003403738.1.28202 WP_003403738.1.28241 WP_003403738.1.28242 WP_003403738.1.28251 WP_003403738.1.28255 WP_003403738.1.28269 WP_003403738.1.28276 WP_003403738.1.28293 WP_003403738.1.28331 WP_003403738.1.28367 WP_003403738.1.28378 WP_003403738.1.28391 WP_003403738.1.2842 WP_003403738.1.28448 WP_003403738.1.2847 WP_003403738.1.28471 WP_003403738.1.28473 WP_003403738.1.28493 WP_003403738.1.28497 WP_003403738.1.28530 WP_003403738.1.28545 WP_003403738.1.28561 WP_003403738.1.28567 WP_003403738.1.28585 WP_003403738.1.286 WP_003403738.1.28610 WP_003403738.1.28617 WP_003403738.1.28634 WP_003403738.1.28642 WP_003403738.1.28671 WP_003403738.1.28682 WP_003403738.1.28698 WP_003403738.1.28703 WP_003403738.1.28739 WP_003403738.1.28758 WP_003403738.1.28781 WP_003403738.1.28787 WP_003403738.1.28827 WP_003403738.1.28839 WP_003403738.1.28847 WP_003403738.1.28850 WP_003403738.1.28851 WP_003403738.1.28865 WP_003403738.1.28897 WP_003403738.1.28914 WP_003403738.1.28935 WP_003403738.1.28936 WP_003403738.1.28939 WP_003403738.1.28943 WP_003403738.1.28952 WP_003403738.1.28975 WP_003403738.1.2899 WP_003403738.1.28993 WP_003403738.1.29000 WP_003403738.1.2901 WP_003403738.1.29028 WP_003403738.1.29033 WP_003403738.1.29058 WP_003403738.1.29078 WP_003403738.1.29102 WP_003403738.1.29115 WP_003403738.1.2916 WP_003403738.1.29217 WP_003403738.1.29223 WP_003403738.1.29234 WP_003403738.1.29264 WP_003403738.1.29275 WP_003403738.1.29306 WP_003403738.1.29339 WP_003403738.1.29348 WP_003403738.1.29364 WP_003403738.1.29367 WP_003403738.1.2938 WP_003403738.1.29399 WP_003403738.1.29426 WP_003403738.1.29449 WP_003403738.1.29450 WP_003403738.1.29452 WP_003403738.1.2949 WP_003403738.1.29510 WP_003403738.1.29515 WP_003403738.1.29525 WP_003403738.1.2953 WP_003403738.1.29559 WP_003403738.1.29587 WP_003403738.1.2959 WP_003403738.1.29592 WP_003403738.1.29599 WP_003403738.1.29611 WP_003403738.1.29632 WP_003403738.1.29649 WP_003403738.1.2965 WP_003403738.1.29659 WP_003403738.1.2969 WP_003403738.1.29696 WP_003403738.1.29698 WP_003403738.1.29718 WP_003403738.1.29742 WP_003403738.1.29745 WP_003403738.1.29747 WP_003403738.1.29769 WP_003403738.1.29825 WP_003403738.1.29830 WP_003403738.1.29847 WP_003403738.1.29861 WP_003403738.1.29869 WP_003403738.1.29883 WP_003403738.1.29890 WP_003403738.1.299 WP_003403738.1.29931 WP_003403738.1.29960 WP_003403738.1.30014 WP_003403738.1.3004 WP_003403738.1.30040 WP_003403738.1.30043 WP_003403738.1.30074 WP_003403738.1.30097 WP_003403738.1.30101 WP_003403738.1.30106 WP_003403738.1.30114 WP_003403738.1.30126 WP_003403738.1.30131 WP_003403738.1.30138 WP_003403738.1.30139 WP_003403738.1.30145 WP_003403738.1.30211 WP_003403738.1.30224 WP_003403738.1.30235 WP_003403738.1.30237 WP_003403738.1.3027 WP_003403738.1.30279 WP_003403738.1.30282 WP_003403738.1.30283 WP_003403738.1.30288 WP_003403738.1.30291 WP_003403738.1.30363 WP_003403738.1.30374 WP_003403738.1.30404 WP_003403738.1.3043 WP_003403738.1.30433 WP_003403738.1.30438 WP_003403738.1.30462 WP_003403738.1.30464 WP_003403738.1.30468 WP_003403738.1.30500 WP_003403738.1.3057 WP_003403738.1.30574 WP_003403738.1.30628 WP_003403738.1.30641 WP_003403738.1.30642 WP_003403738.1.30661 WP_003403738.1.30669 WP_003403738.1.30683 WP_003403738.1.30699 WP_003403738.1.30709 WP_003403738.1.30713 WP_003403738.1.30716 WP_003403738.1.30719 WP_003403738.1.30730 WP_003403738.1.30732 WP_003403738.1.30736 WP_003403738.1.30745 WP_003403738.1.30760 WP_003403738.1.30791 WP_003403738.1.308 WP_003403738.1.30807 WP_003403738.1.30818 WP_003403738.1.30824 WP_003403738.1.30848 WP_003403738.1.30877 WP_003403738.1.30888 WP_003403738.1.30901 WP_003403738.1.30903 WP_003403738.1.30912 WP_003403738.1.30913 WP_003403738.1.30914 WP_003403738.1.30919 WP_003403738.1.30977 WP_003403738.1.3100 WP_003403738.1.31002 WP_003403738.1.3101 WP_003403738.1.31034 WP_003403738.1.31047 WP_003403738.1.31070 WP_003403738.1.31074 WP_003403738.1.31102 WP_003403738.1.31127 WP_003403738.1.31184 WP_003403738.1.31199 WP_003403738.1.31226 WP_003403738.1.31230 WP_003403738.1.31233 WP_003403738.1.31263 WP_003403738.1.31264 WP_003403738.1.31270 WP_003403738.1.31287 WP_003403738.1.31290 WP_003403738.1.31304 WP_003403738.1.31346 WP_003403738.1.31348 WP_003403738.1.31354 WP_003403738.1.31390 WP_003403738.1.31414 WP_003403738.1.31417 WP_003403738.1.31428 WP_003403738.1.3143 WP_003403738.1.31458 WP_003403738.1.31483 WP_003403738.1.3149 WP_003403738.1.31498 WP_003403738.1.31507 WP_003403738.1.31537 WP_003403738.1.31548 WP_003403738.1.31569 WP_003403738.1.31573 WP_003403738.1.316 WP_003403738.1.31629 WP_003403738.1.31666 WP_003403738.1.31693 WP_003403738.1.31703 WP_003403738.1.31744 WP_003403738.1.31745 WP_003403738.1.31770 WP_003403738.1.31776 WP_003403738.1.31783 WP_003403738.1.318 WP_003403738.1.3184 WP_003403738.1.31840 WP_003403738.1.31880 WP_003403738.1.31911 WP_003403738.1.31930 WP_003403738.1.31932 WP_003403738.1.31955 WP_003403738.1.31985 WP_003403738.1.31991 WP_003403738.1.31995 WP_003403738.1.32004 WP_003403738.1.32039 WP_003403738.1.3204 WP_003403738.1.32045 WP_003403738.1.32071 WP_003403738.1.32098 WP_003403738.1.32132 WP_003403738.1.32157 WP_003403738.1.32164 WP_003403738.1.32179 WP_003403738.1.32198 WP_003403738.1.32297 WP_003403738.1.32317 WP_003403738.1.32383 WP_003403738.1.32400 WP_003403738.1.32403 WP_003403738.1.32416 WP_003403738.1.32421 WP_003403738.1.32433 WP_003403738.1.32461 WP_003403738.1.32482 WP_003403738.1.32503 WP_003403738.1.32556 WP_003403738.1.32562 WP_003403738.1.32569 WP_003403738.1.32592 WP_003403738.1.32620 WP_003403738.1.32647 WP_003403738.1.32653 WP_003403738.1.32654 WP_003403738.1.3268 WP_003403738.1.32695 WP_003403738.1.32706 WP_003403738.1.32716 WP_003403738.1.32738 WP_003403738.1.32752 WP_003403738.1.32780 WP_003403738.1.32781 WP_003403738.1.32793 WP_003403738.1.32799 WP_003403738.1.32822 WP_003403738.1.32833 WP_003403738.1.32862 WP_003403738.1.32880 WP_003403738.1.32897 WP_003403738.1.32909 WP_003403738.1.32935 WP_003403738.1.32974 WP_003403738.1.33007 WP_003403738.1.3302 WP_003403738.1.33028 WP_003403738.1.33035 WP_003403738.1.33044 WP_003403738.1.33054 WP_003403738.1.33082 WP_003403738.1.33141 WP_003403738.1.33148 WP_003403738.1.33155 WP_003403738.1.33168 WP_003403738.1.3321 WP_003403738.1.33215 WP_003403738.1.3325 WP_003403738.1.3327 WP_003403738.1.33278 WP_003403738.1.33288 WP_003403738.1.33305 WP_003403738.1.3331 WP_003403738.1.33319 WP_003403738.1.3333 WP_003403738.1.33393 WP_003403738.1.33403 WP_003403738.1.33452 WP_003403738.1.33467 WP_003403738.1.33477 WP_003403738.1.3349 WP_003403738.1.33519 WP_003403738.1.33542 WP_003403738.1.33601 WP_003403738.1.33602 WP_003403738.1.33633 WP_003403738.1.33646 WP_003403738.1.33673 WP_003403738.1.3369 WP_003403738.1.33705 WP_003403738.1.33762 WP_003403738.1.33783 WP_003403738.1.33789 WP_003403738.1.3383 WP_003403738.1.33832 WP_003403738.1.33839 WP_003403738.1.33848 WP_003403738.1.3387 WP_003403738.1.33886 WP_003403738.1.33895 WP_003403738.1.33906 WP_003403738.1.33912 WP_003403738.1.33954 WP_003403738.1.3399 WP_003403738.1.34042 WP_003403738.1.3405 WP_003403738.1.34055 WP_003403738.1.34056 WP_003403738.1.34065 WP_003403738.1.3408 WP_003403738.1.34090 WP_003403738.1.34109 WP_003403738.1.34111 WP_003403738.1.34131 WP_003403738.1.34152 WP_003403738.1.34153 WP_003403738.1.34163 WP_003403738.1.34181 WP_003403738.1.34197 WP_003403738.1.34198 WP_003403738.1.34215 WP_003403738.1.34219 WP_003403738.1.34255 WP_003403738.1.34260 WP_003403738.1.34275 WP_003403738.1.343 WP_003403738.1.34347 WP_003403738.1.34358 WP_003403738.1.34392 WP_003403738.1.344 WP_003403738.1.34428 WP_003403738.1.3443 WP_003403738.1.34435 WP_003403738.1.34499 WP_003403738.1.34505 WP_003403738.1.34516 WP_003403738.1.34529 WP_003403738.1.34551 WP_003403738.1.34563 WP_003403738.1.34576 WP_003403738.1.34581 WP_003403738.1.34588 WP_003403738.1.34596 WP_003403738.1.34599 WP_003403738.1.34639 WP_003403738.1.34673 WP_003403738.1.34724 WP_003403738.1.34740 WP_003403738.1.34755 WP_003403738.1.34783 WP_003403738.1.34841 WP_003403738.1.34908 WP_003403738.1.34919 WP_003403738.1.3492 WP_003403738.1.34933 WP_003403738.1.34945 WP_003403738.1.34946 WP_003403738.1.34954 WP_003403738.1.34960 WP_003403738.1.34961 WP_003403738.1.34963 WP_003403738.1.34965 WP_003403738.1.34968 WP_003403738.1.35023 WP_003403738.1.35069 WP_003403738.1.35072 WP_003403738.1.35078 WP_003403738.1.35100 WP_003403738.1.35146 WP_003403738.1.35156 WP_003403738.1.35160 WP_003403738.1.35162 WP_003403738.1.35173 WP_003403738.1.35176 WP_003403738.1.3520 WP_003403738.1.35213 WP_003403738.1.35221 WP_003403738.1.35246 WP_003403738.1.35278 WP_003403738.1.35301 WP_003403738.1.35311 WP_003403738.1.35312 WP_003403738.1.35317 WP_003403738.1.35319 WP_003403738.1.35347 WP_003403738.1.35363 WP_003403738.1.35382 WP_003403738.1.35385 WP_003403738.1.35396 WP_003403738.1.35397 WP_003403738.1.35426 WP_003403738.1.35439 WP_003403738.1.35455 WP_003403738.1.3548 WP_003403738.1.35484 WP_003403738.1.35492 WP_003403738.1.3553 WP_003403738.1.35553 WP_003403738.1.35555 WP_003403738.1.35561 WP_003403738.1.35602 WP_003403738.1.35610 WP_003403738.1.35635 WP_003403738.1.35657 WP_003403738.1.35680 WP_003403738.1.35687 WP_003403738.1.35689 WP_003403738.1.35707 WP_003403738.1.35732 WP_003403738.1.35754 WP_003403738.1.35767 WP_003403738.1.35770 WP_003403738.1.35771 WP_003403738.1.35780 WP_003403738.1.35805 WP_003403738.1.35811 WP_003403738.1.35821 WP_003403738.1.3584 WP_003403738.1.35848 WP_003403738.1.35864 WP_003403738.1.35874 WP_003403738.1.35876 WP_003403738.1.35897 WP_003403738.1.35899 WP_003403738.1.35923 WP_003403738.1.3593 WP_003403738.1.35954 WP_003403738.1.36005 WP_003403738.1.36014 WP_003403738.1.36023 WP_003403738.1.36051 WP_003403738.1.36053 WP_003403738.1.36075 WP_003403738.1.36089 WP_003403738.1.36097 WP_003403738.1.36098 WP_003403738.1.36116 WP_003403738.1.36145 WP_003403738.1.36156 WP_003403738.1.36205 WP_003403738.1.36228 WP_003403738.1.36246 WP_003403738.1.36252 WP_003403738.1.36260 WP_003403738.1.36270 WP_003403738.1.36271 WP_003403738.1.36303 WP_003403738.1.36309 WP_003403738.1.36315 WP_003403738.1.36319 WP_003403738.1.36321 WP_003403738.1.36326 WP_003403738.1.3634 WP_003403738.1.36356 WP_003403738.1.36357 WP_003403738.1.3636 WP_003403738.1.36385 WP_003403738.1.36399 WP_003403738.1.36436 WP_003403738.1.36465 WP_003403738.1.36469 WP_003403738.1.36473 WP_003403738.1.36485 WP_003403738.1.36508 WP_003403738.1.36561 WP_003403738.1.36571 WP_003403738.1.36573 WP_003403738.1.36578 WP_003403738.1.36585 WP_003403738.1.36597 WP_003403738.1.36614 WP_003403738.1.36657 WP_003403738.1.36674 WP_003403738.1.36720 WP_003403738.1.36727 WP_003403738.1.36733 WP_003403738.1.36785 WP_003403738.1.36810 WP_003403738.1.36844 WP_003403738.1.36851 WP_003403738.1.36862 WP_003403738.1.36893 WP_003403738.1.36901 WP_003403738.1.36921 WP_003403738.1.36935 WP_003403738.1.36941 WP_003403738.1.3695 WP_003403738.1.36951 WP_003403738.1.36968 WP_003403738.1.3700 WP_003403738.1.37004 WP_003403738.1.37012 WP_003403738.1.37071 WP_003403738.1.37088 WP_003403738.1.37131 WP_003403738.1.37157 WP_003403738.1.37175 WP_003403738.1.37188 WP_003403738.1.37213 WP_003403738.1.37229 WP_003403738.1.3724 WP_003403738.1.37277 WP_003403738.1.37305 WP_003403738.1.37330 WP_003403738.1.37389 WP_003403738.1.37400 WP_003403738.1.37440 WP_003403738.1.37459 WP_003403738.1.37468 WP_003403738.1.37475 WP_003403738.1.37484 WP_003403738.1.37601 WP_003403738.1.37612 WP_003403738.1.37632 WP_003403738.1.37643 WP_003403738.1.37655 WP_003403738.1.37660 WP_003403738.1.37674 WP_003403738.1.37700 WP_003403738.1.37701 WP_003403738.1.37709 WP_003403738.1.37711 WP_003403738.1.37721 WP_003403738.1.37722 WP_003403738.1.37747 WP_003403738.1.37765 WP_003403738.1.37772 WP_003403738.1.37804 WP_003403738.1.37809 WP_003403738.1.37859 WP_003403738.1.37877 WP_003403738.1.37912 WP_003403738.1.37913 WP_003403738.1.37943 WP_003403738.1.37950 WP_003403738.1.37973 WP_003403738.1.37975 WP_003403738.1.37983 WP_003403738.1.38 WP_003403738.1.38002 WP_003403738.1.3802 WP_003403738.1.38039 WP_003403738.1.38040 WP_003403738.1.38067 WP_003403738.1.38068 WP_003403738.1.38135 WP_003403738.1.38138 WP_003403738.1.38144 WP_003403738.1.38158 WP_003403738.1.38159 WP_003403738.1.38210 WP_003403738.1.38233 WP_003403738.1.38240 WP_003403738.1.38299 WP_003403738.1.38332 WP_003403738.1.38347 WP_003403738.1.38354 WP_003403738.1.38380 WP_003403738.1.38384 WP_003403738.1.38389 WP_003403738.1.38398 WP_003403738.1.38402 WP_003403738.1.38418 WP_003403738.1.38421 WP_003403738.1.38466 WP_003403738.1.38477 WP_003403738.1.38483 WP_003403738.1.3849 WP_003403738.1.385 WP_003403738.1.38530 WP_003403738.1.38535 WP_003403738.1.38539 WP_003403738.1.38594 WP_003403738.1.38611 WP_003403738.1.38638 WP_003403738.1.38639 WP_003403738.1.38646 WP_003403738.1.38648 WP_003403738.1.38654 WP_003403738.1.38659 WP_003403738.1.38660 WP_003403738.1.38666 WP_003403738.1.38671 WP_003403738.1.38672 WP_003403738.1.38677 WP_003403738.1.38750 WP_003403738.1.38772 WP_003403738.1.38812 WP_003403738.1.38821 WP_003403738.1.38844 WP_003403738.1.38863 WP_003403738.1.38865 WP_003403738.1.38873 WP_003403738.1.3889 WP_003403738.1.38894 WP_003403738.1.38909 WP_003403738.1.38939 WP_003403738.1.38974 WP_003403738.1.38975 WP_003403738.1.38991 WP_003403738.1.39025 WP_003403738.1.39070 WP_003403738.1.39072 WP_003403738.1.39095 WP_003403738.1.39106 WP_003403738.1.39165 WP_003403738.1.39174 WP_003403738.1.39176 WP_003403738.1.39178 WP_003403738.1.39190 WP_003403738.1.39201 WP_003403738.1.39207 WP_003403738.1.39211 WP_003403738.1.39236 WP_003403738.1.39239 WP_003403738.1.39252 WP_003403738.1.39288 WP_003403738.1.39295 WP_003403738.1.39306 WP_003403738.1.39359 WP_003403738.1.39364 WP_003403738.1.39400 WP_003403738.1.39447 WP_003403738.1.3945 WP_003403738.1.39450 WP_003403738.1.39455 WP_003403738.1.3949 WP_003403738.1.39521 WP_003403738.1.39560 WP_003403738.1.39592 WP_003403738.1.39593 WP_003403738.1.396 WP_003403738.1.3960 WP_003403738.1.39616 WP_003403738.1.39654 WP_003403738.1.39657 WP_003403738.1.39661 WP_003403738.1.39674 WP_003403738.1.39678 WP_003403738.1.3968 WP_003403738.1.39694 WP_003403738.1.3971 WP_003403738.1.39718 WP_003403738.1.39728 WP_003403738.1.39739 WP_003403738.1.39748 WP_003403738.1.39751 WP_003403738.1.39759 WP_003403738.1.39801 WP_003403738.1.39804 WP_003403738.1.39848 WP_003403738.1.39877 WP_003403738.1.39925 WP_003403738.1.3994 WP_003403738.1.39959 WP_003403738.1.3996 WP_003403738.1.39960 WP_003403738.1.3997 WP_003403738.1.39980 WP_003403738.1.40000 WP_003403738.1.40028 WP_003403738.1.40029 WP_003403738.1.4003 WP_003403738.1.40094 WP_003403738.1.40096 WP_003403738.1.40150 WP_003403738.1.40156 WP_003403738.1.40174 WP_003403738.1.40186 WP_003403738.1.40276 WP_003403738.1.40277 WP_003403738.1.40323 WP_003403738.1.40336 WP_003403738.1.40353 WP_003403738.1.4036 WP_003403738.1.40372 WP_003403738.1.40402 WP_003403738.1.40413 WP_003403738.1.40440 WP_003403738.1.40446 WP_003403738.1.40451 WP_003403738.1.40455 WP_003403738.1.40523 WP_003403738.1.40543 WP_003403738.1.40641 WP_003403738.1.40646 WP_003403738.1.40651 WP_003403738.1.40653 WP_003403738.1.4067 WP_003403738.1.40705 WP_003403738.1.40723 WP_003403738.1.40731 WP_003403738.1.40735 WP_003403738.1.40795 WP_003403738.1.40799 WP_003403738.1.40852 WP_003403738.1.40876 WP_003403738.1.40881 WP_003403738.1.40922 WP_003403738.1.40948 WP_003403738.1.4095 WP_003403738.1.40956 WP_003403738.1.40957 WP_003403738.1.4097 WP_003403738.1.410 WP_003403738.1.41000 WP_003403738.1.41055 WP_003403738.1.41108 WP_003403738.1.41123 WP_003403738.1.41177 WP_003403738.1.41202 WP_003403738.1.41219 WP_003403738.1.41231 WP_003403738.1.41249 WP_003403738.1.4127 WP_003403738.1.41296 WP_003403738.1.41355 WP_003403738.1.41376 WP_003403738.1.41430 WP_003403738.1.41447 WP_003403738.1.41469 WP_003403738.1.41553 WP_003403738.1.41564 WP_003403738.1.41583 WP_003403738.1.41616 WP_003403738.1.41632 WP_003403738.1.41635 WP_003403738.1.41636 WP_003403738.1.41648 WP_003403738.1.41660 WP_003403738.1.41685 WP_003403738.1.41695 WP_003403738.1.41704 WP_003403738.1.4171 WP_003403738.1.41719 WP_003403738.1.41733 WP_003403738.1.41774 WP_003403738.1.41791 WP_003403738.1.41803 WP_003403738.1.41820 WP_003403738.1.41828 WP_003403738.1.41860 WP_003403738.1.41912 WP_003403738.1.41921 WP_003403738.1.41933 WP_003403738.1.41944 WP_003403738.1.42043 WP_003403738.1.42075 WP_003403738.1.42078 WP_003403738.1.42094 WP_003403738.1.42112 WP_003403738.1.4212 WP_003403738.1.42122 WP_003403738.1.42134 WP_003403738.1.42183 WP_003403738.1.42188 WP_003403738.1.42201 WP_003403738.1.42202 WP_003403738.1.42208 WP_003403738.1.42247 WP_003403738.1.42255 WP_003403738.1.42273 WP_003403738.1.42278 WP_003403738.1.42304 WP_003403738.1.42309 WP_003403738.1.42370 WP_003403738.1.42385 WP_003403738.1.42400 WP_003403738.1.42409 WP_003403738.1.42414 WP_003403738.1.42417 WP_003403738.1.42430 WP_003403738.1.42461 WP_003403738.1.42465 WP_003403738.1.42467 WP_003403738.1.42473 WP_003403738.1.42474 WP_003403738.1.4248 WP_003403738.1.42494 WP_003403738.1.42519 WP_003403738.1.42524 WP_003403738.1.42534 WP_003403738.1.4255 WP_003403738.1.42562 WP_003403738.1.42568 WP_003403738.1.42570 WP_003403738.1.42618 WP_003403738.1.42660 WP_003403738.1.42695 WP_003403738.1.42704 WP_003403738.1.42705 WP_003403738.1.42722 WP_003403738.1.42777 WP_003403738.1.42782 WP_003403738.1.42835 WP_003403738.1.42839 WP_003403738.1.42842 WP_003403738.1.42905 WP_003403738.1.42916 WP_003403738.1.42930 WP_003403738.1.42971 WP_003403738.1.43005 WP_003403738.1.43009 WP_003403738.1.43053 WP_003403738.1.43082 WP_003403738.1.43087 WP_003403738.1.43098 WP_003403738.1.43208 WP_003403738.1.43236 WP_003403738.1.43246 WP_003403738.1.43255 WP_003403738.1.43266 WP_003403738.1.43269 WP_003403738.1.43273 WP_003403738.1.43296 WP_003403738.1.43306 WP_003403738.1.43368 WP_003403738.1.43395 WP_003403738.1.43457 WP_003403738.1.43462 WP_003403738.1.43475 WP_003403738.1.43478 WP_003403738.1.43484 WP_003403738.1.43557 WP_003403738.1.43578 WP_003403738.1.43588 WP_003403738.1.43643 WP_003403738.1.43664 WP_003403738.1.43684 WP_003403738.1.43686 WP_003403738.1.43706 WP_003403738.1.43716 WP_003403738.1.4377 WP_003403738.1.43781 WP_003403738.1.43794 WP_003403738.1.43815 WP_003403738.1.43846 WP_003403738.1.43861 WP_003403738.1.43863 WP_003403738.1.43866 WP_003403738.1.43872 WP_003403738.1.43885 WP_003403738.1.43897 WP_003403738.1.4390 WP_003403738.1.43902 WP_003403738.1.43921 WP_003403738.1.43936 WP_003403738.1.43937 WP_003403738.1.43960 WP_003403738.1.43965 WP_003403738.1.4399 WP_003403738.1.43993 WP_003403738.1.43996 WP_003403738.1.44 WP_003403738.1.44001 WP_003403738.1.44008 WP_003403738.1.44016 WP_003403738.1.44033 WP_003403738.1.44037 WP_003403738.1.44041 WP_003403738.1.44070 WP_003403738.1.44071 WP_003403738.1.44076 WP_003403738.1.44104 WP_003403738.1.44111 WP_003403738.1.44124 WP_003403738.1.44219 WP_003403738.1.44237 WP_003403738.1.44277 WP_003403738.1.44279 WP_003403738.1.44336 WP_003403738.1.44355 WP_003403738.1.44358 WP_003403738.1.4438 WP_003403738.1.44390 WP_003403738.1.44392 WP_003403738.1.4441 WP_003403738.1.44415 WP_003403738.1.44464 WP_003403738.1.44466 WP_003403738.1.44489 WP_003403738.1.44492 WP_003403738.1.44494 WP_003403738.1.44500 WP_003403738.1.44519 WP_003403738.1.44526 WP_003403738.1.44532 WP_003403738.1.44534 WP_003403738.1.44562 WP_003403738.1.44589 WP_003403738.1.44597 WP_003403738.1.44600 WP_003403738.1.44602 WP_003403738.1.44615 WP_003403738.1.4464 WP_003403738.1.44651 WP_003403738.1.44659 WP_003403738.1.44665 WP_003403738.1.44700 WP_003403738.1.44713 WP_003403738.1.44735 WP_003403738.1.44740 WP_003403738.1.44757 WP_003403738.1.44761 WP_003403738.1.44767 WP_003403738.1.44776 WP_003403738.1.44779 WP_003403738.1.44786 WP_003403738.1.44808 WP_003403738.1.44864 WP_003403738.1.44901 WP_003403738.1.44908 WP_003403738.1.44913 WP_003403738.1.4492 WP_003403738.1.44939 WP_003403738.1.44979 WP_003403738.1.44981 WP_003403738.1.45002 WP_003403738.1.45011 WP_003403738.1.4504 WP_003403738.1.45066 WP_003403738.1.45081 WP_003403738.1.45113 WP_003403738.1.45135 WP_003403738.1.45147 WP_003403738.1.45168 WP_003403738.1.4517 WP_003403738.1.45181 WP_003403738.1.45185 WP_003403738.1.45192 WP_003403738.1.45200 WP_003403738.1.45205 WP_003403738.1.45211 WP_003403738.1.45249 WP_003403738.1.4526 WP_003403738.1.45286 WP_003403738.1.45326 WP_003403738.1.45347 WP_003403738.1.45374 WP_003403738.1.45390 WP_003403738.1.454 WP_003403738.1.45407 WP_003403738.1.45451 WP_003403738.1.45453 WP_003403738.1.45460 WP_003403738.1.45463 WP_003403738.1.45470 WP_003403738.1.45474 WP_003403738.1.45510 WP_003403738.1.45563 WP_003403738.1.45584 WP_003403738.1.45590 WP_003403738.1.45619 WP_003403738.1.45626 WP_003403738.1.45631 WP_003403738.1.45666 WP_003403738.1.45697 WP_003403738.1.4571 WP_003403738.1.45731 WP_003403738.1.45743 WP_003403738.1.45765 WP_003403738.1.45776 WP_003403738.1.45783 WP_003403738.1.45805 WP_003403738.1.45815 WP_003403738.1.45849 WP_003403738.1.45867 WP_003403738.1.45884 WP_003403738.1.4590 WP_003403738.1.45923 WP_003403738.1.45926 WP_003403738.1.45963 WP_003403738.1.45989 WP_003403738.1.45992 WP_003403738.1.46025 WP_003403738.1.46083 WP_003403738.1.46090 WP_003403738.1.46092 WP_003403738.1.46100 WP_003403738.1.46101 WP_003403738.1.46103 WP_003403738.1.46107 WP_003403738.1.46127 WP_003403738.1.46128 WP_003403738.1.46129 WP_003403738.1.46141 WP_003403738.1.46150 WP_003403738.1.46201 WP_003403738.1.46226 WP_003403738.1.4624 WP_003403738.1.46253 WP_003403738.1.46268 WP_003403738.1.46285 WP_003403738.1.46300 WP_003403738.1.46313 WP_003403738.1.46336 WP_003403738.1.46365 WP_003403738.1.46370 WP_003403738.1.46381 WP_003403738.1.46402 WP_003403738.1.46411 WP_003403738.1.4644 WP_003403738.1.46442 WP_003403738.1.46453 WP_003403738.1.46463 WP_003403738.1.46478 WP_003403738.1.46492 WP_003403738.1.46521 WP_003403738.1.4653 WP_003403738.1.46532 WP_003403738.1.46539 WP_003403738.1.46568 WP_003403738.1.46585 WP_003403738.1.46609 WP_003403738.1.46613 WP_003403738.1.46642 WP_003403738.1.46647 WP_003403738.1.46674 WP_003403738.1.46724 WP_003403738.1.46758 WP_003403738.1.46773 WP_003403738.1.46777 WP_003403738.1.46786 WP_003403738.1.46792 WP_003403738.1.46847 WP_003403738.1.46851 WP_003403738.1.4687 WP_003403738.1.46897 WP_003403738.1.46936 WP_003403738.1.46980 WP_003403738.1.47011 WP_003403738.1.47012 WP_003403738.1.47066 WP_003403738.1.47077 WP_003403738.1.47083 WP_003403738.1.47106 WP_003403738.1.47142 WP_003403738.1.47147 WP_003403738.1.47166 WP_003403738.1.47178 WP_003403738.1.47179 WP_003403738.1.47194 WP_003403738.1.47207 WP_003403738.1.47210 WP_003403738.1.47261 WP_003403738.1.47262 WP_003403738.1.47402 WP_003403738.1.47423 WP_003403738.1.47467 WP_003403738.1.47502 WP_003403738.1.4751 WP_003403738.1.47511 WP_003403738.1.47537 WP_003403738.1.47540 WP_003403738.1.47568 WP_003403738.1.47572 WP_003403738.1.47588 WP_003403738.1.47636 WP_003403738.1.4764 WP_003403738.1.47653 WP_003403738.1.47679 WP_003403738.1.47681 WP_003403738.1.47690 WP_003403738.1.4771 WP_003403738.1.47717 WP_003403738.1.47743 WP_003403738.1.47754 WP_003403738.1.47773 WP_003403738.1.47776 WP_003403738.1.47780 WP_003403738.1.47805 WP_003403738.1.47832 WP_003403738.1.47847 WP_003403738.1.47858 WP_003403738.1.47861 WP_003403738.1.47868 WP_003403738.1.47893 WP_003403738.1.47899 WP_003403738.1.479 WP_003403738.1.47912 WP_003403738.1.47913 WP_003403738.1.47926 WP_003403738.1.4794 WP_003403738.1.47943 WP_003403738.1.47944 WP_003403738.1.47959 WP_003403738.1.47974 WP_003403738.1.47993 WP_003403738.1.48004 WP_003403738.1.48039 WP_003403738.1.48050 WP_003403738.1.48084 WP_003403738.1.48097 WP_003403738.1.48101 WP_003403738.1.48109 WP_003403738.1.4813 WP_003403738.1.48130 WP_003403738.1.48135 WP_003403738.1.48143 WP_003403738.1.48152 WP_003403738.1.48155 WP_003403738.1.48170 WP_003403738.1.48173 WP_003403738.1.48177 WP_003403738.1.48185 WP_003403738.1.48204 WP_003403738.1.48219 WP_003403738.1.4823 WP_003403738.1.48240 WP_003403738.1.48256 WP_003403738.1.48264 WP_003403738.1.48287 WP_003403738.1.48330 WP_003403738.1.48333 WP_003403738.1.48348 WP_003403738.1.48354 WP_003403738.1.48372 WP_003403738.1.48383 WP_003403738.1.48388 WP_003403738.1.48419 WP_003403738.1.48423 WP_003403738.1.48443 WP_003403738.1.48450 WP_003403738.1.48462 WP_003403738.1.48543 WP_003403738.1.48550 WP_003403738.1.48605 WP_003403738.1.48618 WP_003403738.1.4863 WP_003403738.1.48648 WP_003403738.1.48658 WP_003403738.1.48666 WP_003403738.1.48687 WP_003403738.1.48779 WP_003403738.1.4878 WP_003403738.1.48798 WP_003403738.1.48802 WP_003403738.1.48826 WP_003403738.1.48831 WP_003403738.1.48843 WP_003403738.1.48857 WP_003403738.1.4890 WP_003403738.1.48946 WP_003403738.1.48979 WP_003403738.1.49017 WP_003403738.1.49048 WP_003403738.1.49059 WP_003403738.1.4906 WP_003403738.1.4907 WP_003403738.1.49103 WP_003403738.1.49110 WP_003403738.1.49111 WP_003403738.1.49112 WP_003403738.1.4919 WP_003403738.1.49251 WP_003403738.1.49254 WP_003403738.1.49263 WP_003403738.1.49291 WP_003403738.1.49296 WP_003403738.1.49335 WP_003403738.1.49337 WP_003403738.1.49419 WP_003403738.1.49426 WP_003403738.1.49437 WP_003403738.1.49439 WP_003403738.1.49474 WP_003403738.1.49506 WP_003403738.1.49516 WP_003403738.1.49523 WP_003403738.1.49526 WP_003403738.1.49532 WP_003403738.1.49588 WP_003403738.1.4959 WP_003403738.1.49678 WP_003403738.1.49687 WP_003403738.1.49699 WP_003403738.1.49709 WP_003403738.1.4971 WP_003403738.1.4972 WP_003403738.1.49736 WP_003403738.1.49746 WP_003403738.1.49764 WP_003403738.1.49773 WP_003403738.1.49796 WP_003403738.1.49814 WP_003403738.1.49815 WP_003403738.1.49816 WP_003403738.1.49839 WP_003403738.1.49857 WP_003403738.1.49880 WP_003403738.1.49944 WP_003403738.1.4999 WP_003403738.1.49990 WP_003403738.1.50068 WP_003403738.1.50077 WP_003403738.1.5008 WP_003403738.1.50081 WP_003403738.1.50122 WP_003403738.1.50126 WP_003403738.1.50149 WP_003403738.1.50162 WP_003403738.1.5018 WP_003403738.1.50194 WP_003403738.1.50218 WP_003403738.1.50235 WP_003403738.1.50249 WP_003403738.1.50265 WP_003403738.1.50271 WP_003403738.1.50324 WP_003403738.1.50347 WP_003403738.1.50372 WP_003403738.1.50398 WP_003403738.1.50407 WP_003403738.1.50444 WP_003403738.1.50466 WP_003403738.1.50472 WP_003403738.1.5048 WP_003403738.1.50498 WP_003403738.1.5050 WP_003403738.1.50540 WP_003403738.1.50554 WP_003403738.1.50557 WP_003403738.1.50601 WP_003403738.1.50610 WP_003403738.1.50632 WP_003403738.1.50633 WP_003403738.1.50642 WP_003403738.1.50659 WP_003403738.1.50683 WP_003403738.1.50689 WP_003403738.1.50692 WP_003403738.1.50714 WP_003403738.1.50729 WP_003403738.1.50756 WP_003403738.1.50784 WP_003403738.1.50794 WP_003403738.1.50841 WP_003403738.1.50860 WP_003403738.1.50868 WP_003403738.1.50877 WP_003403738.1.5096 WP_003403738.1.50981 WP_003403738.1.50987 WP_003403738.1.51003 WP_003403738.1.51009 WP_003403738.1.51074 WP_003403738.1.51082 WP_003403738.1.51101 WP_003403738.1.51116 WP_003403738.1.51149 WP_003403738.1.51156 WP_003403738.1.51157 WP_003403738.1.51213 WP_003403738.1.51232 WP_003403738.1.51239 WP_003403738.1.51247 WP_003403738.1.51266 WP_003403738.1.51279 WP_003403738.1.51291 WP_003403738.1.51294 WP_003403738.1.51301 WP_003403738.1.51329 WP_003403738.1.51391 WP_003403738.1.51422 WP_003403738.1.51445 WP_003403738.1.51466 WP_003403738.1.51468 WP_003403738.1.51478 WP_003403738.1.51497 WP_003403738.1.51520 WP_003403738.1.51593 WP_003403738.1.51628 WP_003403738.1.5164 WP_003403738.1.51647 WP_003403738.1.51660 WP_003403738.1.51696 WP_003403738.1.51721 WP_003403738.1.51788 WP_003403738.1.51795 WP_003403738.1.51801 WP_003403738.1.51817 WP_003403738.1.51819 WP_003403738.1.51854 WP_003403738.1.51923 WP_003403738.1.51942 WP_003403738.1.51948 WP_003403738.1.51963 WP_003403738.1.51969 WP_003403738.1.52000 WP_003403738.1.52001 WP_003403738.1.52003 WP_003403738.1.52006 WP_003403738.1.52036 WP_003403738.1.52038 WP_003403738.1.52046 WP_003403738.1.52059 WP_003403738.1.52069 WP_003403738.1.52082 WP_003403738.1.52102 WP_003403738.1.52106 WP_003403738.1.52166 WP_003403738.1.52168 WP_003403738.1.52173 WP_003403738.1.52178 WP_003403738.1.52206 WP_003403738.1.52216 WP_003403738.1.52238 WP_003403738.1.52241 WP_003403738.1.52280 WP_003403738.1.52314 WP_003403738.1.52385 WP_003403738.1.52390 WP_003403738.1.524 WP_003403738.1.52460 WP_003403738.1.52485 WP_003403738.1.52486 WP_003403738.1.52495 WP_003403738.1.52504 WP_003403738.1.52522 WP_003403738.1.52531 WP_003403738.1.52533 WP_003403738.1.52545 WP_003403738.1.52553 WP_003403738.1.52563 WP_003403738.1.52564 WP_003403738.1.52574 WP_003403738.1.52641 WP_003403738.1.52673 WP_003403738.1.52674 WP_003403738.1.52708 WP_003403738.1.52713 WP_003403738.1.52761 WP_003403738.1.52778 WP_003403738.1.52791 WP_003403738.1.52797 WP_003403738.1.52818 WP_003403738.1.52872 WP_003403738.1.52873 WP_003403738.1.52892 WP_003403738.1.52909 WP_003403738.1.52970 WP_003403738.1.52998 WP_003403738.1.53056 WP_003403738.1.5306 WP_003403738.1.53088 WP_003403738.1.5309 WP_003403738.1.53117 WP_003403738.1.53118 WP_003403738.1.53142 WP_003403738.1.53143 WP_003403738.1.53157 WP_003403738.1.53167 WP_003403738.1.53200 WP_003403738.1.53204 WP_003403738.1.53213 WP_003403738.1.53226 WP_003403738.1.53229 WP_003403738.1.53230 WP_003403738.1.53237 WP_003403738.1.53254 WP_003403738.1.53257 WP_003403738.1.5327 WP_003403738.1.53276 WP_003403738.1.53278 WP_003403738.1.533 WP_003403738.1.53302 WP_003403738.1.53306 WP_003403738.1.5334 WP_003403738.1.5335 WP_003403738.1.53353 WP_003403738.1.53381 WP_003403738.1.53413 WP_003403738.1.53458 WP_003403738.1.53460 WP_003403738.1.53480 WP_003403738.1.53517 WP_003403738.1.53522 WP_003403738.1.53525 WP_003403738.1.53526 WP_003403738.1.53553 WP_003403738.1.53606 WP_003403738.1.53609 WP_003403738.1.53628 WP_003403738.1.53643 WP_003403738.1.53667 WP_003403738.1.53679 WP_003403738.1.53715 WP_003403738.1.53742 WP_003403738.1.53743 WP_003403738.1.53754 WP_003403738.1.53775 WP_003403738.1.53787 WP_003403738.1.53803 WP_003403738.1.53818 WP_003403738.1.53822 WP_003403738.1.53853 WP_003403738.1.53865 WP_003403738.1.53888 WP_003403738.1.53900 WP_003403738.1.53912 WP_003403738.1.53914 WP_003403738.1.53952 WP_003403738.1.5398 WP_003403738.1.5408 WP_003403738.1.54089 WP_003403738.1.54093 WP_003403738.1.54099 WP_003403738.1.54112 WP_003403738.1.54125 WP_003403738.1.54141 WP_003403738.1.54162 WP_003403738.1.54179 WP_003403738.1.54206 WP_003403738.1.54218 WP_003403738.1.54225 WP_003403738.1.54227 WP_003403738.1.54232 WP_003403738.1.54241 WP_003403738.1.54245 WP_003403738.1.54247 WP_003403738.1.54260 WP_003403738.1.54275 WP_003403738.1.54280 WP_003403738.1.5429 WP_003403738.1.54294 WP_003403738.1.54314 WP_003403738.1.54347 WP_003403738.1.54351 WP_003403738.1.54370 WP_003403738.1.54428 WP_003403738.1.54449 WP_003403738.1.54494 WP_003403738.1.54502 WP_003403738.1.54514 WP_003403738.1.54519 WP_003403738.1.5452 WP_003403738.1.54537 WP_003403738.1.54553 WP_003403738.1.54555 WP_003403738.1.54575 WP_003403738.1.54633 WP_003403738.1.54686 WP_003403738.1.54687 WP_003403738.1.54705 WP_003403738.1.54730 WP_003403738.1.54732 WP_003403738.1.5475 WP_003403738.1.54797 WP_003403738.1.54807 WP_003403738.1.54836 WP_003403738.1.54838 WP_003403738.1.54860 WP_003403738.1.54888 WP_003403738.1.54897 WP_003403738.1.54905 WP_003403738.1.54909 WP_003403738.1.54937 WP_003403738.1.54939 WP_003403738.1.54944 WP_003403738.1.54945 WP_003403738.1.54953 WP_003403738.1.54964 WP_003403738.1.55015 WP_003403738.1.55022 WP_003403738.1.55023 WP_003403738.1.55051 WP_003403738.1.55072 WP_003403738.1.55088 WP_003403738.1.55106 WP_003403738.1.55126 WP_003403738.1.55128 WP_003403738.1.55140 WP_003403738.1.55150 WP_003403738.1.55210 WP_003403738.1.55227 WP_003403738.1.55248 WP_003403738.1.55257 WP_003403738.1.55258 WP_003403738.1.55267 WP_003403738.1.55279 WP_003403738.1.55307 WP_003403738.1.55326 WP_003403738.1.55328 WP_003403738.1.5533 WP_003403738.1.55345 WP_003403738.1.55396 WP_003403738.1.55398 WP_003403738.1.55441 WP_003403738.1.55459 WP_003403738.1.55501 WP_003403738.1.55504 WP_003403738.1.55578 WP_003403738.1.55626 WP_003403738.1.55641 WP_003403738.1.5569 WP_003403738.1.55723 WP_003403738.1.55735 WP_003403738.1.5574 WP_003403738.1.55772 WP_003403738.1.55802 WP_003403738.1.55807 WP_003403738.1.55819 WP_003403738.1.55821 WP_003403738.1.5583 WP_003403738.1.55849 WP_003403738.1.55856 WP_003403738.1.55860 WP_003403738.1.55882 WP_003403738.1.55883 WP_003403738.1.55894 WP_003403738.1.55902 WP_003403738.1.55909 WP_003403738.1.5591 WP_003403738.1.55961 WP_003403738.1.55983 WP_003403738.1.56028 WP_003403738.1.56057 WP_003403738.1.56060 WP_003403738.1.56107 WP_003403738.1.56132 WP_003403738.1.56163 WP_003403738.1.56167 WP_003403738.1.56178 WP_003403738.1.56287 WP_003403738.1.56292 WP_003403738.1.56327 WP_003403738.1.56341 WP_003403738.1.56359 WP_003403738.1.56394 WP_003403738.1.56443 WP_003403738.1.56473 WP_003403738.1.56478 WP_003403738.1.56500 WP_003403738.1.56517 WP_003403738.1.56534 WP_003403738.1.5656 WP_003403738.1.56577 WP_003403738.1.56593 WP_003403738.1.56625 WP_003403738.1.56637 WP_003403738.1.56670 WP_003403738.1.56697 WP_003403738.1.567 WP_003403738.1.56709 WP_003403738.1.56729 WP_003403738.1.56743 WP_003403738.1.56755 WP_003403738.1.56764 WP_003403738.1.56769 WP_003403738.1.56770 WP_003403738.1.56795 WP_003403738.1.5681 WP_003403738.1.56827 WP_003403738.1.56839 WP_003403738.1.56863 WP_003403738.1.56868 WP_003403738.1.56869 WP_003403738.1.56915 WP_003403738.1.56926 WP_003403738.1.56961 WP_003403738.1.56971 WP_003403738.1.56972 WP_003403738.1.57023 WP_003403738.1.57035 WP_003403738.1.57077 WP_003403738.1.57087 WP_003403738.1.57094 WP_003403738.1.57134 WP_003403738.1.57151 WP_003403738.1.57169 WP_003403738.1.57208 WP_003403738.1.57212 WP_003403738.1.57230 WP_003403738.1.5724 WP_003403738.1.5725 WP_003403738.1.5727 WP_003403738.1.57273 WP_003403738.1.573 WP_003403738.1.57314 WP_003403738.1.57326 WP_003403738.1.57328 WP_003403738.1.57331 WP_003403738.1.57340 WP_003403738.1.57351 WP_003403738.1.57352 WP_003403738.1.57380 WP_003403738.1.57430 WP_003403738.1.5744 WP_003403738.1.57440 WP_003403738.1.5745 WP_003403738.1.57461 WP_003403738.1.57469 WP_003403738.1.57489 WP_003403738.1.57509 WP_003403738.1.57519 WP_003403738.1.57525 WP_003403738.1.57551 WP_003403738.1.5758 WP_003403738.1.57596 WP_003403738.1.57604 WP_003403738.1.57616 WP_003403738.1.57617 WP_003403738.1.57619 WP_003403738.1.57627 WP_003403738.1.57642 WP_003403738.1.57658 WP_003403738.1.57667 WP_003403738.1.57675 WP_003403738.1.57689 WP_003403738.1.57708 WP_003403738.1.57794 WP_003403738.1.57821 WP_003403738.1.57825 WP_003403738.1.57843 WP_003403738.1.57906 WP_003403738.1.57924 WP_003403738.1.57926 WP_003403738.1.57930 WP_003403738.1.57957 WP_003403738.1.57960 WP_003403738.1.57964 WP_003403738.1.57991 WP_003403738.1.58000 WP_003403738.1.58086 WP_003403738.1.58101 WP_003403738.1.58103 WP_003403738.1.58108 WP_003403738.1.5811 WP_003403738.1.58121 WP_003403738.1.58145 WP_003403738.1.58164 WP_003403738.1.58174 WP_003403738.1.582 WP_003403738.1.58202 WP_003403738.1.58209 WP_003403738.1.58215 WP_003403738.1.5824 WP_003403738.1.58250 WP_003403738.1.58259 WP_003403738.1.58283 WP_003403738.1.58288 WP_003403738.1.5830 WP_003403738.1.58303 WP_003403738.1.58311 WP_003403738.1.58330 WP_003403738.1.58359 WP_003403738.1.58386 WP_003403738.1.58393 WP_003403738.1.58431 WP_003403738.1.5844 WP_003403738.1.58457 WP_003403738.1.58488 WP_003403738.1.58518 WP_003403738.1.58534 WP_003403738.1.58559 WP_003403738.1.58567 WP_003403738.1.58573 WP_003403738.1.58602 WP_003403738.1.58612 WP_003403738.1.58619 WP_003403738.1.58630 WP_003403738.1.5865 WP_003403738.1.58671 WP_003403738.1.58690 WP_003403738.1.58702 WP_003403738.1.58743 WP_003403738.1.58754 WP_003403738.1.5879 WP_003403738.1.5881 WP_003403738.1.58824 WP_003403738.1.58848 WP_003403738.1.58857 WP_003403738.1.58891 WP_003403738.1.58892 WP_003403738.1.5890 WP_003403738.1.58904 WP_003403738.1.58921 WP_003403738.1.58930 WP_003403738.1.58939 WP_003403738.1.58941 WP_003403738.1.58953 WP_003403738.1.58961 WP_003403738.1.5898 WP_003403738.1.59025 WP_003403738.1.59029 WP_003403738.1.59037 WP_003403738.1.59044 WP_003403738.1.59085 WP_003403738.1.59088 WP_003403738.1.59112 WP_003403738.1.59130 WP_003403738.1.5914 WP_003403738.1.59147 WP_003403738.1.59166 WP_003403738.1.59205 WP_003403738.1.59209 WP_003403738.1.59237 WP_003403738.1.59240 WP_003403738.1.59253 WP_003403738.1.59254 WP_003403738.1.59262 WP_003403738.1.59270 WP_003403738.1.5928 WP_003403738.1.59304 WP_003403738.1.59305 WP_003403738.1.59309 WP_003403738.1.59316 WP_003403738.1.59326 WP_003403738.1.59328 WP_003403738.1.59333 WP_003403738.1.59338 WP_003403738.1.59388 WP_003403738.1.59428 WP_003403738.1.59487 WP_003403738.1.59537 WP_003403738.1.59561 WP_003403738.1.59677 WP_003403738.1.59722 WP_003403738.1.59727 WP_003403738.1.59732 WP_003403738.1.59738 WP_003403738.1.59750 WP_003403738.1.59757 WP_003403738.1.59761 WP_003403738.1.59808 WP_003403738.1.59850 WP_003403738.1.59856 WP_003403738.1.59860 WP_003403738.1.59861 WP_003403738.1.5987 WP_003403738.1.59878 WP_003403738.1.59888 WP_003403738.1.59952 WP_003403738.1.5996 WP_003403738.1.59961 WP_003403738.1.59974 WP_003403738.1.60007 WP_003403738.1.60016 WP_003403738.1.6003 WP_003403738.1.60047 WP_003403738.1.6007 WP_003403738.1.60091 WP_003403738.1.60121 WP_003403738.1.60125 WP_003403738.1.60139 WP_003403738.1.60152 WP_003403738.1.60171 WP_003403738.1.60197 WP_003403738.1.6020 WP_003403738.1.60205 WP_003403738.1.60207 WP_003403738.1.60215 WP_003403738.1.60217 WP_003403738.1.60267 WP_003403738.1.60288 WP_003403738.1.60291 WP_003403738.1.60301 WP_003403738.1.60305 WP_003403738.1.60312 WP_003403738.1.60313 WP_003403738.1.60314 WP_003403738.1.60367 WP_003403738.1.60376 WP_003403738.1.60403 WP_003403738.1.60413 WP_003403738.1.60421 WP_003403738.1.60451 WP_003403738.1.60460 WP_003403738.1.60479 WP_003403738.1.60487 WP_003403738.1.60512 WP_003403738.1.60573 WP_003403738.1.60632 WP_003403738.1.60657 WP_003403738.1.60687 WP_003403738.1.60689 WP_003403738.1.60727 WP_003403738.1.60738 WP_003403738.1.60763 WP_003403738.1.6077 WP_003403738.1.60791 WP_003403738.1.60834 WP_003403738.1.60870 WP_003403738.1.60878 WP_003403738.1.60879 WP_003403738.1.60913 WP_003403738.1.60978 WP_003403738.1.61000 WP_003403738.1.61001 WP_003403738.1.61012 WP_003403738.1.61014 WP_003403738.1.61015 WP_003403738.1.61037 WP_003403738.1.61052 WP_003403738.1.61065 WP_003403738.1.61100 WP_003403738.1.61101 WP_003403738.1.61138 WP_003403738.1.61142 WP_003403738.1.61198 WP_003403738.1.612 WP_003403738.1.61234 WP_003403738.1.61256 WP_003403738.1.61281 WP_003403738.1.61314 WP_003403738.1.61321 WP_003403738.1.61326 WP_003403738.1.61328 WP_003403738.1.61368 WP_003403738.1.61391 WP_003403738.1.61406 WP_003403738.1.61409 WP_003403738.1.61420 WP_003403738.1.61422 WP_003403738.1.61425 WP_003403738.1.61428 WP_003403738.1.61469 WP_003403738.1.61494 WP_003403738.1.61522 WP_003403738.1.61552 WP_003403738.1.61557 WP_003403738.1.61567 WP_003403738.1.61571 WP_003403738.1.61584 WP_003403738.1.61586 WP_003403738.1.6159 WP_003403738.1.61592 WP_003403738.1.6160 WP_003403738.1.61614 WP_003403738.1.6163 WP_003403738.1.61655 WP_003403738.1.61665 WP_003403738.1.61669 WP_003403738.1.61682 WP_003403738.1.61692 WP_003403738.1.61719 WP_003403738.1.61728 WP_003403738.1.61750 WP_003403738.1.61754 WP_003403738.1.61755 WP_003403738.1.61757 WP_003403738.1.61778 WP_003403738.1.6179 WP_003403738.1.61793 WP_003403738.1.61816 WP_003403738.1.61842 WP_003403738.1.61850 WP_003403738.1.61862 WP_003403738.1.61868 WP_003403738.1.61911 WP_003403738.1.61925 WP_003403738.1.61941 WP_003403738.1.61953 WP_003403738.1.61986 WP_003403738.1.61987 WP_003403738.1.61998 WP_003403738.1.62021 WP_003403738.1.62087 WP_003403738.1.62089 WP_003403738.1.62101 WP_003403738.1.62104 WP_003403738.1.6211 WP_003403738.1.62132 WP_003403738.1.62162 WP_003403738.1.62225 WP_003403738.1.62230 WP_003403738.1.62238 WP_003403738.1.62249 WP_003403738.1.62270 WP_003403738.1.62281 WP_003403738.1.62307 WP_003403738.1.6231 WP_003403738.1.62359 WP_003403738.1.62360 WP_003403738.1.62371 WP_003403738.1.62379 WP_003403738.1.62395 WP_003403738.1.62408 WP_003403738.1.62449 WP_003403738.1.62468 WP_003403738.1.6248 WP_003403738.1.62508 WP_003403738.1.62565 WP_003403738.1.62594 WP_003403738.1.62606 WP_003403738.1.62616 WP_003403738.1.62666 WP_003403738.1.62687 WP_003403738.1.62715 WP_003403738.1.62730 WP_003403738.1.62738 WP_003403738.1.62761 WP_003403738.1.62766 WP_003403738.1.62786 WP_003403738.1.62813 WP_003403738.1.62839 WP_003403738.1.62841 WP_003403738.1.62909 WP_003403738.1.62936 WP_003403738.1.6294 WP_003403738.1.6295 WP_003403738.1.62962 WP_003403738.1.63007 WP_003403738.1.63019 WP_003403738.1.63032 WP_003403738.1.63037 WP_003403738.1.63064 WP_003403738.1.63066 WP_003403738.1.63072 WP_003403738.1.63081 WP_003403738.1.63096 WP_003403738.1.63106 WP_003403738.1.6314 WP_003403738.1.63144 WP_003403738.1.63154 WP_003403738.1.63160 WP_003403738.1.63161 WP_003403738.1.63166 WP_003403738.1.63175 WP_003403738.1.63194 WP_003403738.1.6322 WP_003403738.1.63222 WP_003403738.1.63247 WP_003403738.1.6328 WP_003403738.1.63291 WP_003403738.1.63312 WP_003403738.1.63317 WP_003403738.1.63331 WP_003403738.1.63373 WP_003403738.1.63384 WP_003403738.1.63403 WP_003403738.1.63424 WP_003403738.1.63428 WP_003403738.1.6345 WP_003403738.1.63464 WP_003403738.1.63483 WP_003403738.1.63502 WP_003403738.1.63504 WP_003403738.1.63522 WP_003403738.1.63530 WP_003403738.1.63538 WP_003403738.1.63564 WP_003403738.1.63567 WP_003403738.1.63596 WP_003403738.1.63600 WP_003403738.1.63623 WP_003403738.1.63624 WP_003403738.1.63625 WP_003403738.1.63627 WP_003403738.1.63654 WP_003403738.1.63662 WP_003403738.1.63711 WP_003403738.1.63807 WP_003403738.1.63819 WP_003403738.1.63844 WP_003403738.1.63888 WP_003403738.1.63913 WP_003403738.1.63915 WP_003403738.1.63918 WP_003403738.1.63970 WP_003403738.1.64000 WP_003403738.1.64027 WP_003403738.1.64058 WP_003403738.1.64065 WP_003403738.1.6407 WP_003403738.1.64082 WP_003403738.1.64091 WP_003403738.1.64102 WP_003403738.1.64104 WP_003403738.1.64119 WP_003403738.1.64169 WP_003403738.1.64219 WP_003403738.1.6422 WP_003403738.1.64222 WP_003403738.1.64223 WP_003403738.1.64228 WP_003403738.1.64235 WP_003403738.1.64249 WP_003403738.1.6427 WP_003403738.1.64278 WP_003403738.1.64287 WP_003403738.1.64414 WP_003403738.1.64419 WP_003403738.1.6443 WP_003403738.1.64463 WP_003403738.1.64480 WP_003403738.1.64497 WP_003403738.1.64506 WP_003403738.1.64511 WP_003403738.1.64513 WP_003403738.1.64514 WP_003403738.1.64515 WP_003403738.1.64522 WP_003403738.1.64526 WP_003403738.1.64543 WP_003403738.1.6456 WP_003403738.1.64567 WP_003403738.1.64588 WP_003403738.1.64589 WP_003403738.1.64594 WP_003403738.1.64595 WP_003403738.1.64608 WP_003403738.1.64619 WP_003403738.1.64629 WP_003403738.1.6464 WP_003403738.1.64664 WP_003403738.1.64669 WP_003403738.1.64672 WP_003403738.1.64680 WP_003403738.1.64682 WP_003403738.1.64727 WP_003403738.1.64729 WP_003403738.1.64774 WP_003403738.1.64776 WP_003403738.1.64802 WP_003403738.1.64832 WP_003403738.1.6486 WP_003403738.1.64870 WP_003403738.1.64898 WP_003403738.1.64922 WP_003403738.1.64924 WP_003403738.1.6493 WP_003403738.1.64937 WP_003403738.1.64941 WP_003403738.1.64966 WP_003403738.1.64973 WP_003403738.1.65001 WP_003403738.1.65026 WP_003403738.1.65053 WP_003403738.1.65070 WP_003403738.1.65079 WP_003403738.1.65102 WP_003403738.1.65157 WP_003403738.1.65181 WP_003403738.1.65212 WP_003403738.1.65229 WP_003403738.1.6523 WP_003403738.1.65253 WP_003403738.1.65289 WP_003403738.1.65291 WP_003403738.1.65315 WP_003403738.1.65359 WP_003403738.1.6536 WP_003403738.1.65374 WP_003403738.1.65386 WP_003403738.1.65414 WP_003403738.1.65416 WP_003403738.1.65433 WP_003403738.1.65455 WP_003403738.1.65467 WP_003403738.1.65488 WP_003403738.1.65529 WP_003403738.1.65583 WP_003403738.1.65612 WP_003403738.1.65623 WP_003403738.1.65635 WP_003403738.1.65637 WP_003403738.1.65648 WP_003403738.1.65683 WP_003403738.1.65686 WP_003403738.1.65688 WP_003403738.1.65707 WP_003403738.1.65733 WP_003403738.1.65746 WP_003403738.1.65747 WP_003403738.1.65759 WP_003403738.1.65816 WP_003403738.1.65830 WP_003403738.1.65858 WP_003403738.1.65862 WP_003403738.1.65869 WP_003403738.1.65893 WP_003403738.1.65929 WP_003403738.1.65932 WP_003403738.1.65958 WP_003403738.1.65974 WP_003403738.1.66004 WP_003403738.1.66013 WP_003403738.1.66089 WP_003403738.1.66149 WP_003403738.1.66151 WP_003403738.1.66229 WP_003403738.1.66276 WP_003403738.1.66293 WP_003403738.1.66297 WP_003403738.1.66323 WP_003403738.1.66325 WP_003403738.1.6633 WP_003403738.1.66334 WP_003403738.1.66355 WP_003403738.1.66367 WP_003403738.1.66394 WP_003403738.1.66396 WP_003403738.1.66451 WP_003403738.1.66455 WP_003403738.1.66457 WP_003403738.1.66460 WP_003403738.1.66464 WP_003403738.1.66466 WP_003403738.1.66487 WP_003403738.1.66504 WP_003403738.1.66544 WP_003403738.1.66558 WP_003403738.1.66580 WP_003403738.1.66582 WP_003403738.1.66612 WP_003403738.1.66615 WP_003403738.1.66617 WP_003403738.1.66635 WP_003403738.1.66656 WP_003403738.1.66663 WP_003403738.1.66675 WP_003403738.1.66715 WP_003403738.1.66718 WP_003403738.1.66762 WP_003403738.1.66776 WP_003403738.1.66808 WP_003403738.1.66817 WP_003403738.1.66819 WP_003403738.1.66826 WP_003403738.1.66842 WP_003403738.1.66868 WP_003403738.1.66878 WP_003403738.1.66880 WP_003403738.1.66893 WP_003403738.1.66961 WP_003403738.1.67005 WP_003403738.1.6704 WP_003403738.1.67044 WP_003403738.1.67061 WP_003403738.1.67089 WP_003403738.1.67098 WP_003403738.1.67146 WP_003403738.1.67170 WP_003403738.1.67197 WP_003403738.1.67198 WP_003403738.1.6720 WP_003403738.1.67207 WP_003403738.1.67218 WP_003403738.1.67220 WP_003403738.1.67225 WP_003403738.1.67231 WP_003403738.1.6724 WP_003403738.1.67257 WP_003403738.1.67298 WP_003403738.1.67307 WP_003403738.1.67324 WP_003403738.1.67332 WP_003403738.1.67346 WP_003403738.1.67354 WP_003403738.1.67360 WP_003403738.1.67381 WP_003403738.1.67396 WP_003403738.1.67417 WP_003403738.1.67422 WP_003403738.1.67453 WP_003403738.1.67459 WP_003403738.1.6746 WP_003403738.1.67473 WP_003403738.1.67481 WP_003403738.1.67482 WP_003403738.1.67496 WP_003403738.1.67499 WP_003403738.1.67516 WP_003403738.1.67523 WP_003403738.1.67536 WP_003403738.1.67575 WP_003403738.1.67587 WP_003403738.1.67598 WP_003403738.1.67600 WP_003403738.1.67602 WP_003403738.1.67630 WP_003403738.1.67679 WP_003403738.1.67692 WP_003403738.1.67744 WP_003403738.1.6775 WP_003403738.1.67750 WP_003403738.1.6777 WP_003403738.1.67809 WP_003403738.1.67816 WP_003403738.1.67844 WP_003403738.1.67848 WP_003403738.1.67870 WP_003403738.1.67888 WP_003403738.1.67915 WP_003403738.1.67945 WP_003403738.1.67949 WP_003403738.1.67980 WP_003403738.1.67982 WP_003403738.1.68022 WP_003403738.1.68029 WP_003403738.1.68037 WP_003403738.1.68038 WP_003403738.1.68045 WP_003403738.1.68057 WP_003403738.1.68083 WP_003403738.1.68088 WP_003403738.1.68106 WP_003403738.1.68110 WP_003403738.1.68153 WP_003403738.1.68164 WP_003403738.1.68169 WP_003403738.1.68193 WP_003403738.1.68212 WP_003403738.1.68227 WP_003403738.1.68243 WP_003403738.1.6825 WP_003403738.1.68297 WP_003403738.1.68309 WP_003403738.1.68325 WP_003403738.1.68329 WP_003403738.1.68340 WP_003403738.1.68384 WP_003403738.1.68388 WP_003403738.1.68429 WP_003403738.1.6843 WP_003403738.1.68433 WP_003403738.1.68444 WP_003403738.1.68465 WP_003403738.1.68484 WP_003403738.1.68518 WP_003403738.1.68569 WP_003403738.1.68576 WP_003403738.1.68580 WP_003403738.1.68586 WP_003403738.1.68623 WP_003403738.1.68624 WP_003403738.1.68637 WP_003403738.1.68646 WP_003403738.1.68667 WP_003403738.1.68669 WP_003403738.1.68672 WP_003403738.1.68684 WP_003403738.1.68704 WP_003403738.1.68708 WP_003403738.1.6872 WP_003403738.1.68730 WP_003403738.1.68734 WP_003403738.1.68748 WP_003403738.1.68754 WP_003403738.1.6876 WP_003403738.1.68761 WP_003403738.1.68763 WP_003403738.1.68766 WP_003403738.1.68774 WP_003403738.1.68796 WP_003403738.1.68824 WP_003403738.1.68832 WP_003403738.1.68833 WP_003403738.1.68841 WP_003403738.1.68859 WP_003403738.1.68876 WP_003403738.1.68906 WP_003403738.1.68916 WP_003403738.1.68923 WP_003403738.1.68945 WP_003403738.1.6896 WP_003403738.1.68981 WP_003403738.1.68984 WP_003403738.1.68997 WP_003403738.1.69008 WP_003403738.1.69076 WP_003403738.1.69079 WP_003403738.1.6908 WP_003403738.1.69082 WP_003403738.1.69178 WP_003403738.1.69208 WP_003403738.1.69231 WP_003403738.1.69256 WP_003403738.1.69311 WP_003403738.1.69315 WP_003403738.1.69322 WP_003403738.1.69342 WP_003403738.1.6935 WP_003403738.1.6936 WP_003403738.1.69369 WP_003403738.1.69374 WP_003403738.1.69398 WP_003403738.1.69401 WP_003403738.1.69426 WP_003403738.1.69427 WP_003403738.1.69429 WP_003403738.1.6949 WP_003403738.1.6951 WP_003403738.1.69511 WP_003403738.1.69526 WP_003403738.1.69528 WP_003403738.1.69547 WP_003403738.1.69573 WP_003403738.1.69581 WP_003403738.1.6960 WP_003403738.1.69617 WP_003403738.1.69634 WP_003403738.1.69647 WP_003403738.1.69659 WP_003403738.1.69673 WP_003403738.1.69682 WP_003403738.1.69684 WP_003403738.1.69686 WP_003403738.1.69707 WP_003403738.1.69709 WP_003403738.1.69723 WP_003403738.1.69736 WP_003403738.1.69778 WP_003403738.1.69800 WP_003403738.1.69802 WP_003403738.1.69845 WP_003403738.1.69870 WP_003403738.1.69873 WP_003403738.1.69898 WP_003403738.1.69913 WP_003403738.1.69925 WP_003403738.1.69931 WP_003403738.1.69938 WP_003403738.1.69955 WP_003403738.1.69957 WP_003403738.1.69981 WP_003403738.1.69990 WP_003403738.1.70 WP_003403738.1.70000 WP_003403738.1.70017 WP_003403738.1.70032 WP_003403738.1.70055 WP_003403738.1.70062 WP_003403738.1.70072 WP_003403738.1.70131 WP_003403738.1.70132 WP_003403738.1.7022 WP_003403738.1.70227 WP_003403738.1.70255 WP_003403738.1.70271 WP_003403738.1.70274 WP_003403738.1.7029 WP_003403738.1.70325 WP_003403738.1.70328 WP_003403738.1.70356 WP_003403738.1.70364 WP_003403738.1.70368 WP_003403738.1.70369 WP_003403738.1.70418 WP_003403738.1.70422 WP_003403738.1.70435 WP_003403738.1.70463 WP_003403738.1.70471 WP_003403738.1.70480 WP_003403738.1.70494 WP_003403738.1.70498 WP_003403738.1.70505 WP_003403738.1.70525 WP_003403738.1.70573 WP_003403738.1.70577 WP_003403738.1.70610 WP_003403738.1.70615 WP_003403738.1.70618 WP_003403738.1.70622 WP_003403738.1.70626 WP_003403738.1.70668 WP_003403738.1.70699 WP_003403738.1.70704 WP_003403738.1.70729 WP_003403738.1.70782 WP_003403738.1.70796 WP_003403738.1.70830 WP_003403738.1.70834 WP_003403738.1.7084 WP_003403738.1.70840 WP_003403738.1.70864 WP_003403738.1.70871 WP_003403738.1.70915 WP_003403738.1.70955 WP_003403738.1.70958 WP_003403738.1.70964 WP_003403738.1.70976 WP_003403738.1.71015 WP_003403738.1.71026 WP_003403738.1.71063 WP_003403738.1.71076 WP_003403738.1.71083 WP_003403738.1.7111 WP_003403738.1.71118 WP_003403738.1.71128 WP_003403738.1.7113 WP_003403738.1.71187 WP_003403738.1.71191 WP_003403738.1.71255 WP_003403738.1.71258 WP_003403738.1.71259 WP_003403738.1.71289 WP_003403738.1.71326 WP_003403738.1.71329 WP_003403738.1.71331 WP_003403738.1.71344 WP_003403738.1.71390 WP_003403738.1.71399 WP_003403738.1.71414 WP_003403738.1.71440 WP_003403738.1.71457 WP_003403738.1.7146 WP_003403738.1.71464 WP_003403738.1.71490 WP_003403738.1.71492 WP_003403738.1.71509 WP_003403738.1.71516 WP_003403738.1.71517 WP_003403738.1.71527 WP_003403738.1.71532 WP_003403738.1.71545 WP_003403738.1.71546 WP_003403738.1.71569 WP_003403738.1.71604 WP_003403738.1.71621 WP_003403738.1.71630 WP_003403738.1.71638 WP_003403738.1.71654 WP_003403738.1.71664 WP_003403738.1.71665 WP_003403738.1.71683 WP_003403738.1.71718 WP_003403738.1.71731 WP_003403738.1.71778 WP_003403738.1.71781 WP_003403738.1.71803 WP_003403738.1.71847 WP_003403738.1.7185 WP_003403738.1.71851 WP_003403738.1.71871 WP_003403738.1.71909 WP_003403738.1.71957 WP_003403738.1.71970 WP_003403738.1.72047 WP_003403738.1.72061 WP_003403738.1.72062 WP_003403738.1.72072 WP_003403738.1.72111 WP_003403738.1.72122 WP_003403738.1.72128 WP_003403738.1.72143 WP_003403738.1.7216 WP_003403738.1.72168 WP_003403738.1.72179 WP_003403738.1.72209 WP_003403738.1.72218 WP_003403738.1.72219 WP_003403738.1.72227 WP_003403738.1.7224 WP_003403738.1.72268 WP_003403738.1.72332 WP_003403738.1.72380 WP_003403738.1.72401 WP_003403738.1.72405 WP_003403738.1.72420 WP_003403738.1.72441 WP_003403738.1.72451 WP_003403738.1.72452 WP_003403738.1.72457 WP_003403738.1.72459 WP_003403738.1.72460 WP_003403738.1.72466 WP_003403738.1.72487 WP_003403738.1.72488 WP_003403738.1.72492 WP_003403738.1.72506 WP_003403738.1.72543 WP_003403738.1.7256 WP_003403738.1.72576 WP_003403738.1.72578 WP_003403738.1.72585 WP_003403738.1.72591 WP_003403738.1.72592 WP_003403738.1.72640 WP_003403738.1.7266 WP_003403738.1.72661 WP_003403738.1.72684 WP_003403738.1.72739 WP_003403738.1.72744 WP_003403738.1.72755 WP_003403738.1.72759 WP_003403738.1.72784 WP_003403738.1.72792 WP_003403738.1.72826 WP_003403738.1.72831 WP_003403738.1.72852 WP_003403738.1.72853 WP_003403738.1.72879 WP_003403738.1.72880 WP_003403738.1.72938 WP_003403738.1.72954 WP_003403738.1.72957 WP_003403738.1.72959 WP_003403738.1.72973 WP_003403738.1.7298 WP_003403738.1.72982 WP_003403738.1.72988 WP_003403738.1.72993 WP_003403738.1.73006 WP_003403738.1.73013 WP_003403738.1.73025 WP_003403738.1.73028 WP_003403738.1.73042 WP_003403738.1.73045 WP_003403738.1.73092 WP_003403738.1.73118 WP_003403738.1.7312 WP_003403738.1.73127 WP_003403738.1.73134 WP_003403738.1.73150 WP_003403738.1.73154 WP_003403738.1.73163 WP_003403738.1.73182 WP_003403738.1.73205 WP_003403738.1.7321 WP_003403738.1.73310 WP_003403738.1.73315 WP_003403738.1.73365 WP_003403738.1.73391 WP_003403738.1.73404 WP_003403738.1.73424 WP_003403738.1.73436 WP_003403738.1.73445 WP_003403738.1.73453 WP_003403738.1.73465 WP_003403738.1.73466 WP_003403738.1.73470 WP_003403738.1.73471 WP_003403738.1.73478 WP_003403738.1.73482 WP_003403738.1.73507 WP_003403738.1.73532 WP_003403738.1.73550 WP_003403738.1.73564 WP_003403738.1.73623 WP_003403738.1.73629 WP_003403738.1.73644 WP_003403738.1.7366 WP_003403738.1.73661 WP_003403738.1.7368 WP_003403738.1.73688 WP_003403738.1.73723 WP_003403738.1.73744 WP_003403738.1.73750 WP_003403738.1.73760 WP_003403738.1.73774 WP_003403738.1.7379 WP_003403738.1.73813 WP_003403738.1.73840 WP_003403738.1.73876 WP_003403738.1.7389 WP_003403738.1.73986 WP_003403738.1.74016 WP_003403738.1.74039 WP_003403738.1.74083 WP_003403738.1.74101 WP_003403738.1.74107 WP_003403738.1.74120 WP_003403738.1.74129 WP_003403738.1.74144 WP_003403738.1.7417 WP_003403738.1.74190 WP_003403738.1.74210 WP_003403738.1.7423 WP_003403738.1.74259 WP_003403738.1.74262 WP_003403738.1.74269 WP_003403738.1.74282 WP_003403738.1.74291 WP_003403738.1.74296 WP_003403738.1.74304 WP_003403738.1.7432 WP_003403738.1.74347 WP_003403738.1.7436 WP_003403738.1.74378 WP_003403738.1.74382 WP_003403738.1.74395 WP_003403738.1.74400 WP_003403738.1.74401 WP_003403738.1.74432 WP_003403738.1.74442 WP_003403738.1.74477 WP_003403738.1.74487 WP_003403738.1.74499 WP_003403738.1.74504 WP_003403738.1.74511 WP_003403738.1.74523 WP_003403738.1.74525 WP_003403738.1.74551 WP_003403738.1.74555 WP_003403738.1.74628 WP_003403738.1.74641 WP_003403738.1.74653 WP_003403738.1.74660 WP_003403738.1.74683 WP_003403738.1.7469 WP_003403738.1.74725 WP_003403738.1.74760 WP_003403738.1.74786 WP_003403738.1.74809 WP_003403738.1.74820 WP_003403738.1.74870 WP_003403738.1.74881 WP_003403738.1.74888 WP_003403738.1.74952 WP_003403738.1.7496 WP_003403738.1.74988 WP_003403738.1.75045 WP_003403738.1.75055 WP_003403738.1.75078 WP_003403738.1.75081 WP_003403738.1.75120 WP_003403738.1.75163 WP_003403738.1.75188 WP_003403738.1.75200 WP_003403738.1.75202 WP_003403738.1.75234 WP_003403738.1.75239 WP_003403738.1.75250 WP_003403738.1.75263 WP_003403738.1.75281 WP_003403738.1.75342 WP_003403738.1.7535 WP_003403738.1.75376 WP_003403738.1.75391 WP_003403738.1.75395 WP_003403738.1.75441 WP_003403738.1.75581 WP_003403738.1.75598 WP_003403738.1.75635 WP_003403738.1.75645 WP_003403738.1.75665 WP_003403738.1.75671 WP_003403738.1.75741 WP_003403738.1.75749 WP_003403738.1.75772 WP_003403738.1.75774 WP_003403738.1.75811 WP_003403738.1.75833 WP_003403738.1.7585 WP_003403738.1.75864 WP_003403738.1.75868 WP_003403738.1.75878 WP_003403738.1.75927 WP_003403738.1.75946 WP_003403738.1.75968 WP_003403738.1.75974 WP_003403738.1.76007 WP_003403738.1.76016 WP_003403738.1.76032 WP_003403738.1.76037 WP_003403738.1.7604 WP_003403738.1.76045 WP_003403738.1.76052 WP_003403738.1.76058 WP_003403738.1.76064 WP_003403738.1.76110 WP_003403738.1.76126 WP_003403738.1.76133 WP_003403738.1.76138 WP_003403738.1.76157 WP_003403738.1.76172 WP_003403738.1.76177 WP_003403738.1.76183 WP_003403738.1.76209 WP_003403738.1.76239 WP_003403738.1.76272 WP_003403738.1.76277 WP_003403738.1.76280 WP_003403738.1.76281 WP_003403738.1.76291 WP_003403738.1.76297 WP_003403738.1.76360 WP_003403738.1.76379 WP_003403738.1.76403 WP_003403738.1.76413 WP_003403738.1.76414 WP_003403738.1.76427 WP_003403738.1.76436 WP_003403738.1.76442 WP_003403738.1.76443 WP_003403738.1.76456 WP_003403738.1.76521 WP_003403738.1.76533 WP_003403738.1.76616 WP_003403738.1.76625 WP_003403738.1.76629 WP_003403738.1.76635 WP_003403738.1.76638 WP_003403738.1.76639 WP_003403738.1.76640 WP_003403738.1.76644 WP_003403738.1.76677 WP_003403738.1.76678 WP_003403738.1.76679 WP_003403738.1.76734 WP_003403738.1.76744 WP_003403738.1.76750 WP_003403738.1.76754 WP_003403738.1.76757 WP_003403738.1.76781 WP_003403738.1.76818 WP_003403738.1.76824 WP_003403738.1.76835 WP_003403738.1.76873 WP_003403738.1.76881 WP_003403738.1.76888 WP_003403738.1.76900 WP_003403738.1.7691 WP_003403738.1.76947 WP_003403738.1.76954 WP_003403738.1.76955 WP_003403738.1.76963 WP_003403738.1.76976 WP_003403738.1.770 WP_003403738.1.77000 WP_003403738.1.77008 WP_003403738.1.77021 WP_003403738.1.77056 WP_003403738.1.77065 WP_003403738.1.77075 WP_003403738.1.77093 WP_003403738.1.77107 WP_003403738.1.77115 WP_003403738.1.77118 WP_003403738.1.77125 WP_003403738.1.77141 WP_003403738.1.77142 WP_003403738.1.77166 WP_003403738.1.77250 WP_003403738.1.77252 WP_003403738.1.77260 WP_003403738.1.77266 WP_003403738.1.77280 WP_003403738.1.77285 WP_003403738.1.77312 WP_003403738.1.77348 WP_003403738.1.77351 WP_003403738.1.77352 WP_003403738.1.77361 WP_003403738.1.774 WP_003403738.1.7740 WP_003403738.1.77404 WP_003403738.1.77425 WP_003403738.1.77463 WP_003403738.1.77474 WP_003403738.1.7748 WP_003403738.1.77484 WP_003403738.1.77491 WP_003403738.1.77499 WP_003403738.1.77510 WP_003403738.1.77530 WP_003403738.1.77554 WP_003403738.1.77559 WP_003403738.1.77599 WP_003403738.1.77605 WP_003403738.1.7762 WP_003403738.1.77627 WP_003403738.1.77649 WP_003403738.1.77654 WP_003403738.1.7766 WP_003403738.1.77667 WP_003403738.1.77704 WP_003403738.1.77706 WP_003403738.1.77726 WP_003403738.1.77774 WP_003403738.1.7778 WP_003403738.1.77790 WP_003403738.1.77809 WP_003403738.1.77820 WP_003403738.1.77843 WP_003403738.1.77855 WP_003403738.1.77865 WP_003403738.1.77868 WP_003403738.1.77879 WP_003403738.1.77890 WP_003403738.1.77909 WP_003403738.1.77911 WP_003403738.1.77931 WP_003403738.1.77984 WP_003403738.1.78020 WP_003403738.1.78024 WP_003403738.1.78084 WP_003403738.1.78086 WP_003403738.1.7809 WP_003403738.1.78098 WP_003403738.1.78105 WP_003403738.1.78113 WP_003403738.1.78136 WP_003403738.1.78162 WP_003403738.1.7817 WP_003403738.1.78200 WP_003403738.1.78216 WP_003403738.1.78236 WP_003403738.1.78238 WP_003403738.1.78322 WP_003403738.1.78338 WP_003403738.1.7836 WP_003403738.1.78360 WP_003403738.1.78386 WP_003403738.1.78429 WP_003403738.1.78435 WP_003403738.1.7844 WP_003403738.1.78459 WP_003403738.1.78488 WP_003403738.1.7849 WP_003403738.1.78499 WP_003403738.1.785 WP_003403738.1.78516 WP_003403738.1.78524 WP_003403738.1.78538 WP_003403738.1.78544 WP_003403738.1.78545 WP_003403738.1.78547 WP_003403738.1.78574 WP_003403738.1.78580 WP_003403738.1.7860 WP_003403738.1.78620 WP_003403738.1.78646 WP_003403738.1.78648 WP_003403738.1.78655 WP_003403738.1.78657 WP_003403738.1.78659 WP_003403738.1.7869 WP_003403738.1.78692 WP_003403738.1.78760 WP_003403738.1.78766 WP_003403738.1.78776 WP_003403738.1.78778 WP_003403738.1.78784 WP_003403738.1.78788 WP_003403738.1.78790 WP_003403738.1.78793 WP_003403738.1.78848 WP_003403738.1.78860 WP_003403738.1.7887 WP_003403738.1.78884 WP_003403738.1.78932 WP_003403738.1.78969 WP_003403738.1.78977 WP_003403738.1.78980 WP_003403738.1.79005 WP_003403738.1.79016 WP_003403738.1.79033 WP_003403738.1.79064 WP_003403738.1.79066 WP_003403738.1.79068 WP_003403738.1.79077 WP_003403738.1.79095 WP_003403738.1.79112 WP_003403738.1.79122 WP_003403738.1.79145 WP_003403738.1.79152 WP_003403738.1.79163 WP_003403738.1.79182 WP_003403738.1.79198 WP_003403738.1.79213 WP_003403738.1.79218 WP_003403738.1.79268 WP_003403738.1.79273 WP_003403738.1.79278 WP_003403738.1.79290 WP_003403738.1.79319 WP_003403738.1.79325 WP_003403738.1.79326 WP_003403738.1.7933 WP_003403738.1.79330 WP_003403738.1.79339 WP_003403738.1.79394 WP_003403738.1.79399 WP_003403738.1.79413 WP_003403738.1.79422 WP_003403738.1.79445 WP_003403738.1.79447 WP_003403738.1.79455 WP_003403738.1.79471 WP_003403738.1.79480 WP_003403738.1.79482 WP_003403738.1.79488 WP_003403738.1.79500 WP_003403738.1.79502 WP_003403738.1.79508 WP_003403738.1.79514 WP_003403738.1.79561 WP_003403738.1.79565 WP_003403738.1.79578 WP_003403738.1.79588 WP_003403738.1.79598 WP_003403738.1.79615 WP_003403738.1.79684 WP_003403738.1.79698 WP_003403738.1.797 WP_003403738.1.79744 WP_003403738.1.79784 WP_003403738.1.79802 WP_003403738.1.79806 WP_003403738.1.79819 WP_003403738.1.79826 WP_003403738.1.79828 WP_003403738.1.79851 WP_003403738.1.79853 WP_003403738.1.79863 WP_003403738.1.79881 WP_003403738.1.79885 WP_003403738.1.79898 WP_003403738.1.7990 WP_003403738.1.79900 WP_003403738.1.79913 WP_003403738.1.79918 WP_003403738.1.79947 WP_003403738.1.79948 WP_003403738.1.7995 WP_003403738.1.7997 WP_003403738.1.80004 WP_003403738.1.80015 WP_003403738.1.80022 WP_003403738.1.80030 WP_003403738.1.80054 WP_003403738.1.80084 WP_003403738.1.80099 WP_003403738.1.80129 WP_003403738.1.80177 WP_003403738.1.80234 WP_003403738.1.8026 WP_003403738.1.80275 WP_003403738.1.8029 WP_003403738.1.80299 WP_003403738.1.80300 WP_003403738.1.80304 WP_003403738.1.80326 WP_003403738.1.80351 WP_003403738.1.8037 WP_003403738.1.80370 WP_003403738.1.80387 WP_003403738.1.80399 WP_003403738.1.8044 WP_003403738.1.80451 WP_003403738.1.80458 WP_003403738.1.80461 WP_003403738.1.80490 WP_003403738.1.80503 WP_003403738.1.80507 WP_003403738.1.80552 WP_003403738.1.80576 WP_003403738.1.80588 WP_003403738.1.80599 WP_003403738.1.8060 WP_003403738.1.80624 WP_003403738.1.80636 WP_003403738.1.80669 WP_003403738.1.80673 WP_003403738.1.80711 WP_003403738.1.80714 WP_003403738.1.80743 WP_003403738.1.80784 WP_003403738.1.80815 WP_003403738.1.80853 WP_003403738.1.80918 WP_003403738.1.8093 WP_003403738.1.80967 WP_003403738.1.8097 WP_003403738.1.80988 WP_003403738.1.81007 WP_003403738.1.81013 WP_003403738.1.8105 WP_003403738.1.81059 WP_003403738.1.81063 WP_003403738.1.81066 WP_003403738.1.81075 WP_003403738.1.81091 WP_003403738.1.81119 WP_003403738.1.81125 WP_003403738.1.81136 WP_003403738.1.8114 WP_003403738.1.81189 WP_003403738.1.81192 WP_003403738.1.812 WP_003403738.1.81230 WP_003403738.1.81249 WP_003403738.1.81250 WP_003403738.1.81264 WP_003403738.1.8128 WP_003403738.1.81287 WP_003403738.1.81297 WP_003403738.1.8138 WP_003403738.1.81407 WP_003403738.1.8143 WP_003403738.1.81439 WP_003403738.1.81465 WP_003403738.1.81505 WP_003403738.1.81529 WP_003403738.1.81538 WP_003403738.1.81541 WP_003403738.1.81560 WP_003403738.1.81561 WP_003403738.1.81567 WP_003403738.1.81583 WP_003403738.1.81686 WP_003403738.1.81712 WP_003403738.1.81720 WP_003403738.1.81731 WP_003403738.1.81774 WP_003403738.1.81788 WP_003403738.1.81809 WP_003403738.1.81820 WP_003403738.1.81850 WP_003403738.1.81883 WP_003403738.1.81891 WP_003403738.1.81911 WP_003403738.1.81918 WP_003403738.1.82011 WP_003403738.1.82048 WP_003403738.1.82069 WP_003403738.1.82071 WP_003403738.1.82108 WP_003403738.1.82136 WP_003403738.1.82142 WP_003403738.1.8215 WP_003403738.1.82158 WP_003403738.1.8217 WP_003403738.1.82209 WP_003403738.1.82210 WP_003403738.1.82228 WP_003403738.1.82236 WP_003403738.1.82251 WP_003403738.1.82271 WP_003403738.1.82305 WP_003403738.1.82307 WP_003403738.1.82309 WP_003403738.1.82317 WP_003403738.1.8232 WP_003403738.1.82346 WP_003403738.1.82374 WP_003403738.1.82385 WP_003403738.1.82429 WP_003403738.1.82460 WP_003403738.1.82462 WP_003403738.1.82483 WP_003403738.1.82494 WP_003403738.1.82531 WP_003403738.1.82546 WP_003403738.1.82547 WP_003403738.1.82549 WP_003403738.1.82577 WP_003403738.1.82592 WP_003403738.1.82597 WP_003403738.1.82598 WP_003403738.1.82625 WP_003403738.1.82642 WP_003403738.1.82651 WP_003403738.1.82653 WP_003403738.1.82681 WP_003403738.1.82685 WP_003403738.1.82712 WP_003403738.1.8273 WP_003403738.1.82743 WP_003403738.1.82757 WP_003403738.1.82774 WP_003403738.1.82803 WP_003403738.1.82836 WP_003403738.1.82860 WP_003403738.1.82871 WP_003403738.1.82892 WP_003403738.1.82935 WP_003403738.1.82957 WP_003403738.1.82973 WP_003403738.1.82981 WP_003403738.1.82983 WP_003403738.1.83004 WP_003403738.1.83009 WP_003403738.1.83044 WP_003403738.1.83065 WP_003403738.1.83074 WP_003403738.1.83110 WP_003403738.1.83146 WP_003403738.1.83149 WP_003403738.1.83159 WP_003403738.1.8317 WP_003403738.1.83173 WP_003403738.1.83181 WP_003403738.1.83182 WP_003403738.1.83191 WP_003403738.1.83197 WP_003403738.1.83212 WP_003403738.1.8326 WP_003403738.1.83262 WP_003403738.1.83268 WP_003403738.1.83273 WP_003403738.1.83309 WP_003403738.1.83332 WP_003403738.1.83334 WP_003403738.1.83341 WP_003403738.1.83349 WP_003403738.1.8335 WP_003403738.1.83353 WP_003403738.1.83367 WP_003403738.1.83380 WP_003403738.1.83381 WP_003403738.1.83389 WP_003403738.1.83408 WP_003403738.1.83409 WP_003403738.1.83435 WP_003403738.1.83470 WP_003403738.1.83524 WP_003403738.1.83526 WP_003403738.1.8358 WP_003403738.1.83589 WP_003403738.1.83601 WP_003403738.1.83611 WP_003403738.1.83638 WP_003403738.1.83648 WP_003403738.1.83656 WP_003403738.1.83667 WP_003403738.1.83689 WP_003403738.1.83692 WP_003403738.1.83704 WP_003403738.1.83705 WP_003403738.1.83766 WP_003403738.1.83793 WP_003403738.1.83794 WP_003403738.1.83802 WP_003403738.1.83805 WP_003403738.1.83839 WP_003403738.1.83842 WP_003403738.1.83850 WP_003403738.1.83861 WP_003403738.1.83884 WP_003403738.1.83920 WP_003403738.1.83929 WP_003403738.1.83930 WP_003403738.1.83975 WP_003403738.1.83991 WP_003403738.1.8400 WP_003403738.1.84027 WP_003403738.1.8404 WP_003403738.1.84057 WP_003403738.1.84070 WP_003403738.1.8409 WP_003403738.1.84112 WP_003403738.1.84146 WP_003403738.1.8415 WP_003403738.1.84176 WP_003403738.1.84186 WP_003403738.1.84192 WP_003403738.1.84228 WP_003403738.1.8424 WP_003403738.1.84244 WP_003403738.1.84259 WP_003403738.1.8426 WP_003403738.1.84277 WP_003403738.1.84287 WP_003403738.1.8434 WP_003403738.1.84388 WP_003403738.1.84408 WP_003403738.1.84409 WP_003403738.1.84438 WP_003403738.1.84460 WP_003403738.1.84488 WP_003403738.1.84504 WP_003403738.1.84620 WP_003403738.1.84623 WP_003403738.1.84641 WP_003403738.1.84655 WP_003403738.1.84666 WP_003403738.1.84670 WP_003403738.1.84739 WP_003403738.1.84748 WP_003403738.1.84766 WP_003403738.1.84772 WP_003403738.1.84774 WP_003403738.1.848 WP_003403738.1.84812 WP_003403738.1.84836 WP_003403738.1.84839 WP_003403738.1.84846 WP_003403738.1.84873 WP_003403738.1.84911 WP_003403738.1.84938 WP_003403738.1.84968 WP_003403738.1.84973 WP_003403738.1.84981 WP_003403738.1.84985 WP_003403738.1.8503 WP_003403738.1.85038 WP_003403738.1.85041 WP_003403738.1.85043 WP_003403738.1.8505 WP_003403738.1.85074 WP_003403738.1.8509 WP_003403738.1.8512 WP_003403738.1.85148 WP_003403738.1.8518 WP_003403738.1.8522 WP_003403738.1.85242 WP_003403738.1.85276 WP_003403738.1.85281 WP_003403738.1.85284 WP_003403738.1.85314 WP_003403738.1.85319 WP_003403738.1.85330 WP_003403738.1.85341 WP_003403738.1.8535 WP_003403738.1.85363 WP_003403738.1.85371 WP_003403738.1.85377 WP_003403738.1.85387 WP_003403738.1.85399 WP_003403738.1.85458 WP_003403738.1.8546 WP_003403738.1.85464 WP_003403738.1.85478 WP_003403738.1.85480 WP_003403738.1.85488 WP_003403738.1.85495 WP_003403738.1.85557 WP_003403738.1.85577 WP_003403738.1.85597 WP_003403738.1.85599 WP_003403738.1.85610 WP_003403738.1.8563 WP_003403738.1.85648 WP_003403738.1.85679 WP_003403738.1.85704 WP_003403738.1.85717 WP_003403738.1.85727 WP_003403738.1.85737 WP_003403738.1.85763 WP_003403738.1.85808 WP_003403738.1.85819 WP_003403738.1.85820 WP_003403738.1.85823 WP_003403738.1.85832 WP_003403738.1.8586 WP_003403738.1.85872 WP_003403738.1.85894 WP_003403738.1.85909 WP_003403738.1.85913 WP_003403738.1.85953 WP_003403738.1.85986 WP_003403738.1.86000 WP_003403738.1.86024 WP_003403738.1.86025 WP_003403738.1.86032 WP_003403738.1.86048 WP_003403738.1.86052 WP_003403738.1.86067 WP_003403738.1.86103 WP_003403738.1.86122 WP_003403738.1.86124 WP_003403738.1.86160 WP_003403738.1.86164 WP_003403738.1.86168 WP_003403738.1.86190 WP_003403738.1.86204 WP_003403738.1.86208 WP_003403738.1.86235 WP_003403738.1.86249 WP_003403738.1.86260 WP_003403738.1.86290 WP_003403738.1.863 WP_003403738.1.86327 WP_003403738.1.86334 WP_003403738.1.86337 WP_003403738.1.86368 WP_003403738.1.86377 WP_003403738.1.86425 WP_003403738.1.86459 WP_003403738.1.8649 WP_003403738.1.86499 WP_003403738.1.86520 WP_003403738.1.86568 WP_003403738.1.86575 WP_003403738.1.86584 WP_003403738.1.86605 WP_003403738.1.86626 WP_003403738.1.86648 WP_003403738.1.8666 WP_003403738.1.86684 WP_003403738.1.86696 WP_003403738.1.86705 WP_003403738.1.86718 WP_003403738.1.86725 WP_003403738.1.86757 WP_003403738.1.86766 WP_003403738.1.86801 WP_003403738.1.86814 WP_003403738.1.86820 WP_003403738.1.86825 WP_003403738.1.86834 WP_003403738.1.8685 WP_003403738.1.86851 WP_003403738.1.86855 WP_003403738.1.86867 WP_003403738.1.86877 WP_003403738.1.86883 WP_003403738.1.8689 WP_003403738.1.86892 WP_003403738.1.86933 WP_003403738.1.86941 WP_003403738.1.86950 WP_003403738.1.86962 WP_003403738.1.86963 WP_003403738.1.86979 WP_003403738.1.8700 WP_003403738.1.87001 WP_003403738.1.87002 WP_003403738.1.87031 WP_003403738.1.87116 WP_003403738.1.87117 WP_003403738.1.8714 WP_003403738.1.87162 WP_003403738.1.87178 WP_003403738.1.87191 WP_003403738.1.87201 WP_003403738.1.87209 WP_003403738.1.87240 WP_003403738.1.87266 WP_003403738.1.87273 WP_003403738.1.87275 WP_003403738.1.8733 WP_003403738.1.87345 WP_003403738.1.87369 WP_003403738.1.8737 WP_003403738.1.87401 WP_003403738.1.87404 WP_003403738.1.87406 WP_003403738.1.87409 WP_003403738.1.87444 WP_003403738.1.87446 WP_003403738.1.87459 WP_003403738.1.87472 WP_003403738.1.87489 WP_003403738.1.87494 WP_003403738.1.87496 WP_003403738.1.87582 WP_003403738.1.87588 WP_003403738.1.87617 WP_003403738.1.87619 WP_003403738.1.87620 WP_003403738.1.87643 WP_003403738.1.8765 WP_003403738.1.87650 WP_003403738.1.87654 WP_003403738.1.87658 WP_003403738.1.87665 WP_003403738.1.87676 WP_003403738.1.87677 WP_003403738.1.87684 WP_003403738.1.87692 WP_003403738.1.87707 WP_003403738.1.87732 WP_003403738.1.87784 WP_003403738.1.87796 WP_003403738.1.87809 WP_003403738.1.87817 WP_003403738.1.87827 WP_003403738.1.87831 WP_003403738.1.87835 WP_003403738.1.87837 WP_003403738.1.87866 WP_003403738.1.8789 WP_003403738.1.87911 WP_003403738.1.87924 WP_003403738.1.87951 WP_003403738.1.87955 WP_003403738.1.87956 WP_003403738.1.87991 WP_003403738.1.88 WP_003403738.1.88002 WP_003403738.1.88037 WP_003403738.1.88039 WP_003403738.1.88072 WP_003403738.1.88077 WP_003403738.1.88121 WP_003403738.1.88180 WP_003403738.1.88191 WP_003403738.1.88205 WP_003403738.1.88217 WP_003403738.1.88219 WP_003403738.1.88245 WP_003403738.1.88253 WP_003403738.1.88294 WP_003403738.1.88315 WP_003403738.1.88316 WP_003403738.1.88320 WP_003403738.1.88338 WP_003403738.1.8840 WP_003403738.1.88437 WP_003403738.1.88453 WP_003403738.1.88469 WP_003403738.1.88489 WP_003403738.1.88507 WP_003403738.1.88521 WP_003403738.1.88530 WP_003403738.1.88537 WP_003403738.1.88541 WP_003403738.1.88592 WP_003403738.1.88616 WP_003403738.1.88618 WP_003403738.1.8862 WP_003403738.1.88625 WP_003403738.1.88632 WP_003403738.1.88634 WP_003403738.1.88649 WP_003403738.1.8870 WP_003403738.1.88737 WP_003403738.1.88756 WP_003403738.1.88824 WP_003403738.1.88886 WP_003403738.1.88965 WP_003403738.1.88985 WP_003403738.1.89025 WP_003403738.1.89041 WP_003403738.1.89046 WP_003403738.1.89082 WP_003403738.1.89162 WP_003403738.1.89168 WP_003403738.1.8917 WP_003403738.1.89193 WP_003403738.1.89205 WP_003403738.1.89207 WP_003403738.1.89225 WP_003403738.1.8925 WP_003403738.1.89277 WP_003403738.1.89286 WP_003403738.1.89320 WP_003403738.1.8935 WP_003403738.1.89371 WP_003403738.1.89378 WP_003403738.1.89392 WP_003403738.1.89406 WP_003403738.1.8943 WP_003403738.1.89451 WP_003403738.1.89453 WP_003403738.1.89473 WP_003403738.1.89475 WP_003403738.1.89483 WP_003403738.1.895 WP_003403738.1.89513 WP_003403738.1.89517 WP_003403738.1.89522 WP_003403738.1.8954 WP_003403738.1.89543 WP_003403738.1.89567 WP_003403738.1.8957 WP_003403738.1.89572 WP_003403738.1.89589 WP_003403738.1.89607 WP_003403738.1.89613 WP_003403738.1.89625 WP_003403738.1.89648 WP_003403738.1.8967 WP_003403738.1.89670 WP_003403738.1.89676 WP_003403738.1.89729 WP_003403738.1.89739 WP_003403738.1.89762 WP_003403738.1.8977 WP_003403738.1.89802 WP_003403738.1.89808 WP_003403738.1.8982 WP_003403738.1.89829 WP_003403738.1.89831 WP_003403738.1.89844 WP_003403738.1.89849 WP_003403738.1.8989 WP_003403738.1.89901 WP_003403738.1.89903 WP_003403738.1.89909 WP_003403738.1.8992 WP_003403738.1.89922 WP_003403738.1.89926 WP_003403738.1.89963 WP_003403738.1.89971 WP_003403738.1.8998 WP_003403738.1.89987 WP_003403738.1.900 WP_003403738.1.90048 WP_003403738.1.9007 WP_003403738.1.90080 WP_003403738.1.90130 WP_003403738.1.90134 WP_003403738.1.90137 WP_003403738.1.90157 WP_003403738.1.90184 WP_003403738.1.90199 WP_003403738.1.90231 WP_003403738.1.90245 WP_003403738.1.90308 WP_003403738.1.90322 WP_003403738.1.90328 WP_003403738.1.90372 WP_003403738.1.90439 WP_003403738.1.90481 WP_003403738.1.90499 WP_003403738.1.9050 WP_003403738.1.90527 WP_003403738.1.90550 WP_003403738.1.90560 WP_003403738.1.90612 WP_003403738.1.90640 WP_003403738.1.90672 WP_003403738.1.90687 WP_003403738.1.90691 WP_003403738.1.90711 WP_003403738.1.90722 WP_003403738.1.90744 WP_003403738.1.9075 WP_003403738.1.90756 WP_003403738.1.90767 WP_003403738.1.90771 WP_003403738.1.90785 WP_003403738.1.90788 WP_003403738.1.90800 WP_003403738.1.90810 WP_003403738.1.90816 WP_003403738.1.90819 WP_003403738.1.9082 WP_003403738.1.90831 WP_003403738.1.90884 WP_003403738.1.90899 WP_003403738.1.90906 WP_003403738.1.90958 WP_003403738.1.90976 WP_003403738.1.90977 WP_003403738.1.90987 WP_003403738.1.9102 WP_003403738.1.91026 WP_003403738.1.91032 WP_003403738.1.91043 WP_003403738.1.91053 WP_003403738.1.91082 WP_003403738.1.91106 WP_003403738.1.91112 WP_003403738.1.91144 WP_003403738.1.91151 WP_003403738.1.91157 WP_003403738.1.91167 WP_003403738.1.91169 WP_003403738.1.91192 WP_003403738.1.91201 WP_003403738.1.91207 WP_003403738.1.91208 WP_003403738.1.91211 WP_003403738.1.91214 WP_003403738.1.91230 WP_003403738.1.91244 WP_003403738.1.91251 WP_003403738.1.91260 WP_003403738.1.91265 WP_003403738.1.9128 WP_003403738.1.91284 WP_003403738.1.91294 WP_003403738.1.91303 WP_003403738.1.91322 WP_003403738.1.91352 WP_003403738.1.91386 WP_003403738.1.9139 WP_003403738.1.91398 WP_003403738.1.91411 WP_003403738.1.91430 WP_003403738.1.91436 WP_003403738.1.91483 WP_003403738.1.91496 WP_003403738.1.91507 WP_003403738.1.91508 WP_003403738.1.91576 WP_003403738.1.91589 WP_003403738.1.91694 WP_003403738.1.91695 WP_003403738.1.91713 WP_003403738.1.91716 WP_003403738.1.91717 WP_003403738.1.91728 WP_003403738.1.91743 WP_003403738.1.91759 WP_003403738.1.91784 WP_003403738.1.91785 WP_003403738.1.91786 WP_003403738.1.91802 WP_003403738.1.91822 WP_003403738.1.91828 WP_003403738.1.9189 WP_003403738.1.91896 WP_003403738.1.9190 WP_003403738.1.91915 WP_003403738.1.91931 WP_003403738.1.91944 WP_003403738.1.91953 WP_003403738.1.91957 WP_003403738.1.91976 WP_003403738.1.91978 WP_003403738.1.92021 WP_003403738.1.92083 WP_003403738.1.92127 WP_003403738.1.92144 WP_003403738.1.92150 WP_003403738.1.92153 WP_003403738.1.92190 WP_003403738.1.92192 WP_003403738.1.92200 WP_003403738.1.92220 WP_003403738.1.92221 WP_003403738.1.92222 WP_003403738.1.92273 WP_003403738.1.92289 WP_003403738.1.9229 WP_003403738.1.92294 WP_003403738.1.92300 WP_003403738.1.92317 WP_003403738.1.92334 WP_003403738.1.92338 WP_003403738.1.92345 WP_003403738.1.92356 WP_003403738.1.92364 WP_003403738.1.92380 WP_003403738.1.92416 WP_003403738.1.92428 WP_003403738.1.92447 WP_003403738.1.92456 WP_003403738.1.92467 WP_003403738.1.92471 WP_003403738.1.92490 WP_003403738.1.92508 WP_003403738.1.9251 WP_003403738.1.92511 WP_003403738.1.92523 WP_003403738.1.92527 WP_003403738.1.92536 WP_003403738.1.92592 WP_003403738.1.92597 WP_003403738.1.92603 WP_003403738.1.92606 WP_003403738.1.92610 WP_003403738.1.92613 WP_003403738.1.9263 WP_003403738.1.92650 WP_003403738.1.92660 WP_003403738.1.92677 WP_003403738.1.92685 WP_003403738.1.92689 WP_003403738.1.92690 WP_003403738.1.92706 WP_003403738.1.92714 WP_003403738.1.92736 WP_003403738.1.92752 WP_003403738.1.92760 WP_003403738.1.92777 WP_003403738.1.92803 WP_003403738.1.92833 WP_003403738.1.92856 WP_003403738.1.92881 WP_003403738.1.92892 WP_003403738.1.92907 WP_003403738.1.92908 WP_003403738.1.9291 WP_003403738.1.92917 WP_003403738.1.92996 WP_003403738.1.93006 WP_003403738.1.93008 WP_003403738.1.93009 WP_003403738.1.93015 WP_003403738.1.93043 WP_003403738.1.9307 WP_003403738.1.93083 WP_003403738.1.93097 WP_003403738.1.93137 WP_003403738.1.93192 WP_003403738.1.93199 WP_003403738.1.93203 WP_003403738.1.93212 WP_003403738.1.93234 WP_003403738.1.93245 WP_003403738.1.93257 WP_003403738.1.93265 WP_003403738.1.93297 WP_003403738.1.93320 WP_003403738.1.93328 WP_003403738.1.93337 WP_003403738.1.93343 WP_003403738.1.93349 WP_003403738.1.93363 WP_003403738.1.93377 WP_003403738.1.93407 WP_003403738.1.93417 WP_003403738.1.93419 WP_003403738.1.93426 WP_003403738.1.9344 WP_003403738.1.93443 WP_003403738.1.93447 WP_003403738.1.93470 WP_003403738.1.93483 WP_003403738.1.93487 WP_003403738.1.93495 WP_003403738.1.93499 WP_003403738.1.93516 WP_003403738.1.93536 WP_003403738.1.93544 WP_003403738.1.93555 WP_003403738.1.93560 WP_003403738.1.93564 WP_003403738.1.9357 WP_003403738.1.93573 WP_003403738.1.93576 WP_003403738.1.93588 WP_003403738.1.9363 WP_003403738.1.93645 WP_003403738.1.93649 WP_003403738.1.93659 WP_003403738.1.93677 WP_003403738.1.9368 WP_003403738.1.93689 WP_003403738.1.93698 WP_003403738.1.93706 WP_003403738.1.9371 WP_003403738.1.93792 WP_003403738.1.93823 WP_003403738.1.93871 WP_003403738.1.9388 WP_003403738.1.93894 WP_003403738.1.93903 WP_003403738.1.93907 WP_003403738.1.93913 WP_003403738.1.93946 WP_003403738.1.93950 WP_003403738.1.93953 WP_003403738.1.93954 WP_003403738.1.93988 WP_003403738.1.9407 WP_003403738.1.94143 WP_003403738.1.94154 WP_003403738.1.94184 WP_003403738.1.94204 WP_003403738.1.94205 WP_003403738.1.94226 WP_003403738.1.94231 WP_003403738.1.94256 WP_003403738.1.94261 WP_003403738.1.94281 WP_003403738.1.94292 WP_003403738.1.94297 WP_003403738.1.9431 WP_003403738.1.94326 WP_003403738.1.94339 WP_003403738.1.94392 WP_003403738.1.94416 WP_003403738.1.94421 WP_003403738.1.94456 WP_003403738.1.94470 WP_003403738.1.94480 WP_003403738.1.94495 WP_003403738.1.94511 WP_003403738.1.94512 WP_003403738.1.94525 WP_003403738.1.94528 WP_003403738.1.94564 WP_003403738.1.946 WP_003403738.1.94602 WP_003403738.1.94623 WP_003403738.1.94629 WP_003403738.1.9465 WP_003403738.1.94673 WP_003403738.1.94714 WP_003403738.1.94730 WP_003403738.1.94736 WP_003403738.1.94776 WP_003403738.1.9478 WP_003403738.1.94834 WP_003403738.1.94852 WP_003403738.1.94872 WP_003403738.1.9488 WP_003403738.1.94902 WP_003403738.1.94916 WP_003403738.1.94979 WP_003403738.1.94994 WP_003403738.1.94996 WP_003403738.1.94998 WP_003403738.1.95007 WP_003403738.1.95010 WP_003403738.1.95015 WP_003403738.1.95034 WP_003403738.1.95068 WP_003403738.1.95081 WP_003403738.1.95082 WP_003403738.1.9509 WP_003403738.1.95096 WP_003403738.1.95112 WP_003403738.1.95138 WP_003403738.1.9514 WP_003403738.1.95179 WP_003403738.1.95188 WP_003403738.1.95190 WP_003403738.1.95234 WP_003403738.1.95241 WP_003403738.1.95245 WP_003403738.1.95257 WP_003403738.1.95279 WP_003403738.1.9531 WP_003403738.1.95335 WP_003403738.1.95344 WP_003403738.1.9535 WP_003403738.1.95370 WP_003403738.1.95392 WP_003403738.1.95416 WP_003403738.1.95417 WP_003403738.1.95454 WP_003403738.1.95455 WP_003403738.1.95491 WP_003403738.1.95497 WP_003403738.1.95508 WP_003403738.1.95509 WP_003403738.1.95529 WP_003403738.1.95556 WP_003403738.1.95557 WP_003403738.1.95565 WP_003403738.1.95578 WP_003403738.1.95580 WP_003403738.1.95585 WP_003403738.1.95643 WP_003403738.1.95679 WP_003403738.1.95685 WP_003403738.1.957 WP_003403738.1.95724 WP_003403738.1.95727 WP_003403738.1.95730 WP_003403738.1.95735 WP_003403738.1.95758 WP_003403738.1.95772 WP_003403738.1.95797 WP_003403738.1.95839 WP_003403738.1.9585 WP_003403738.1.9590 WP_003403738.1.95902 WP_003403738.1.95908 WP_003403738.1.95924 WP_003403738.1.95926 WP_003403738.1.95953 WP_003403738.1.95958 WP_003403738.1.95964 WP_003403738.1.95973 WP_003403738.1.96006 WP_003403738.1.9602 WP_003403738.1.96036 WP_003403738.1.96062 WP_003403738.1.96065 WP_003403738.1.96098 WP_003403738.1.96146 WP_003403738.1.96166 WP_003403738.1.96171 WP_003403738.1.96182 WP_003403738.1.96204 WP_003403738.1.96230 WP_003403738.1.96235 WP_003403738.1.96242 WP_003403738.1.96245 WP_003403738.1.96254 WP_003403738.1.96259 WP_003403738.1.96286 WP_003403738.1.96313 WP_003403738.1.96318 WP_003403738.1.96345 WP_003403738.1.96360 WP_003403738.1.96373 WP_003403738.1.96456 WP_003403738.1.96486 WP_003403738.1.96560 WP_003403738.1.96569 WP_003403738.1.96573 WP_003403738.1.96575 WP_003403738.1.96576 WP_003403738.1.96611 WP_003403738.1.96621 WP_003403738.1.9667 WP_003403738.1.96681 WP_003403738.1.96726 WP_003403738.1.96733 WP_003403738.1.96742 WP_003403738.1.96754 WP_003403738.1.9678 WP_003403738.1.96832 WP_003403738.1.9685 WP_003403738.1.97008 WP_003403738.1.97009 WP_003403738.1.97084 WP_003403738.1.97087 WP_003403738.1.97094 WP_003403738.1.97096 WP_003403738.1.97099 WP_003403738.1.97108 WP_003403738.1.97113 WP_003403738.1.97122 WP_003403738.1.97127 WP_003403738.1.97129 WP_003403738.1.97136 WP_003403738.1.9716 WP_003403738.1.97176 WP_003403738.1.97222 WP_003403738.1.97223 WP_003403738.1.97237 WP_003403738.1.97242 WP_003403738.1.97270 WP_003403738.1.97283 WP_003403738.1.97296 WP_003403738.1.97321 WP_003403738.1.97325 WP_003403738.1.97330 WP_003403738.1.97366 WP_003403738.1.97376 WP_003403738.1.97380 WP_003403738.1.9739 WP_003403738.1.97462 WP_003403738.1.97517 WP_003403738.1.97519 WP_003403738.1.97535 WP_003403738.1.97540 WP_003403738.1.97545 WP_003403738.1.97546 WP_003403738.1.97550 WP_003403738.1.97568 WP_003403738.1.97577 WP_003403738.1.97584 WP_003403738.1.9759 WP_003403738.1.97591 WP_003403738.1.97596 WP_003403738.1.97609 WP_003403738.1.97618 WP_003403738.1.9763 WP_003403738.1.97669 WP_003403738.1.97673 WP_003403738.1.97700 WP_003403738.1.97701 WP_003403738.1.9773 WP_003403738.1.97730 WP_003403738.1.97740 WP_003403738.1.97751 WP_003403738.1.97754 WP_003403738.1.97797 WP_003403738.1.9782 WP_003403738.1.9784 WP_003403738.1.97888 WP_003403738.1.9790 WP_003403738.1.9795 WP_003403738.1.97951 WP_003403738.1.97958 WP_003403738.1.97966 WP_003403738.1.97977 WP_003403738.1.97979 WP_003403738.1.97995 WP_003403738.1.98018 WP_003403738.1.98034 WP_003403738.1.98052 WP_003403738.1.98071 WP_003403738.1.98072 WP_003403738.1.98113 WP_003403738.1.98114 WP_003403738.1.98128 WP_003403738.1.98181 WP_003403738.1.98188 WP_003403738.1.98189 WP_003403738.1.98213 WP_003403738.1.98225 WP_003403738.1.98291 WP_003403738.1.98335 WP_003403738.1.98350 WP_003403738.1.98395 WP_003403738.1.98412 WP_003403738.1.98441 WP_003403738.1.98443 WP_003403738.1.98462 WP_003403738.1.9848 WP_003403738.1.98482 WP_003403738.1.98486 WP_003403738.1.98488 WP_003403738.1.98503 WP_003403738.1.98516 WP_003403738.1.98524 WP_003403738.1.98536 WP_003403738.1.98541 WP_003403738.1.98566 WP_003403738.1.98576 WP_003403738.1.98594 WP_003403738.1.98599 WP_003403738.1.98629 WP_003403738.1.98645 WP_003403738.1.98646 WP_003403738.1.98649 WP_003403738.1.98656 WP_003403738.1.9867 WP_003403738.1.98674 WP_003403738.1.98697 WP_003403738.1.98701 WP_003403738.1.98739 WP_003403738.1.98749 WP_003403738.1.98765 WP_003403738.1.98770 WP_003403738.1.98777 WP_003403738.1.98778 WP_003403738.1.98802 WP_003403738.1.98838 WP_003403738.1.98850 WP_003403738.1.98906 WP_003403738.1.98935 WP_003403738.1.98948 WP_003403738.1.98953 WP_003403738.1.98984 WP_003403738.1.99000 WP_003403738.1.99023 WP_003403738.1.99030 WP_003403738.1.99037 WP_003403738.1.99055 WP_003403738.1.99062 WP_003403738.1.99086 WP_003403738.1.99115 WP_003403738.1.99117 WP_003403738.1.99161 WP_003403738.1.99176 WP_003403738.1.99205 WP_003403738.1.99211 WP_003403738.1.99216 WP_003403738.1.99222 WP_003403738.1.99251 WP_003403738.1.99269 WP_003403738.1.99294 WP_003403738.1.99312 WP_003403738.1.99315 WP_003403738.1.99316 WP_003403738.1.99322 WP_003403738.1.99328 WP_003403738.1.99365 WP_003403738.1.99368 WP_003403738.1.99379 WP_003403738.1.99396 WP_003403738.1.99402 WP_003403738.1.99404 WP_003403738.1.99419 WP_003403738.1.99438 WP_003403738.1.99460 WP_003403738.1.99468 WP_003403738.1.99473 WP_003403738.1.99513 WP_003403738.1.99529 WP_003403738.1.99548 WP_003403738.1.99572 WP_003403738.1.99575 WP_003403738.1.99578 WP_003403738.1.99605 WP_003403738.1.99609 WP_003403738.1.99617 WP_003403738.1.99635 WP_003403738.1.99650 WP_003403738.1.99672 WP_003403738.1.99701 WP_003403738.1.99711 WP_003403738.1.99716 WP_003403738.1.99740 WP_003403738.1.99745 WP_003403738.1.99749 WP_003403738.1.9976 WP_003403738.1.99798 WP_003403738.1.99817 WP_003403738.1.99832 WP_003403738.1.99847 WP_003403738.1.99852 WP_003403738.1.99886 WP_003403738.1.99897 WP_003403738.1.99899 WP_003403738.1.99915 WP_003403738.1.9993 WP_003403738.1.99982 WP_003403738.1.99991 gi|433640861|ref|YP_007286620.1| gi|506925160|ref|YP_008005610.1| gi|148821942|ref|YP_001286696.1| gi|224989131|ref|YP_002643818.1| gi|385990208|ref|YP_005908506.1| gi|525673541|ref|YP_008224835.1| gi|121636659|ref|YP_976882.1| gi|375294956|ref|YP_005099223.1| gi|197739500|ref|YP_002160814.1| gi|253797681|ref|YP_003030682.1| gi|392431166|ref|YP_006472210.1| gi|471336587|ref|YP_007609300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]