SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197739628|ref|YP_002160942.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197739628|ref|YP_002160942.1|
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.9e-25
Family MarR-like transcriptional regulators 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197739628|ref|YP_002160942.1|
Sequence length 143
Comment transcriptional regulator MarR-family [Mycobacterium tuberculosis str. Haarlem]
Sequence
MLDSDARLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERV
RPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATL
NRSERDILRSAADLMLALVDESP
Download sequence
Identical sequences A0A045H7R5 A0A0H3M3D2 A0A0K2HTC7 A0A109SUS8 A0A120IVY0 A0A197IZD3 A0A1A9E4E4 A0A1S1BDA3 F8M4C6 G0TFM7 I6Y901 M8CQL5 P67746 P9WMF0 P9WMF1 R4M3Z9
gi|121636803|ref|YP_977026.1| gi|479054831|ref|YP_007350637.1| gi|392433537|ref|YP_006474581.1| gi|392385590|ref|YP_005307219.1| gi|197739628|ref|YP_002160942.1| gi|253800098|ref|YP_003033099.1| gi|339630945|ref|YP_004722587.1| gi|506925309|ref|YP_008005759.1| gi|340625892|ref|YP_004744344.1| gi|383306776|ref|YP_005359587.1| gi|224989274|ref|YP_002643961.1| gi|385997661|ref|YP_005915959.1| gi|15608020|ref|NP_215395.1| gi|15608020|ref|NP_215395.1| gi|148822088|ref|YP_001286842.1| gi|449062914|ref|YP_007429997.1| gi|494695282|ref|YP_007960785.1| gi|386003894|ref|YP_005922173.1| 233413.Mb0904 336982.TBFG_10897 410289.BCG_0932 478434.TBMG_03110 561275.JTY_0902 83332.Rv0880 gi|378770637|ref|YP_005170370.1| NP_215395.1.84033 WP_003404606.1.100000 WP_003404606.1.100021 WP_003404606.1.100069 WP_003404606.1.100087 WP_003404606.1.10015 WP_003404606.1.100208 WP_003404606.1.100216 WP_003404606.1.10022 WP_003404606.1.100255 WP_003404606.1.100260 WP_003404606.1.100270 WP_003404606.1.100279 WP_003404606.1.100286 WP_003404606.1.100308 WP_003404606.1.100309 WP_003404606.1.100318 WP_003404606.1.100337 WP_003404606.1.100338 WP_003404606.1.10037 WP_003404606.1.100383 WP_003404606.1.100395 WP_003404606.1.100396 WP_003404606.1.1004 WP_003404606.1.100401 WP_003404606.1.100459 WP_003404606.1.100460 WP_003404606.1.100552 WP_003404606.1.100581 WP_003404606.1.100600 WP_003404606.1.100625 WP_003404606.1.10064 WP_003404606.1.100666 WP_003404606.1.100671 WP_003404606.1.100677 WP_003404606.1.100682 WP_003404606.1.100697 WP_003404606.1.100703 WP_003404606.1.100716 WP_003404606.1.100722 WP_003404606.1.100754 WP_003404606.1.100757 WP_003404606.1.100772 WP_003404606.1.1008 WP_003404606.1.100812 WP_003404606.1.100845 WP_003404606.1.100866 WP_003404606.1.10088 WP_003404606.1.100889 WP_003404606.1.10090 WP_003404606.1.100910 WP_003404606.1.100915 WP_003404606.1.100918 WP_003404606.1.100935 WP_003404606.1.100984 WP_003404606.1.100992 WP_003404606.1.100998 WP_003404606.1.101 WP_003404606.1.101025 WP_003404606.1.101028 WP_003404606.1.10104 WP_003404606.1.101048 WP_003404606.1.101054 WP_003404606.1.101075 WP_003404606.1.101143 WP_003404606.1.101146 WP_003404606.1.10116 WP_003404606.1.10117 WP_003404606.1.101209 WP_003404606.1.10125 WP_003404606.1.101290 WP_003404606.1.101323 WP_003404606.1.101324 WP_003404606.1.101350 WP_003404606.1.101367 WP_003404606.1.101398 WP_003404606.1.101403 WP_003404606.1.101421 WP_003404606.1.10144 WP_003404606.1.101442 WP_003404606.1.10145 WP_003404606.1.101452 WP_003404606.1.101456 WP_003404606.1.101481 WP_003404606.1.101493 WP_003404606.1.101496 WP_003404606.1.101525 WP_003404606.1.101533 WP_003404606.1.101535 WP_003404606.1.101553 WP_003404606.1.101558 WP_003404606.1.10156 WP_003404606.1.101573 WP_003404606.1.101576 WP_003404606.1.10159 WP_003404606.1.101592 WP_003404606.1.101604 WP_003404606.1.101607 WP_003404606.1.101622 WP_003404606.1.101644 WP_003404606.1.101659 WP_003404606.1.101671 WP_003404606.1.101687 WP_003404606.1.101698 WP_003404606.1.10170 WP_003404606.1.101713 WP_003404606.1.101722 WP_003404606.1.101733 WP_003404606.1.101743 WP_003404606.1.101753 WP_003404606.1.101754 WP_003404606.1.101764 WP_003404606.1.101773 WP_003404606.1.101795 WP_003404606.1.101797 WP_003404606.1.101798 WP_003404606.1.101802 WP_003404606.1.101826 WP_003404606.1.101836 WP_003404606.1.101858 WP_003404606.1.101859 WP_003404606.1.101862 WP_003404606.1.101888 WP_003404606.1.101894 WP_003404606.1.101899 WP_003404606.1.1019 WP_003404606.1.101923 WP_003404606.1.101925 WP_003404606.1.10193 WP_003404606.1.101996 WP_003404606.1.102 WP_003404606.1.102008 WP_003404606.1.102017 WP_003404606.1.102053 WP_003404606.1.102055 WP_003404606.1.102063 WP_003404606.1.102099 WP_003404606.1.1021 WP_003404606.1.10211 WP_003404606.1.102119 WP_003404606.1.102121 WP_003404606.1.102143 WP_003404606.1.10216 WP_003404606.1.10224 WP_003404606.1.10253 WP_003404606.1.10262 WP_003404606.1.10272 WP_003404606.1.10277 WP_003404606.1.1033 WP_003404606.1.10350 WP_003404606.1.10362 WP_003404606.1.10366 WP_003404606.1.10376 WP_003404606.1.10396 WP_003404606.1.10410 WP_003404606.1.10414 WP_003404606.1.10421 WP_003404606.1.10430 WP_003404606.1.1044 WP_003404606.1.10440 WP_003404606.1.10445 WP_003404606.1.10471 WP_003404606.1.10472 WP_003404606.1.10489 WP_003404606.1.105 WP_003404606.1.10518 WP_003404606.1.10523 WP_003404606.1.10545 WP_003404606.1.1057 WP_003404606.1.10594 WP_003404606.1.10603 WP_003404606.1.10606 WP_003404606.1.10615 WP_003404606.1.10623 WP_003404606.1.10635 WP_003404606.1.10643 WP_003404606.1.10648 WP_003404606.1.10662 WP_003404606.1.10709 WP_003404606.1.10735 WP_003404606.1.10740 WP_003404606.1.10756 WP_003404606.1.1078 WP_003404606.1.10791 WP_003404606.1.10799 WP_003404606.1.10825 WP_003404606.1.10848 WP_003404606.1.10863 WP_003404606.1.10879 WP_003404606.1.10912 WP_003404606.1.10916 WP_003404606.1.10923 WP_003404606.1.10927 WP_003404606.1.1095 WP_003404606.1.10956 WP_003404606.1.10958 WP_003404606.1.10962 WP_003404606.1.10980 WP_003404606.1.10981 WP_003404606.1.10993 WP_003404606.1.1100 WP_003404606.1.11040 WP_003404606.1.11061 WP_003404606.1.11070 WP_003404606.1.11141 WP_003404606.1.11171 WP_003404606.1.11175 WP_003404606.1.11176 WP_003404606.1.11222 WP_003404606.1.11236 WP_003404606.1.11329 WP_003404606.1.1133 WP_003404606.1.11342 WP_003404606.1.11373 WP_003404606.1.11376 WP_003404606.1.11390 WP_003404606.1.11402 WP_003404606.1.11481 WP_003404606.1.11487 WP_003404606.1.11489 WP_003404606.1.11491 WP_003404606.1.11514 WP_003404606.1.11587 WP_003404606.1.11589 WP_003404606.1.11596 WP_003404606.1.11604 WP_003404606.1.11610 WP_003404606.1.11697 WP_003404606.1.11707 WP_003404606.1.11752 WP_003404606.1.11758 WP_003404606.1.11761 WP_003404606.1.11775 WP_003404606.1.11822 WP_003404606.1.11826 WP_003404606.1.11856 WP_003404606.1.11898 WP_003404606.1.11906 WP_003404606.1.11939 WP_003404606.1.11960 WP_003404606.1.11961 WP_003404606.1.11972 WP_003404606.1.11984 WP_003404606.1.120 WP_003404606.1.12001 WP_003404606.1.12049 WP_003404606.1.12052 WP_003404606.1.12100 WP_003404606.1.12116 WP_003404606.1.12130 WP_003404606.1.12133 WP_003404606.1.12161 WP_003404606.1.12165 WP_003404606.1.12184 WP_003404606.1.12187 WP_003404606.1.12190 WP_003404606.1.12216 WP_003404606.1.12265 WP_003404606.1.12275 WP_003404606.1.12293 WP_003404606.1.12294 WP_003404606.1.1231 WP_003404606.1.12314 WP_003404606.1.12327 WP_003404606.1.12338 WP_003404606.1.1236 WP_003404606.1.12371 WP_003404606.1.12372 WP_003404606.1.12389 WP_003404606.1.12406 WP_003404606.1.1241 WP_003404606.1.12421 WP_003404606.1.12424 WP_003404606.1.12446 WP_003404606.1.12464 WP_003404606.1.12479 WP_003404606.1.12519 WP_003404606.1.12523 WP_003404606.1.12526 WP_003404606.1.1255 WP_003404606.1.12550 WP_003404606.1.12551 WP_003404606.1.12563 WP_003404606.1.12611 WP_003404606.1.12669 WP_003404606.1.1267 WP_003404606.1.12672 WP_003404606.1.12692 WP_003404606.1.1271 WP_003404606.1.12710 WP_003404606.1.12768 WP_003404606.1.1279 WP_003404606.1.12794 WP_003404606.1.12801 WP_003404606.1.12804 WP_003404606.1.12821 WP_003404606.1.12841 WP_003404606.1.12854 WP_003404606.1.12871 WP_003404606.1.12901 WP_003404606.1.12941 WP_003404606.1.12947 WP_003404606.1.12957 WP_003404606.1.12972 WP_003404606.1.13028 WP_003404606.1.13043 WP_003404606.1.13086 WP_003404606.1.13087 WP_003404606.1.13090 WP_003404606.1.13096 WP_003404606.1.13163 WP_003404606.1.13175 WP_003404606.1.13183 WP_003404606.1.132 WP_003404606.1.13249 WP_003404606.1.13282 WP_003404606.1.13284 WP_003404606.1.13296 WP_003404606.1.13298 WP_003404606.1.13302 WP_003404606.1.13306 WP_003404606.1.13312 WP_003404606.1.13313 WP_003404606.1.13321 WP_003404606.1.13345 WP_003404606.1.13358 WP_003404606.1.13370 WP_003404606.1.13375 WP_003404606.1.1338 WP_003404606.1.13420 WP_003404606.1.13433 WP_003404606.1.13435 WP_003404606.1.13438 WP_003404606.1.13461 WP_003404606.1.13466 WP_003404606.1.13489 WP_003404606.1.13526 WP_003404606.1.13551 WP_003404606.1.13561 WP_003404606.1.13564 WP_003404606.1.13579 WP_003404606.1.13647 WP_003404606.1.13697 WP_003404606.1.13719 WP_003404606.1.13763 WP_003404606.1.1377 WP_003404606.1.13774 WP_003404606.1.13786 WP_003404606.1.13793 WP_003404606.1.13794 WP_003404606.1.13817 WP_003404606.1.13834 WP_003404606.1.13866 WP_003404606.1.13880 WP_003404606.1.13899 WP_003404606.1.13909 WP_003404606.1.13910 WP_003404606.1.13919 WP_003404606.1.13920 WP_003404606.1.13952 WP_003404606.1.13953 WP_003404606.1.13962 WP_003404606.1.1398 WP_003404606.1.13988 WP_003404606.1.14027 WP_003404606.1.14046 WP_003404606.1.14115 WP_003404606.1.1415 WP_003404606.1.14152 WP_003404606.1.14158 WP_003404606.1.14162 WP_003404606.1.14175 WP_003404606.1.14178 WP_003404606.1.14194 WP_003404606.1.14195 WP_003404606.1.14208 WP_003404606.1.14238 WP_003404606.1.14266 WP_003404606.1.14273 WP_003404606.1.14303 WP_003404606.1.14306 WP_003404606.1.14307 WP_003404606.1.14310 WP_003404606.1.14341 WP_003404606.1.14382 WP_003404606.1.14416 WP_003404606.1.14428 WP_003404606.1.14441 WP_003404606.1.14469 WP_003404606.1.14477 WP_003404606.1.14504 WP_003404606.1.14514 WP_003404606.1.1452 WP_003404606.1.14527 WP_003404606.1.1454 WP_003404606.1.14544 WP_003404606.1.14548 WP_003404606.1.14551 WP_003404606.1.14561 WP_003404606.1.14573 WP_003404606.1.1462 WP_003404606.1.14658 WP_003404606.1.14667 WP_003404606.1.14668 WP_003404606.1.14675 WP_003404606.1.14694 WP_003404606.1.14709 WP_003404606.1.14766 WP_003404606.1.14783 WP_003404606.1.14865 WP_003404606.1.14872 WP_003404606.1.14905 WP_003404606.1.14926 WP_003404606.1.14951 WP_003404606.1.14955 WP_003404606.1.15003 WP_003404606.1.15009 WP_003404606.1.15028 WP_003404606.1.15040 WP_003404606.1.15052 WP_003404606.1.15065 WP_003404606.1.15072 WP_003404606.1.15089 WP_003404606.1.1509 WP_003404606.1.15126 WP_003404606.1.15131 WP_003404606.1.15168 WP_003404606.1.15172 WP_003404606.1.15174 WP_003404606.1.15187 WP_003404606.1.15196 WP_003404606.1.15210 WP_003404606.1.15216 WP_003404606.1.15217 WP_003404606.1.1523 WP_003404606.1.15232 WP_003404606.1.15238 WP_003404606.1.15240 WP_003404606.1.15253 WP_003404606.1.15267 WP_003404606.1.1527 WP_003404606.1.15292 WP_003404606.1.15302 WP_003404606.1.15322 WP_003404606.1.1534 WP_003404606.1.15345 WP_003404606.1.15365 WP_003404606.1.15372 WP_003404606.1.15386 WP_003404606.1.15387 WP_003404606.1.15447 WP_003404606.1.15449 WP_003404606.1.15477 WP_003404606.1.15481 WP_003404606.1.15492 WP_003404606.1.15511 WP_003404606.1.15512 WP_003404606.1.15558 WP_003404606.1.15559 WP_003404606.1.15566 WP_003404606.1.15599 WP_003404606.1.1560 WP_003404606.1.15611 WP_003404606.1.1563 WP_003404606.1.15633 WP_003404606.1.15643 WP_003404606.1.15688 WP_003404606.1.15755 WP_003404606.1.15763 WP_003404606.1.15774 WP_003404606.1.1578 WP_003404606.1.15780 WP_003404606.1.15827 WP_003404606.1.15834 WP_003404606.1.15842 WP_003404606.1.15848 WP_003404606.1.15853 WP_003404606.1.15870 WP_003404606.1.15877 WP_003404606.1.15893 WP_003404606.1.15896 WP_003404606.1.15926 WP_003404606.1.15933 WP_003404606.1.15946 WP_003404606.1.15958 WP_003404606.1.15973 WP_003404606.1.15987 WP_003404606.1.15993 WP_003404606.1.16009 WP_003404606.1.16025 WP_003404606.1.16043 WP_003404606.1.16055 WP_003404606.1.16066 WP_003404606.1.16069 WP_003404606.1.16077 WP_003404606.1.16106 WP_003404606.1.16108 WP_003404606.1.16110 WP_003404606.1.16130 WP_003404606.1.16136 WP_003404606.1.16139 WP_003404606.1.16141 WP_003404606.1.16143 WP_003404606.1.1630 WP_003404606.1.16318 WP_003404606.1.1632 WP_003404606.1.16327 WP_003404606.1.16334 WP_003404606.1.16341 WP_003404606.1.16345 WP_003404606.1.16374 WP_003404606.1.16384 WP_003404606.1.16386 WP_003404606.1.164 WP_003404606.1.1642 WP_003404606.1.16421 WP_003404606.1.16424 WP_003404606.1.16426 WP_003404606.1.16431 WP_003404606.1.16438 WP_003404606.1.1644 WP_003404606.1.16442 WP_003404606.1.16448 WP_003404606.1.16451 WP_003404606.1.16476 WP_003404606.1.16480 WP_003404606.1.16494 WP_003404606.1.1652 WP_003404606.1.16549 WP_003404606.1.16560 WP_003404606.1.16598 WP_003404606.1.16609 WP_003404606.1.16619 WP_003404606.1.16620 WP_003404606.1.16622 WP_003404606.1.16637 WP_003404606.1.1669 WP_003404606.1.16707 WP_003404606.1.16724 WP_003404606.1.16731 WP_003404606.1.16743 WP_003404606.1.1683 WP_003404606.1.16837 WP_003404606.1.16852 WP_003404606.1.16937 WP_003404606.1.16940 WP_003404606.1.16950 WP_003404606.1.16959 WP_003404606.1.16968 WP_003404606.1.1697 WP_003404606.1.16973 WP_003404606.1.16977 WP_003404606.1.16987 WP_003404606.1.17005 WP_003404606.1.17006 WP_003404606.1.17010 WP_003404606.1.17015 WP_003404606.1.17019 WP_003404606.1.17039 WP_003404606.1.17041 WP_003404606.1.17052 WP_003404606.1.17057 WP_003404606.1.17062 WP_003404606.1.1707 WP_003404606.1.17094 WP_003404606.1.17130 WP_003404606.1.17138 WP_003404606.1.17147 WP_003404606.1.17167 WP_003404606.1.17224 WP_003404606.1.17251 WP_003404606.1.17288 WP_003404606.1.17304 WP_003404606.1.17314 WP_003404606.1.17345 WP_003404606.1.17381 WP_003404606.1.17391 WP_003404606.1.17412 WP_003404606.1.1743 WP_003404606.1.17440 WP_003404606.1.17466 WP_003404606.1.17477 WP_003404606.1.17483 WP_003404606.1.17505 WP_003404606.1.17527 WP_003404606.1.17535 WP_003404606.1.17540 WP_003404606.1.17553 WP_003404606.1.17558 WP_003404606.1.17599 WP_003404606.1.17635 WP_003404606.1.17655 WP_003404606.1.17679 WP_003404606.1.1768 WP_003404606.1.17687 WP_003404606.1.17700 WP_003404606.1.17710 WP_003404606.1.17713 WP_003404606.1.17722 WP_003404606.1.17746 WP_003404606.1.17788 WP_003404606.1.17798 WP_003404606.1.17803 WP_003404606.1.17816 WP_003404606.1.17821 WP_003404606.1.17830 WP_003404606.1.17868 WP_003404606.1.17878 WP_003404606.1.1792 WP_003404606.1.17923 WP_003404606.1.1795 WP_003404606.1.17955 WP_003404606.1.17973 WP_003404606.1.18009 WP_003404606.1.18013 WP_003404606.1.18033 WP_003404606.1.18057 WP_003404606.1.18065 WP_003404606.1.18070 WP_003404606.1.18116 WP_003404606.1.18120 WP_003404606.1.18126 WP_003404606.1.1817 WP_003404606.1.18170 WP_003404606.1.18206 WP_003404606.1.18216 WP_003404606.1.18240 WP_003404606.1.18297 WP_003404606.1.18306 WP_003404606.1.18364 WP_003404606.1.18399 WP_003404606.1.18411 WP_003404606.1.18444 WP_003404606.1.18448 WP_003404606.1.18467 WP_003404606.1.18476 WP_003404606.1.18522 WP_003404606.1.18580 WP_003404606.1.18582 WP_003404606.1.18587 WP_003404606.1.186 WP_003404606.1.18601 WP_003404606.1.18639 WP_003404606.1.18646 WP_003404606.1.18647 WP_003404606.1.1868 WP_003404606.1.18694 WP_003404606.1.18710 WP_003404606.1.18751 WP_003404606.1.18781 WP_003404606.1.18793 WP_003404606.1.18804 WP_003404606.1.18816 WP_003404606.1.18823 WP_003404606.1.18827 WP_003404606.1.18838 WP_003404606.1.18849 WP_003404606.1.18856 WP_003404606.1.18945 WP_003404606.1.1898 WP_003404606.1.19005 WP_003404606.1.19056 WP_003404606.1.19063 WP_003404606.1.19066 WP_003404606.1.19071 WP_003404606.1.19085 WP_003404606.1.19094 WP_003404606.1.19144 WP_003404606.1.19159 WP_003404606.1.19193 WP_003404606.1.19231 WP_003404606.1.19243 WP_003404606.1.19264 WP_003404606.1.19295 WP_003404606.1.19307 WP_003404606.1.19326 WP_003404606.1.1933 WP_003404606.1.19364 WP_003404606.1.19382 WP_003404606.1.19400 WP_003404606.1.19426 WP_003404606.1.19429 WP_003404606.1.19464 WP_003404606.1.19480 WP_003404606.1.19512 WP_003404606.1.19553 WP_003404606.1.19562 WP_003404606.1.19564 WP_003404606.1.19568 WP_003404606.1.19572 WP_003404606.1.19595 WP_003404606.1.19596 WP_003404606.1.19600 WP_003404606.1.19630 WP_003404606.1.1967 WP_003404606.1.19694 WP_003404606.1.1970 WP_003404606.1.19707 WP_003404606.1.19742 WP_003404606.1.19785 WP_003404606.1.19820 WP_003404606.1.19868 WP_003404606.1.19874 WP_003404606.1.19890 WP_003404606.1.19900 WP_003404606.1.19922 WP_003404606.1.19936 WP_003404606.1.19946 WP_003404606.1.19949 WP_003404606.1.19960 WP_003404606.1.19964 WP_003404606.1.20007 WP_003404606.1.20016 WP_003404606.1.20028 WP_003404606.1.2003 WP_003404606.1.20037 WP_003404606.1.20039 WP_003404606.1.20082 WP_003404606.1.20085 WP_003404606.1.20097 WP_003404606.1.20116 WP_003404606.1.20130 WP_003404606.1.20140 WP_003404606.1.20141 WP_003404606.1.20142 WP_003404606.1.20158 WP_003404606.1.20239 WP_003404606.1.20243 WP_003404606.1.20259 WP_003404606.1.20262 WP_003404606.1.20268 WP_003404606.1.20272 WP_003404606.1.20273 WP_003404606.1.20280 WP_003404606.1.20294 WP_003404606.1.20300 WP_003404606.1.20309 WP_003404606.1.20322 WP_003404606.1.2037 WP_003404606.1.20372 WP_003404606.1.20381 WP_003404606.1.204 WP_003404606.1.20427 WP_003404606.1.20432 WP_003404606.1.20457 WP_003404606.1.20459 WP_003404606.1.20460 WP_003404606.1.20542 WP_003404606.1.20578 WP_003404606.1.20608 WP_003404606.1.20624 WP_003404606.1.20628 WP_003404606.1.2066 WP_003404606.1.20707 WP_003404606.1.20722 WP_003404606.1.20729 WP_003404606.1.20742 WP_003404606.1.20751 WP_003404606.1.20776 WP_003404606.1.20843 WP_003404606.1.20850 WP_003404606.1.2086 WP_003404606.1.20868 WP_003404606.1.20876 WP_003404606.1.20897 WP_003404606.1.20898 WP_003404606.1.2090 WP_003404606.1.20911 WP_003404606.1.20916 WP_003404606.1.20921 WP_003404606.1.20926 WP_003404606.1.20927 WP_003404606.1.20951 WP_003404606.1.20970 WP_003404606.1.2104 WP_003404606.1.21070 WP_003404606.1.21127 WP_003404606.1.21135 WP_003404606.1.21173 WP_003404606.1.21187 WP_003404606.1.212 WP_003404606.1.2120 WP_003404606.1.21218 WP_003404606.1.21219 WP_003404606.1.2123 WP_003404606.1.21231 WP_003404606.1.21234 WP_003404606.1.2126 WP_003404606.1.21292 WP_003404606.1.21307 WP_003404606.1.2131 WP_003404606.1.21311 WP_003404606.1.21321 WP_003404606.1.21365 WP_003404606.1.2137 WP_003404606.1.21392 WP_003404606.1.21397 WP_003404606.1.21403 WP_003404606.1.21415 WP_003404606.1.21418 WP_003404606.1.21430 WP_003404606.1.21434 WP_003404606.1.21444 WP_003404606.1.21468 WP_003404606.1.21498 WP_003404606.1.21509 WP_003404606.1.21513 WP_003404606.1.21560 WP_003404606.1.21565 WP_003404606.1.21586 WP_003404606.1.21591 WP_003404606.1.21594 WP_003404606.1.21602 WP_003404606.1.21615 WP_003404606.1.21638 WP_003404606.1.21639 WP_003404606.1.21655 WP_003404606.1.21658 WP_003404606.1.2168 WP_003404606.1.2174 WP_003404606.1.21741 WP_003404606.1.21742 WP_003404606.1.21777 WP_003404606.1.21786 WP_003404606.1.21795 WP_003404606.1.218 WP_003404606.1.21826 WP_003404606.1.21829 WP_003404606.1.21840 WP_003404606.1.21843 WP_003404606.1.21872 WP_003404606.1.21873 WP_003404606.1.2188 WP_003404606.1.21882 WP_003404606.1.21906 WP_003404606.1.21912 WP_003404606.1.2194 WP_003404606.1.21941 WP_003404606.1.21956 WP_003404606.1.21958 WP_003404606.1.21960 WP_003404606.1.21971 WP_003404606.1.21973 WP_003404606.1.21983 WP_003404606.1.22003 WP_003404606.1.22013 WP_003404606.1.22025 WP_003404606.1.22036 WP_003404606.1.22075 WP_003404606.1.22092 WP_003404606.1.2212 WP_003404606.1.22127 WP_003404606.1.22140 WP_003404606.1.22233 WP_003404606.1.22255 WP_003404606.1.22277 WP_003404606.1.22305 WP_003404606.1.22348 WP_003404606.1.22356 WP_003404606.1.22366 WP_003404606.1.2238 WP_003404606.1.22380 WP_003404606.1.22437 WP_003404606.1.22438 WP_003404606.1.22445 WP_003404606.1.22490 WP_003404606.1.22511 WP_003404606.1.22524 WP_003404606.1.2253 WP_003404606.1.22585 WP_003404606.1.22589 WP_003404606.1.22606 WP_003404606.1.22608 WP_003404606.1.22609 WP_003404606.1.22618 WP_003404606.1.2262 WP_003404606.1.22624 WP_003404606.1.22629 WP_003404606.1.22647 WP_003404606.1.22664 WP_003404606.1.22665 WP_003404606.1.22670 WP_003404606.1.22674 WP_003404606.1.22680 WP_003404606.1.22725 WP_003404606.1.22728 WP_003404606.1.22733 WP_003404606.1.22737 WP_003404606.1.2275 WP_003404606.1.22754 WP_003404606.1.22797 WP_003404606.1.22800 WP_003404606.1.22804 WP_003404606.1.22829 WP_003404606.1.22840 WP_003404606.1.22844 WP_003404606.1.22963 WP_003404606.1.22970 WP_003404606.1.22996 WP_003404606.1.22997 WP_003404606.1.22999 WP_003404606.1.23015 WP_003404606.1.23032 WP_003404606.1.231 WP_003404606.1.23101 WP_003404606.1.2312 WP_003404606.1.23140 WP_003404606.1.23153 WP_003404606.1.23171 WP_003404606.1.23199 WP_003404606.1.2320 WP_003404606.1.23204 WP_003404606.1.23216 WP_003404606.1.23229 WP_003404606.1.23233 WP_003404606.1.2326 WP_003404606.1.23261 WP_003404606.1.23272 WP_003404606.1.23289 WP_003404606.1.2329 WP_003404606.1.23308 WP_003404606.1.23316 WP_003404606.1.23321 WP_003404606.1.23325 WP_003404606.1.2339 WP_003404606.1.23406 WP_003404606.1.23438 WP_003404606.1.23445 WP_003404606.1.23447 WP_003404606.1.23452 WP_003404606.1.23461 WP_003404606.1.2349 WP_003404606.1.23496 WP_003404606.1.23497 WP_003404606.1.23506 WP_003404606.1.23530 WP_003404606.1.23539 WP_003404606.1.23546 WP_003404606.1.23551 WP_003404606.1.23573 WP_003404606.1.23583 WP_003404606.1.23588 WP_003404606.1.23628 WP_003404606.1.23677 WP_003404606.1.23683 WP_003404606.1.23692 WP_003404606.1.23694 WP_003404606.1.23699 WP_003404606.1.2371 WP_003404606.1.23803 WP_003404606.1.23807 WP_003404606.1.23825 WP_003404606.1.23832 WP_003404606.1.2384 WP_003404606.1.23843 WP_003404606.1.2387 WP_003404606.1.23894 WP_003404606.1.23993 WP_003404606.1.2400 WP_003404606.1.24007 WP_003404606.1.24008 WP_003404606.1.24046 WP_003404606.1.24057 WP_003404606.1.24062 WP_003404606.1.24113 WP_003404606.1.24119 WP_003404606.1.24128 WP_003404606.1.24140 WP_003404606.1.24176 WP_003404606.1.24190 WP_003404606.1.24202 WP_003404606.1.24244 WP_003404606.1.24261 WP_003404606.1.24284 WP_003404606.1.24294 WP_003404606.1.24357 WP_003404606.1.24396 WP_003404606.1.24414 WP_003404606.1.24423 WP_003404606.1.2443 WP_003404606.1.24446 WP_003404606.1.24461 WP_003404606.1.24500 WP_003404606.1.24507 WP_003404606.1.24509 WP_003404606.1.24529 WP_003404606.1.24553 WP_003404606.1.24599 WP_003404606.1.24629 WP_003404606.1.24638 WP_003404606.1.24648 WP_003404606.1.2466 WP_003404606.1.24767 WP_003404606.1.24824 WP_003404606.1.24831 WP_003404606.1.24840 WP_003404606.1.24848 WP_003404606.1.24857 WP_003404606.1.2487 WP_003404606.1.24893 WP_003404606.1.24907 WP_003404606.1.24933 WP_003404606.1.24956 WP_003404606.1.24958 WP_003404606.1.24985 WP_003404606.1.2499 WP_003404606.1.25004 WP_003404606.1.2505 WP_003404606.1.25051 WP_003404606.1.2507 WP_003404606.1.25096 WP_003404606.1.25103 WP_003404606.1.25129 WP_003404606.1.25171 WP_003404606.1.25184 WP_003404606.1.25247 WP_003404606.1.25252 WP_003404606.1.25278 WP_003404606.1.25283 WP_003404606.1.25309 WP_003404606.1.25313 WP_003404606.1.25338 WP_003404606.1.25342 WP_003404606.1.25343 WP_003404606.1.25367 WP_003404606.1.25393 WP_003404606.1.25406 WP_003404606.1.25435 WP_003404606.1.25437 WP_003404606.1.25445 WP_003404606.1.25455 WP_003404606.1.25473 WP_003404606.1.25504 WP_003404606.1.25513 WP_003404606.1.25542 WP_003404606.1.25579 WP_003404606.1.25594 WP_003404606.1.25606 WP_003404606.1.25645 WP_003404606.1.2566 WP_003404606.1.25673 WP_003404606.1.25674 WP_003404606.1.25693 WP_003404606.1.25699 WP_003404606.1.25727 WP_003404606.1.25736 WP_003404606.1.25738 WP_003404606.1.25756 WP_003404606.1.25759 WP_003404606.1.2580 WP_003404606.1.25813 WP_003404606.1.25853 WP_003404606.1.25854 WP_003404606.1.25874 WP_003404606.1.25885 WP_003404606.1.25892 WP_003404606.1.25906 WP_003404606.1.25914 WP_003404606.1.2594 WP_003404606.1.25954 WP_003404606.1.25965 WP_003404606.1.25972 WP_003404606.1.26017 WP_003404606.1.26032 WP_003404606.1.26038 WP_003404606.1.26072 WP_003404606.1.26089 WP_003404606.1.26097 WP_003404606.1.26098 WP_003404606.1.26108 WP_003404606.1.26109 WP_003404606.1.26118 WP_003404606.1.26126 WP_003404606.1.2614 WP_003404606.1.26168 WP_003404606.1.26182 WP_003404606.1.26190 WP_003404606.1.2620 WP_003404606.1.26234 WP_003404606.1.26243 WP_003404606.1.26265 WP_003404606.1.26267 WP_003404606.1.26292 WP_003404606.1.26310 WP_003404606.1.26328 WP_003404606.1.26349 WP_003404606.1.26366 WP_003404606.1.26374 WP_003404606.1.26407 WP_003404606.1.26412 WP_003404606.1.26454 WP_003404606.1.26464 WP_003404606.1.2653 WP_003404606.1.26560 WP_003404606.1.26571 WP_003404606.1.2659 WP_003404606.1.26597 WP_003404606.1.26603 WP_003404606.1.26629 WP_003404606.1.26651 WP_003404606.1.26702 WP_003404606.1.26707 WP_003404606.1.26710 WP_003404606.1.26719 WP_003404606.1.26737 WP_003404606.1.26738 WP_003404606.1.26745 WP_003404606.1.26756 WP_003404606.1.2676 WP_003404606.1.2677 WP_003404606.1.26779 WP_003404606.1.26780 WP_003404606.1.26798 WP_003404606.1.26854 WP_003404606.1.26868 WP_003404606.1.26876 WP_003404606.1.26888 WP_003404606.1.26914 WP_003404606.1.26945 WP_003404606.1.26959 WP_003404606.1.26969 WP_003404606.1.26984 WP_003404606.1.26992 WP_003404606.1.27004 WP_003404606.1.27017 WP_003404606.1.27045 WP_003404606.1.27074 WP_003404606.1.27075 WP_003404606.1.27128 WP_003404606.1.27130 WP_003404606.1.27139 WP_003404606.1.27152 WP_003404606.1.27162 WP_003404606.1.27164 WP_003404606.1.27193 WP_003404606.1.27235 WP_003404606.1.27254 WP_003404606.1.27278 WP_003404606.1.27343 WP_003404606.1.27352 WP_003404606.1.27369 WP_003404606.1.27391 WP_003404606.1.27398 WP_003404606.1.27402 WP_003404606.1.27410 WP_003404606.1.27411 WP_003404606.1.27449 WP_003404606.1.27460 WP_003404606.1.27463 WP_003404606.1.2749 WP_003404606.1.27492 WP_003404606.1.27528 WP_003404606.1.27541 WP_003404606.1.27576 WP_003404606.1.27582 WP_003404606.1.27596 WP_003404606.1.27607 WP_003404606.1.2766 WP_003404606.1.277 WP_003404606.1.27724 WP_003404606.1.27730 WP_003404606.1.27736 WP_003404606.1.27743 WP_003404606.1.27750 WP_003404606.1.27771 WP_003404606.1.27779 WP_003404606.1.27795 WP_003404606.1.27803 WP_003404606.1.27819 WP_003404606.1.27835 WP_003404606.1.27915 WP_003404606.1.27935 WP_003404606.1.27962 WP_003404606.1.28053 WP_003404606.1.28092 WP_003404606.1.28106 WP_003404606.1.28131 WP_003404606.1.28142 WP_003404606.1.28159 WP_003404606.1.2816 WP_003404606.1.28161 WP_003404606.1.28192 WP_003404606.1.28202 WP_003404606.1.28241 WP_003404606.1.28242 WP_003404606.1.28251 WP_003404606.1.28255 WP_003404606.1.28269 WP_003404606.1.28276 WP_003404606.1.28293 WP_003404606.1.28331 WP_003404606.1.28367 WP_003404606.1.28378 WP_003404606.1.28391 WP_003404606.1.2842 WP_003404606.1.28448 WP_003404606.1.2847 WP_003404606.1.28471 WP_003404606.1.28473 WP_003404606.1.28493 WP_003404606.1.28497 WP_003404606.1.28530 WP_003404606.1.28545 WP_003404606.1.28561 WP_003404606.1.28567 WP_003404606.1.28585 WP_003404606.1.286 WP_003404606.1.28610 WP_003404606.1.28617 WP_003404606.1.28634 WP_003404606.1.28642 WP_003404606.1.28671 WP_003404606.1.28682 WP_003404606.1.28698 WP_003404606.1.28703 WP_003404606.1.28739 WP_003404606.1.28758 WP_003404606.1.28781 WP_003404606.1.28787 WP_003404606.1.28827 WP_003404606.1.28839 WP_003404606.1.28847 WP_003404606.1.28850 WP_003404606.1.28851 WP_003404606.1.28865 WP_003404606.1.28897 WP_003404606.1.28914 WP_003404606.1.28935 WP_003404606.1.28936 WP_003404606.1.28939 WP_003404606.1.28943 WP_003404606.1.28952 WP_003404606.1.28975 WP_003404606.1.2899 WP_003404606.1.28993 WP_003404606.1.29000 WP_003404606.1.2901 WP_003404606.1.29028 WP_003404606.1.29033 WP_003404606.1.29058 WP_003404606.1.29078 WP_003404606.1.29102 WP_003404606.1.29115 WP_003404606.1.2916 WP_003404606.1.29217 WP_003404606.1.29223 WP_003404606.1.29234 WP_003404606.1.29264 WP_003404606.1.29275 WP_003404606.1.29306 WP_003404606.1.29339 WP_003404606.1.29364 WP_003404606.1.29367 WP_003404606.1.2938 WP_003404606.1.29399 WP_003404606.1.29426 WP_003404606.1.2944 WP_003404606.1.29449 WP_003404606.1.29450 WP_003404606.1.29452 WP_003404606.1.2949 WP_003404606.1.29510 WP_003404606.1.29515 WP_003404606.1.29525 WP_003404606.1.2953 WP_003404606.1.29559 WP_003404606.1.29587 WP_003404606.1.2959 WP_003404606.1.29592 WP_003404606.1.29599 WP_003404606.1.29611 WP_003404606.1.29632 WP_003404606.1.29649 WP_003404606.1.2965 WP_003404606.1.29659 WP_003404606.1.2969 WP_003404606.1.29696 WP_003404606.1.29698 WP_003404606.1.29718 WP_003404606.1.29742 WP_003404606.1.29745 WP_003404606.1.29747 WP_003404606.1.29769 WP_003404606.1.29825 WP_003404606.1.29830 WP_003404606.1.29847 WP_003404606.1.29861 WP_003404606.1.29869 WP_003404606.1.29883 WP_003404606.1.29890 WP_003404606.1.299 WP_003404606.1.29931 WP_003404606.1.30014 WP_003404606.1.3004 WP_003404606.1.30040 WP_003404606.1.30043 WP_003404606.1.30074 WP_003404606.1.30097 WP_003404606.1.30101 WP_003404606.1.30106 WP_003404606.1.30114 WP_003404606.1.30126 WP_003404606.1.30131 WP_003404606.1.30138 WP_003404606.1.30139 WP_003404606.1.30145 WP_003404606.1.30211 WP_003404606.1.30224 WP_003404606.1.30235 WP_003404606.1.30237 WP_003404606.1.3027 WP_003404606.1.30279 WP_003404606.1.30282 WP_003404606.1.30283 WP_003404606.1.30288 WP_003404606.1.30291 WP_003404606.1.30363 WP_003404606.1.30374 WP_003404606.1.30404 WP_003404606.1.3043 WP_003404606.1.30433 WP_003404606.1.30438 WP_003404606.1.30462 WP_003404606.1.30464 WP_003404606.1.30468 WP_003404606.1.30500 WP_003404606.1.3057 WP_003404606.1.30574 WP_003404606.1.30628 WP_003404606.1.30641 WP_003404606.1.30642 WP_003404606.1.30661 WP_003404606.1.30669 WP_003404606.1.30683 WP_003404606.1.30699 WP_003404606.1.30709 WP_003404606.1.30713 WP_003404606.1.30716 WP_003404606.1.30719 WP_003404606.1.30730 WP_003404606.1.30732 WP_003404606.1.30736 WP_003404606.1.30745 WP_003404606.1.30760 WP_003404606.1.30791 WP_003404606.1.308 WP_003404606.1.30807 WP_003404606.1.30818 WP_003404606.1.30824 WP_003404606.1.30848 WP_003404606.1.30877 WP_003404606.1.30888 WP_003404606.1.30901 WP_003404606.1.30903 WP_003404606.1.30912 WP_003404606.1.30913 WP_003404606.1.30914 WP_003404606.1.30919 WP_003404606.1.30977 WP_003404606.1.3100 WP_003404606.1.31002 WP_003404606.1.3101 WP_003404606.1.31034 WP_003404606.1.31047 WP_003404606.1.31070 WP_003404606.1.31074 WP_003404606.1.31102 WP_003404606.1.31127 WP_003404606.1.31184 WP_003404606.1.31199 WP_003404606.1.31226 WP_003404606.1.31230 WP_003404606.1.31233 WP_003404606.1.31263 WP_003404606.1.31264 WP_003404606.1.31270 WP_003404606.1.31287 WP_003404606.1.31290 WP_003404606.1.31304 WP_003404606.1.31346 WP_003404606.1.31348 WP_003404606.1.31354 WP_003404606.1.31390 WP_003404606.1.31414 WP_003404606.1.31417 WP_003404606.1.31428 WP_003404606.1.3143 WP_003404606.1.31458 WP_003404606.1.31483 WP_003404606.1.3149 WP_003404606.1.31498 WP_003404606.1.31507 WP_003404606.1.31537 WP_003404606.1.31548 WP_003404606.1.31569 WP_003404606.1.31573 WP_003404606.1.316 WP_003404606.1.31629 WP_003404606.1.31666 WP_003404606.1.31693 WP_003404606.1.31703 WP_003404606.1.31744 WP_003404606.1.31745 WP_003404606.1.31770 WP_003404606.1.31776 WP_003404606.1.31783 WP_003404606.1.318 WP_003404606.1.3184 WP_003404606.1.31840 WP_003404606.1.31880 WP_003404606.1.31911 WP_003404606.1.31930 WP_003404606.1.31932 WP_003404606.1.31955 WP_003404606.1.31985 WP_003404606.1.31991 WP_003404606.1.31995 WP_003404606.1.32004 WP_003404606.1.32039 WP_003404606.1.3204 WP_003404606.1.32045 WP_003404606.1.32071 WP_003404606.1.32098 WP_003404606.1.32132 WP_003404606.1.32157 WP_003404606.1.32164 WP_003404606.1.32179 WP_003404606.1.32198 WP_003404606.1.32297 WP_003404606.1.32317 WP_003404606.1.32383 WP_003404606.1.32400 WP_003404606.1.32403 WP_003404606.1.32416 WP_003404606.1.32421 WP_003404606.1.32433 WP_003404606.1.32461 WP_003404606.1.32482 WP_003404606.1.32503 WP_003404606.1.32556 WP_003404606.1.32562 WP_003404606.1.32569 WP_003404606.1.32592 WP_003404606.1.32620 WP_003404606.1.32647 WP_003404606.1.32653 WP_003404606.1.32654 WP_003404606.1.3268 WP_003404606.1.32695 WP_003404606.1.32706 WP_003404606.1.32716 WP_003404606.1.32738 WP_003404606.1.32752 WP_003404606.1.32780 WP_003404606.1.32781 WP_003404606.1.32793 WP_003404606.1.32799 WP_003404606.1.32822 WP_003404606.1.32833 WP_003404606.1.32862 WP_003404606.1.32880 WP_003404606.1.32897 WP_003404606.1.32909 WP_003404606.1.32935 WP_003404606.1.32974 WP_003404606.1.33007 WP_003404606.1.3302 WP_003404606.1.33028 WP_003404606.1.33035 WP_003404606.1.33044 WP_003404606.1.33054 WP_003404606.1.33082 WP_003404606.1.33141 WP_003404606.1.33148 WP_003404606.1.33155 WP_003404606.1.33168 WP_003404606.1.3321 WP_003404606.1.33215 WP_003404606.1.3325 WP_003404606.1.3327 WP_003404606.1.33278 WP_003404606.1.33288 WP_003404606.1.33305 WP_003404606.1.3331 WP_003404606.1.33319 WP_003404606.1.3333 WP_003404606.1.33393 WP_003404606.1.33403 WP_003404606.1.33452 WP_003404606.1.33467 WP_003404606.1.33477 WP_003404606.1.3349 WP_003404606.1.33519 WP_003404606.1.33542 WP_003404606.1.33601 WP_003404606.1.33602 WP_003404606.1.33633 WP_003404606.1.33646 WP_003404606.1.33673 WP_003404606.1.3369 WP_003404606.1.33705 WP_003404606.1.33762 WP_003404606.1.33783 WP_003404606.1.33789 WP_003404606.1.3383 WP_003404606.1.33832 WP_003404606.1.33839 WP_003404606.1.33848 WP_003404606.1.3387 WP_003404606.1.33886 WP_003404606.1.33895 WP_003404606.1.33906 WP_003404606.1.33912 WP_003404606.1.33954 WP_003404606.1.3399 WP_003404606.1.34042 WP_003404606.1.3405 WP_003404606.1.34055 WP_003404606.1.34056 WP_003404606.1.34065 WP_003404606.1.3408 WP_003404606.1.34090 WP_003404606.1.34109 WP_003404606.1.34131 WP_003404606.1.34152 WP_003404606.1.34153 WP_003404606.1.34163 WP_003404606.1.34181 WP_003404606.1.34197 WP_003404606.1.34198 WP_003404606.1.34215 WP_003404606.1.34219 WP_003404606.1.34255 WP_003404606.1.34260 WP_003404606.1.34275 WP_003404606.1.343 WP_003404606.1.34347 WP_003404606.1.34358 WP_003404606.1.34392 WP_003404606.1.344 WP_003404606.1.34428 WP_003404606.1.3443 WP_003404606.1.34435 WP_003404606.1.34446 WP_003404606.1.34499 WP_003404606.1.34505 WP_003404606.1.34516 WP_003404606.1.34529 WP_003404606.1.34551 WP_003404606.1.34563 WP_003404606.1.34576 WP_003404606.1.34581 WP_003404606.1.34588 WP_003404606.1.34596 WP_003404606.1.34599 WP_003404606.1.34639 WP_003404606.1.34673 WP_003404606.1.34724 WP_003404606.1.34740 WP_003404606.1.34755 WP_003404606.1.34777 WP_003404606.1.34841 WP_003404606.1.34908 WP_003404606.1.34919 WP_003404606.1.3492 WP_003404606.1.34933 WP_003404606.1.34945 WP_003404606.1.34946 WP_003404606.1.34954 WP_003404606.1.34960 WP_003404606.1.34961 WP_003404606.1.34963 WP_003404606.1.34965 WP_003404606.1.34968 WP_003404606.1.35023 WP_003404606.1.35069 WP_003404606.1.35072 WP_003404606.1.35078 WP_003404606.1.35100 WP_003404606.1.35146 WP_003404606.1.35156 WP_003404606.1.35160 WP_003404606.1.35162 WP_003404606.1.35173 WP_003404606.1.35176 WP_003404606.1.3520 WP_003404606.1.35213 WP_003404606.1.35221 WP_003404606.1.35246 WP_003404606.1.35278 WP_003404606.1.35301 WP_003404606.1.35311 WP_003404606.1.35312 WP_003404606.1.35317 WP_003404606.1.35319 WP_003404606.1.35347 WP_003404606.1.35363 WP_003404606.1.35382 WP_003404606.1.35385 WP_003404606.1.35396 WP_003404606.1.35397 WP_003404606.1.35426 WP_003404606.1.35439 WP_003404606.1.35455 WP_003404606.1.3548 WP_003404606.1.35484 WP_003404606.1.35492 WP_003404606.1.3553 WP_003404606.1.35553 WP_003404606.1.35555 WP_003404606.1.35561 WP_003404606.1.35602 WP_003404606.1.35610 WP_003404606.1.35635 WP_003404606.1.35657 WP_003404606.1.35687 WP_003404606.1.35689 WP_003404606.1.35732 WP_003404606.1.35754 WP_003404606.1.35767 WP_003404606.1.35770 WP_003404606.1.35771 WP_003404606.1.35780 WP_003404606.1.35805 WP_003404606.1.35811 WP_003404606.1.35821 WP_003404606.1.3584 WP_003404606.1.35848 WP_003404606.1.35864 WP_003404606.1.35874 WP_003404606.1.35876 WP_003404606.1.35897 WP_003404606.1.35899 WP_003404606.1.35923 WP_003404606.1.3593 WP_003404606.1.35954 WP_003404606.1.36005 WP_003404606.1.36014 WP_003404606.1.36023 WP_003404606.1.36051 WP_003404606.1.36053 WP_003404606.1.36075 WP_003404606.1.36089 WP_003404606.1.36097 WP_003404606.1.36098 WP_003404606.1.36116 WP_003404606.1.36145 WP_003404606.1.36156 WP_003404606.1.36205 WP_003404606.1.36228 WP_003404606.1.36246 WP_003404606.1.36252 WP_003404606.1.36260 WP_003404606.1.36270 WP_003404606.1.36271 WP_003404606.1.36303 WP_003404606.1.36309 WP_003404606.1.36315 WP_003404606.1.36319 WP_003404606.1.36326 WP_003404606.1.3634 WP_003404606.1.36356 WP_003404606.1.36357 WP_003404606.1.3636 WP_003404606.1.36385 WP_003404606.1.36399 WP_003404606.1.36436 WP_003404606.1.36465 WP_003404606.1.36469 WP_003404606.1.36473 WP_003404606.1.36485 WP_003404606.1.36508 WP_003404606.1.36540 WP_003404606.1.36561 WP_003404606.1.36571 WP_003404606.1.36573 WP_003404606.1.36578 WP_003404606.1.36585 WP_003404606.1.36597 WP_003404606.1.36614 WP_003404606.1.36657 WP_003404606.1.36674 WP_003404606.1.36720 WP_003404606.1.36727 WP_003404606.1.36733 WP_003404606.1.36785 WP_003404606.1.36810 WP_003404606.1.36844 WP_003404606.1.36851 WP_003404606.1.36862 WP_003404606.1.36893 WP_003404606.1.36901 WP_003404606.1.36921 WP_003404606.1.36935 WP_003404606.1.36941 WP_003404606.1.3695 WP_003404606.1.36951 WP_003404606.1.36968 WP_003404606.1.3700 WP_003404606.1.37004 WP_003404606.1.37012 WP_003404606.1.37071 WP_003404606.1.37088 WP_003404606.1.37131 WP_003404606.1.37157 WP_003404606.1.37175 WP_003404606.1.37188 WP_003404606.1.37213 WP_003404606.1.37229 WP_003404606.1.3724 WP_003404606.1.37277 WP_003404606.1.37305 WP_003404606.1.37330 WP_003404606.1.37389 WP_003404606.1.37400 WP_003404606.1.37440 WP_003404606.1.37459 WP_003404606.1.37468 WP_003404606.1.37475 WP_003404606.1.37484 WP_003404606.1.37601 WP_003404606.1.37612 WP_003404606.1.37632 WP_003404606.1.37643 WP_003404606.1.37655 WP_003404606.1.37660 WP_003404606.1.37674 WP_003404606.1.37700 WP_003404606.1.37701 WP_003404606.1.37709 WP_003404606.1.37711 WP_003404606.1.37721 WP_003404606.1.37722 WP_003404606.1.37747 WP_003404606.1.37765 WP_003404606.1.37772 WP_003404606.1.37804 WP_003404606.1.37809 WP_003404606.1.37859 WP_003404606.1.37877 WP_003404606.1.37912 WP_003404606.1.37913 WP_003404606.1.37943 WP_003404606.1.37950 WP_003404606.1.37973 WP_003404606.1.37975 WP_003404606.1.37983 WP_003404606.1.38 WP_003404606.1.38002 WP_003404606.1.3802 WP_003404606.1.38039 WP_003404606.1.38040 WP_003404606.1.38067 WP_003404606.1.38068 WP_003404606.1.38135 WP_003404606.1.38138 WP_003404606.1.38144 WP_003404606.1.38158 WP_003404606.1.38159 WP_003404606.1.38210 WP_003404606.1.38233 WP_003404606.1.38240 WP_003404606.1.38299 WP_003404606.1.38332 WP_003404606.1.38347 WP_003404606.1.38354 WP_003404606.1.38380 WP_003404606.1.38384 WP_003404606.1.38389 WP_003404606.1.38398 WP_003404606.1.38402 WP_003404606.1.38418 WP_003404606.1.38421 WP_003404606.1.38466 WP_003404606.1.38477 WP_003404606.1.38483 WP_003404606.1.3849 WP_003404606.1.385 WP_003404606.1.38530 WP_003404606.1.38535 WP_003404606.1.38539 WP_003404606.1.38594 WP_003404606.1.38611 WP_003404606.1.38638 WP_003404606.1.38639 WP_003404606.1.38646 WP_003404606.1.38648 WP_003404606.1.38654 WP_003404606.1.38659 WP_003404606.1.38660 WP_003404606.1.38666 WP_003404606.1.38671 WP_003404606.1.38672 WP_003404606.1.38677 WP_003404606.1.38750 WP_003404606.1.38772 WP_003404606.1.38812 WP_003404606.1.38821 WP_003404606.1.38844 WP_003404606.1.38863 WP_003404606.1.38865 WP_003404606.1.38873 WP_003404606.1.3889 WP_003404606.1.38894 WP_003404606.1.38909 WP_003404606.1.38939 WP_003404606.1.38974 WP_003404606.1.38975 WP_003404606.1.38991 WP_003404606.1.39025 WP_003404606.1.39070 WP_003404606.1.39072 WP_003404606.1.39095 WP_003404606.1.39106 WP_003404606.1.39165 WP_003404606.1.39174 WP_003404606.1.39176 WP_003404606.1.39178 WP_003404606.1.39190 WP_003404606.1.39201 WP_003404606.1.39207 WP_003404606.1.39211 WP_003404606.1.39236 WP_003404606.1.39239 WP_003404606.1.39252 WP_003404606.1.39288 WP_003404606.1.39295 WP_003404606.1.39306 WP_003404606.1.39359 WP_003404606.1.39364 WP_003404606.1.39400 WP_003404606.1.39447 WP_003404606.1.3945 WP_003404606.1.39450 WP_003404606.1.39455 WP_003404606.1.3949 WP_003404606.1.39521 WP_003404606.1.39560 WP_003404606.1.39592 WP_003404606.1.39593 WP_003404606.1.396 WP_003404606.1.3960 WP_003404606.1.39616 WP_003404606.1.39654 WP_003404606.1.39657 WP_003404606.1.39661 WP_003404606.1.39674 WP_003404606.1.39678 WP_003404606.1.3968 WP_003404606.1.39694 WP_003404606.1.3971 WP_003404606.1.39718 WP_003404606.1.39728 WP_003404606.1.39739 WP_003404606.1.39748 WP_003404606.1.39751 WP_003404606.1.39759 WP_003404606.1.39801 WP_003404606.1.39804 WP_003404606.1.39848 WP_003404606.1.39877 WP_003404606.1.39925 WP_003404606.1.3994 WP_003404606.1.39959 WP_003404606.1.3996 WP_003404606.1.39960 WP_003404606.1.3997 WP_003404606.1.39980 WP_003404606.1.40000 WP_003404606.1.40028 WP_003404606.1.40029 WP_003404606.1.4003 WP_003404606.1.40094 WP_003404606.1.40096 WP_003404606.1.40150 WP_003404606.1.40156 WP_003404606.1.40174 WP_003404606.1.40186 WP_003404606.1.40276 WP_003404606.1.40277 WP_003404606.1.40323 WP_003404606.1.40336 WP_003404606.1.40353 WP_003404606.1.4036 WP_003404606.1.40372 WP_003404606.1.40402 WP_003404606.1.40413 WP_003404606.1.40440 WP_003404606.1.40446 WP_003404606.1.40451 WP_003404606.1.40455 WP_003404606.1.40523 WP_003404606.1.40543 WP_003404606.1.40641 WP_003404606.1.40646 WP_003404606.1.40651 WP_003404606.1.40653 WP_003404606.1.4067 WP_003404606.1.40705 WP_003404606.1.40723 WP_003404606.1.40731 WP_003404606.1.40735 WP_003404606.1.40795 WP_003404606.1.40799 WP_003404606.1.40852 WP_003404606.1.40876 WP_003404606.1.40881 WP_003404606.1.40922 WP_003404606.1.40948 WP_003404606.1.4095 WP_003404606.1.40956 WP_003404606.1.40957 WP_003404606.1.40964 WP_003404606.1.4097 WP_003404606.1.410 WP_003404606.1.41000 WP_003404606.1.41055 WP_003404606.1.41108 WP_003404606.1.41123 WP_003404606.1.41177 WP_003404606.1.41202 WP_003404606.1.41219 WP_003404606.1.41231 WP_003404606.1.41249 WP_003404606.1.4127 WP_003404606.1.41296 WP_003404606.1.41355 WP_003404606.1.41376 WP_003404606.1.41430 WP_003404606.1.41447 WP_003404606.1.41469 WP_003404606.1.41504 WP_003404606.1.41553 WP_003404606.1.41564 WP_003404606.1.41583 WP_003404606.1.41616 WP_003404606.1.41632 WP_003404606.1.41635 WP_003404606.1.41636 WP_003404606.1.41648 WP_003404606.1.41660 WP_003404606.1.41685 WP_003404606.1.41695 WP_003404606.1.41704 WP_003404606.1.4171 WP_003404606.1.41719 WP_003404606.1.41733 WP_003404606.1.41744 WP_003404606.1.41774 WP_003404606.1.41791 WP_003404606.1.41803 WP_003404606.1.41820 WP_003404606.1.41828 WP_003404606.1.41829 WP_003404606.1.41860 WP_003404606.1.41912 WP_003404606.1.41921 WP_003404606.1.41933 WP_003404606.1.41944 WP_003404606.1.42043 WP_003404606.1.42075 WP_003404606.1.42078 WP_003404606.1.42094 WP_003404606.1.42112 WP_003404606.1.4212 WP_003404606.1.42122 WP_003404606.1.42134 WP_003404606.1.42183 WP_003404606.1.42188 WP_003404606.1.42201 WP_003404606.1.42202 WP_003404606.1.42208 WP_003404606.1.42247 WP_003404606.1.42255 WP_003404606.1.42273 WP_003404606.1.42278 WP_003404606.1.42304 WP_003404606.1.42309 WP_003404606.1.42370 WP_003404606.1.42385 WP_003404606.1.42400 WP_003404606.1.42409 WP_003404606.1.42414 WP_003404606.1.42417 WP_003404606.1.42430 WP_003404606.1.42461 WP_003404606.1.42465 WP_003404606.1.42467 WP_003404606.1.42473 WP_003404606.1.42474 WP_003404606.1.4248 WP_003404606.1.42494 WP_003404606.1.42519 WP_003404606.1.42524 WP_003404606.1.42534 WP_003404606.1.42562 WP_003404606.1.42568 WP_003404606.1.42570 WP_003404606.1.42618 WP_003404606.1.42660 WP_003404606.1.42695 WP_003404606.1.42704 WP_003404606.1.42705 WP_003404606.1.42722 WP_003404606.1.42777 WP_003404606.1.42782 WP_003404606.1.42835 WP_003404606.1.42839 WP_003404606.1.42842 WP_003404606.1.42905 WP_003404606.1.42916 WP_003404606.1.42930 WP_003404606.1.42971 WP_003404606.1.43005 WP_003404606.1.43009 WP_003404606.1.43053 WP_003404606.1.43082 WP_003404606.1.43087 WP_003404606.1.43098 WP_003404606.1.43208 WP_003404606.1.43236 WP_003404606.1.43246 WP_003404606.1.43255 WP_003404606.1.43266 WP_003404606.1.43269 WP_003404606.1.43273 WP_003404606.1.43296 WP_003404606.1.43306 WP_003404606.1.4335 WP_003404606.1.43368 WP_003404606.1.43395 WP_003404606.1.43457 WP_003404606.1.43462 WP_003404606.1.43475 WP_003404606.1.43478 WP_003404606.1.43484 WP_003404606.1.43557 WP_003404606.1.43578 WP_003404606.1.43588 WP_003404606.1.43643 WP_003404606.1.43664 WP_003404606.1.43684 WP_003404606.1.43686 WP_003404606.1.43706 WP_003404606.1.43716 WP_003404606.1.4377 WP_003404606.1.43781 WP_003404606.1.43794 WP_003404606.1.43815 WP_003404606.1.43846 WP_003404606.1.43861 WP_003404606.1.43863 WP_003404606.1.43866 WP_003404606.1.43872 WP_003404606.1.43885 WP_003404606.1.43897 WP_003404606.1.4390 WP_003404606.1.43902 WP_003404606.1.43921 WP_003404606.1.43936 WP_003404606.1.43937 WP_003404606.1.43960 WP_003404606.1.43965 WP_003404606.1.4399 WP_003404606.1.43993 WP_003404606.1.43996 WP_003404606.1.44 WP_003404606.1.44001 WP_003404606.1.44008 WP_003404606.1.44016 WP_003404606.1.44033 WP_003404606.1.44037 WP_003404606.1.44041 WP_003404606.1.44070 WP_003404606.1.44071 WP_003404606.1.44076 WP_003404606.1.44104 WP_003404606.1.44111 WP_003404606.1.44124 WP_003404606.1.44169 WP_003404606.1.44219 WP_003404606.1.44237 WP_003404606.1.44277 WP_003404606.1.44279 WP_003404606.1.44336 WP_003404606.1.44355 WP_003404606.1.44358 WP_003404606.1.4438 WP_003404606.1.44390 WP_003404606.1.44392 WP_003404606.1.4441 WP_003404606.1.44415 WP_003404606.1.44464 WP_003404606.1.44466 WP_003404606.1.44489 WP_003404606.1.44492 WP_003404606.1.44494 WP_003404606.1.44500 WP_003404606.1.44519 WP_003404606.1.44526 WP_003404606.1.44532 WP_003404606.1.44534 WP_003404606.1.44562 WP_003404606.1.44589 WP_003404606.1.44597 WP_003404606.1.44600 WP_003404606.1.44602 WP_003404606.1.44615 WP_003404606.1.4464 WP_003404606.1.44651 WP_003404606.1.44659 WP_003404606.1.44665 WP_003404606.1.44694 WP_003404606.1.44700 WP_003404606.1.44713 WP_003404606.1.44735 WP_003404606.1.44740 WP_003404606.1.44757 WP_003404606.1.4476 WP_003404606.1.44761 WP_003404606.1.44767 WP_003404606.1.44776 WP_003404606.1.44779 WP_003404606.1.44786 WP_003404606.1.44808 WP_003404606.1.44864 WP_003404606.1.44901 WP_003404606.1.44908 WP_003404606.1.44913 WP_003404606.1.4492 WP_003404606.1.44939 WP_003404606.1.44979 WP_003404606.1.44981 WP_003404606.1.45002 WP_003404606.1.45011 WP_003404606.1.4504 WP_003404606.1.45062 WP_003404606.1.45066 WP_003404606.1.45081 WP_003404606.1.45113 WP_003404606.1.45129 WP_003404606.1.45135 WP_003404606.1.45147 WP_003404606.1.45168 WP_003404606.1.4517 WP_003404606.1.45181 WP_003404606.1.45185 WP_003404606.1.45192 WP_003404606.1.45200 WP_003404606.1.45205 WP_003404606.1.45211 WP_003404606.1.4526 WP_003404606.1.45286 WP_003404606.1.45326 WP_003404606.1.45347 WP_003404606.1.45374 WP_003404606.1.45390 WP_003404606.1.454 WP_003404606.1.45407 WP_003404606.1.45451 WP_003404606.1.45453 WP_003404606.1.45460 WP_003404606.1.45463 WP_003404606.1.45470 WP_003404606.1.45474 WP_003404606.1.45491 WP_003404606.1.45510 WP_003404606.1.45563 WP_003404606.1.45584 WP_003404606.1.45590 WP_003404606.1.45619 WP_003404606.1.45626 WP_003404606.1.45631 WP_003404606.1.45666 WP_003404606.1.45697 WP_003404606.1.4571 WP_003404606.1.45731 WP_003404606.1.45743 WP_003404606.1.45765 WP_003404606.1.45776 WP_003404606.1.45783 WP_003404606.1.45805 WP_003404606.1.45815 WP_003404606.1.45849 WP_003404606.1.45867 WP_003404606.1.45884 WP_003404606.1.4590 WP_003404606.1.45923 WP_003404606.1.45926 WP_003404606.1.45963 WP_003404606.1.45989 WP_003404606.1.45992 WP_003404606.1.46025 WP_003404606.1.46083 WP_003404606.1.46090 WP_003404606.1.46092 WP_003404606.1.46100 WP_003404606.1.46101 WP_003404606.1.46103 WP_003404606.1.46107 WP_003404606.1.46127 WP_003404606.1.46128 WP_003404606.1.46129 WP_003404606.1.46141 WP_003404606.1.46150 WP_003404606.1.46201 WP_003404606.1.46226 WP_003404606.1.4624 WP_003404606.1.46253 WP_003404606.1.46268 WP_003404606.1.46285 WP_003404606.1.46300 WP_003404606.1.46313 WP_003404606.1.46336 WP_003404606.1.46365 WP_003404606.1.46370 WP_003404606.1.46381 WP_003404606.1.46402 WP_003404606.1.46411 WP_003404606.1.4644 WP_003404606.1.46442 WP_003404606.1.46453 WP_003404606.1.46463 WP_003404606.1.46478 WP_003404606.1.46492 WP_003404606.1.46521 WP_003404606.1.4653 WP_003404606.1.46532 WP_003404606.1.46539 WP_003404606.1.46568 WP_003404606.1.46585 WP_003404606.1.46609 WP_003404606.1.46613 WP_003404606.1.46625 WP_003404606.1.46642 WP_003404606.1.46647 WP_003404606.1.46674 WP_003404606.1.46724 WP_003404606.1.46758 WP_003404606.1.46773 WP_003404606.1.46777 WP_003404606.1.46786 WP_003404606.1.46792 WP_003404606.1.46847 WP_003404606.1.46851 WP_003404606.1.4687 WP_003404606.1.46897 WP_003404606.1.46936 WP_003404606.1.46980 WP_003404606.1.47011 WP_003404606.1.47012 WP_003404606.1.47066 WP_003404606.1.47077 WP_003404606.1.47083 WP_003404606.1.47106 WP_003404606.1.47142 WP_003404606.1.47147 WP_003404606.1.47166 WP_003404606.1.47178 WP_003404606.1.47179 WP_003404606.1.47194 WP_003404606.1.47207 WP_003404606.1.47210 WP_003404606.1.47261 WP_003404606.1.47262 WP_003404606.1.47402 WP_003404606.1.47423 WP_003404606.1.47467 WP_003404606.1.47502 WP_003404606.1.4751 WP_003404606.1.47511 WP_003404606.1.47537 WP_003404606.1.47540 WP_003404606.1.47568 WP_003404606.1.47572 WP_003404606.1.47588 WP_003404606.1.47636 WP_003404606.1.4764 WP_003404606.1.47653 WP_003404606.1.47679 WP_003404606.1.47681 WP_003404606.1.47690 WP_003404606.1.4771 WP_003404606.1.47717 WP_003404606.1.47743 WP_003404606.1.47754 WP_003404606.1.47773 WP_003404606.1.47776 WP_003404606.1.47780 WP_003404606.1.47805 WP_003404606.1.47832 WP_003404606.1.47847 WP_003404606.1.47858 WP_003404606.1.47861 WP_003404606.1.47868 WP_003404606.1.47893 WP_003404606.1.47899 WP_003404606.1.479 WP_003404606.1.47912 WP_003404606.1.47913 WP_003404606.1.47926 WP_003404606.1.4794 WP_003404606.1.47943 WP_003404606.1.47944 WP_003404606.1.47959 WP_003404606.1.47974 WP_003404606.1.47993 WP_003404606.1.48004 WP_003404606.1.48039 WP_003404606.1.48050 WP_003404606.1.48084 WP_003404606.1.48097 WP_003404606.1.48101 WP_003404606.1.48109 WP_003404606.1.4813 WP_003404606.1.48130 WP_003404606.1.48135 WP_003404606.1.48143 WP_003404606.1.48152 WP_003404606.1.48155 WP_003404606.1.48170 WP_003404606.1.48173 WP_003404606.1.48177 WP_003404606.1.48185 WP_003404606.1.48204 WP_003404606.1.48219 WP_003404606.1.4823 WP_003404606.1.48240 WP_003404606.1.48256 WP_003404606.1.48264 WP_003404606.1.48287 WP_003404606.1.48330 WP_003404606.1.48333 WP_003404606.1.48348 WP_003404606.1.48354 WP_003404606.1.48372 WP_003404606.1.48383 WP_003404606.1.48388 WP_003404606.1.48419 WP_003404606.1.48423 WP_003404606.1.48443 WP_003404606.1.48450 WP_003404606.1.48462 WP_003404606.1.48550 WP_003404606.1.48605 WP_003404606.1.48618 WP_003404606.1.4863 WP_003404606.1.48648 WP_003404606.1.48658 WP_003404606.1.48666 WP_003404606.1.48687 WP_003404606.1.48779 WP_003404606.1.4878 WP_003404606.1.48798 WP_003404606.1.48802 WP_003404606.1.48826 WP_003404606.1.48831 WP_003404606.1.48843 WP_003404606.1.48857 WP_003404606.1.4890 WP_003404606.1.48946 WP_003404606.1.48979 WP_003404606.1.49017 WP_003404606.1.49048 WP_003404606.1.49059 WP_003404606.1.4907 WP_003404606.1.49103 WP_003404606.1.49110 WP_003404606.1.49111 WP_003404606.1.49112 WP_003404606.1.4919 WP_003404606.1.49251 WP_003404606.1.49254 WP_003404606.1.49263 WP_003404606.1.49291 WP_003404606.1.49296 WP_003404606.1.49335 WP_003404606.1.49337 WP_003404606.1.49419 WP_003404606.1.49426 WP_003404606.1.49437 WP_003404606.1.49439 WP_003404606.1.49474 WP_003404606.1.49506 WP_003404606.1.49516 WP_003404606.1.49523 WP_003404606.1.49526 WP_003404606.1.49532 WP_003404606.1.49588 WP_003404606.1.4959 WP_003404606.1.49678 WP_003404606.1.49687 WP_003404606.1.49699 WP_003404606.1.49709 WP_003404606.1.4971 WP_003404606.1.4972 WP_003404606.1.49736 WP_003404606.1.49746 WP_003404606.1.49764 WP_003404606.1.49773 WP_003404606.1.49796 WP_003404606.1.49814 WP_003404606.1.49815 WP_003404606.1.49816 WP_003404606.1.49839 WP_003404606.1.49857 WP_003404606.1.49878 WP_003404606.1.49880 WP_003404606.1.49944 WP_003404606.1.4999 WP_003404606.1.49990 WP_003404606.1.50068 WP_003404606.1.5008 WP_003404606.1.50081 WP_003404606.1.50122 WP_003404606.1.50126 WP_003404606.1.50149 WP_003404606.1.50162 WP_003404606.1.5018 WP_003404606.1.50194 WP_003404606.1.50218 WP_003404606.1.50235 WP_003404606.1.50249 WP_003404606.1.50265 WP_003404606.1.50271 WP_003404606.1.50324 WP_003404606.1.50347 WP_003404606.1.50372 WP_003404606.1.50398 WP_003404606.1.50407 WP_003404606.1.50444 WP_003404606.1.50466 WP_003404606.1.5048 WP_003404606.1.50498 WP_003404606.1.5050 WP_003404606.1.50540 WP_003404606.1.50554 WP_003404606.1.50557 WP_003404606.1.50601 WP_003404606.1.50610 WP_003404606.1.50632 WP_003404606.1.50633 WP_003404606.1.50642 WP_003404606.1.50655 WP_003404606.1.50659 WP_003404606.1.50683 WP_003404606.1.50689 WP_003404606.1.50692 WP_003404606.1.50714 WP_003404606.1.50729 WP_003404606.1.50756 WP_003404606.1.50784 WP_003404606.1.50794 WP_003404606.1.50841 WP_003404606.1.50860 WP_003404606.1.50868 WP_003404606.1.50877 WP_003404606.1.5096 WP_003404606.1.50987 WP_003404606.1.51003 WP_003404606.1.51009 WP_003404606.1.51037 WP_003404606.1.51074 WP_003404606.1.51082 WP_003404606.1.51101 WP_003404606.1.51116 WP_003404606.1.51149 WP_003404606.1.51156 WP_003404606.1.51157 WP_003404606.1.51213 WP_003404606.1.51232 WP_003404606.1.51239 WP_003404606.1.51247 WP_003404606.1.51266 WP_003404606.1.51279 WP_003404606.1.51291 WP_003404606.1.51294 WP_003404606.1.51301 WP_003404606.1.51329 WP_003404606.1.51391 WP_003404606.1.51422 WP_003404606.1.51445 WP_003404606.1.51455 WP_003404606.1.51466 WP_003404606.1.51468 WP_003404606.1.51478 WP_003404606.1.51497 WP_003404606.1.51520 WP_003404606.1.51593 WP_003404606.1.51628 WP_003404606.1.5164 WP_003404606.1.51647 WP_003404606.1.51660 WP_003404606.1.51696 WP_003404606.1.51721 WP_003404606.1.51788 WP_003404606.1.51795 WP_003404606.1.51801 WP_003404606.1.51817 WP_003404606.1.51819 WP_003404606.1.51854 WP_003404606.1.51923 WP_003404606.1.51942 WP_003404606.1.51948 WP_003404606.1.51963 WP_003404606.1.51969 WP_003404606.1.52000 WP_003404606.1.52001 WP_003404606.1.52003 WP_003404606.1.52006 WP_003404606.1.52036 WP_003404606.1.52038 WP_003404606.1.52046 WP_003404606.1.52059 WP_003404606.1.52069 WP_003404606.1.52082 WP_003404606.1.52102 WP_003404606.1.52106 WP_003404606.1.52166 WP_003404606.1.52168 WP_003404606.1.52173 WP_003404606.1.52178 WP_003404606.1.52206 WP_003404606.1.52216 WP_003404606.1.52238 WP_003404606.1.52241 WP_003404606.1.52280 WP_003404606.1.52314 WP_003404606.1.52385 WP_003404606.1.52390 WP_003404606.1.524 WP_003404606.1.52460 WP_003404606.1.52485 WP_003404606.1.52486 WP_003404606.1.52495 WP_003404606.1.52504 WP_003404606.1.52522 WP_003404606.1.52531 WP_003404606.1.52533 WP_003404606.1.52545 WP_003404606.1.52553 WP_003404606.1.52563 WP_003404606.1.52564 WP_003404606.1.52574 WP_003404606.1.52641 WP_003404606.1.52673 WP_003404606.1.52674 WP_003404606.1.52708 WP_003404606.1.52713 WP_003404606.1.52761 WP_003404606.1.52778 WP_003404606.1.52791 WP_003404606.1.52797 WP_003404606.1.52818 WP_003404606.1.52872 WP_003404606.1.52873 WP_003404606.1.52891 WP_003404606.1.52892 WP_003404606.1.52909 WP_003404606.1.52970 WP_003404606.1.52998 WP_003404606.1.53053 WP_003404606.1.53056 WP_003404606.1.5306 WP_003404606.1.53088 WP_003404606.1.5309 WP_003404606.1.531 WP_003404606.1.53117 WP_003404606.1.53118 WP_003404606.1.53142 WP_003404606.1.53143 WP_003404606.1.53167 WP_003404606.1.53200 WP_003404606.1.53204 WP_003404606.1.53213 WP_003404606.1.53217 WP_003404606.1.53226 WP_003404606.1.53229 WP_003404606.1.53230 WP_003404606.1.53237 WP_003404606.1.53254 WP_003404606.1.53257 WP_003404606.1.5327 WP_003404606.1.53276 WP_003404606.1.53278 WP_003404606.1.533 WP_003404606.1.53302 WP_003404606.1.5334 WP_003404606.1.5335 WP_003404606.1.53353 WP_003404606.1.53381 WP_003404606.1.53413 WP_003404606.1.53458 WP_003404606.1.53460 WP_003404606.1.53480 WP_003404606.1.53517 WP_003404606.1.53522 WP_003404606.1.53525 WP_003404606.1.53526 WP_003404606.1.53553 WP_003404606.1.53606 WP_003404606.1.53609 WP_003404606.1.53628 WP_003404606.1.53643 WP_003404606.1.53667 WP_003404606.1.53679 WP_003404606.1.53715 WP_003404606.1.53730 WP_003404606.1.53742 WP_003404606.1.53743 WP_003404606.1.53754 WP_003404606.1.53775 WP_003404606.1.53787 WP_003404606.1.53803 WP_003404606.1.53818 WP_003404606.1.53822 WP_003404606.1.53853 WP_003404606.1.53865 WP_003404606.1.53888 WP_003404606.1.53900 WP_003404606.1.53912 WP_003404606.1.53914 WP_003404606.1.53952 WP_003404606.1.5398 WP_003404606.1.5408 WP_003404606.1.54089 WP_003404606.1.54093 WP_003404606.1.54099 WP_003404606.1.54112 WP_003404606.1.54125 WP_003404606.1.54141 WP_003404606.1.54162 WP_003404606.1.54179 WP_003404606.1.54218 WP_003404606.1.54225 WP_003404606.1.54227 WP_003404606.1.54232 WP_003404606.1.54241 WP_003404606.1.54245 WP_003404606.1.54247 WP_003404606.1.54260 WP_003404606.1.54275 WP_003404606.1.54280 WP_003404606.1.5429 WP_003404606.1.54294 WP_003404606.1.54314 WP_003404606.1.54347 WP_003404606.1.54351 WP_003404606.1.54370 WP_003404606.1.54428 WP_003404606.1.54449 WP_003404606.1.54494 WP_003404606.1.54502 WP_003404606.1.54514 WP_003404606.1.54519 WP_003404606.1.5452 WP_003404606.1.54531 WP_003404606.1.54537 WP_003404606.1.54553 WP_003404606.1.54555 WP_003404606.1.54575 WP_003404606.1.54633 WP_003404606.1.54686 WP_003404606.1.54687 WP_003404606.1.54705 WP_003404606.1.54730 WP_003404606.1.54732 WP_003404606.1.5475 WP_003404606.1.54797 WP_003404606.1.54807 WP_003404606.1.54836 WP_003404606.1.54838 WP_003404606.1.54860 WP_003404606.1.54888 WP_003404606.1.54897 WP_003404606.1.54905 WP_003404606.1.54909 WP_003404606.1.54937 WP_003404606.1.54939 WP_003404606.1.54944 WP_003404606.1.54945 WP_003404606.1.54953 WP_003404606.1.54964 WP_003404606.1.55015 WP_003404606.1.55022 WP_003404606.1.55023 WP_003404606.1.55051 WP_003404606.1.55072 WP_003404606.1.55088 WP_003404606.1.55106 WP_003404606.1.55126 WP_003404606.1.55128 WP_003404606.1.55140 WP_003404606.1.55150 WP_003404606.1.55210 WP_003404606.1.55227 WP_003404606.1.55248 WP_003404606.1.55257 WP_003404606.1.55258 WP_003404606.1.55267 WP_003404606.1.55279 WP_003404606.1.55307 WP_003404606.1.55326 WP_003404606.1.55328 WP_003404606.1.5533 WP_003404606.1.55345 WP_003404606.1.55396 WP_003404606.1.55398 WP_003404606.1.55441 WP_003404606.1.55459 WP_003404606.1.55501 WP_003404606.1.55504 WP_003404606.1.55578 WP_003404606.1.55626 WP_003404606.1.55641 WP_003404606.1.5569 WP_003404606.1.55723 WP_003404606.1.55735 WP_003404606.1.5574 WP_003404606.1.55772 WP_003404606.1.55802 WP_003404606.1.55807 WP_003404606.1.55819 WP_003404606.1.55821 WP_003404606.1.5583 WP_003404606.1.55849 WP_003404606.1.55856 WP_003404606.1.55860 WP_003404606.1.55882 WP_003404606.1.55883 WP_003404606.1.55894 WP_003404606.1.55902 WP_003404606.1.55908 WP_003404606.1.55909 WP_003404606.1.5591 WP_003404606.1.55961 WP_003404606.1.55977 WP_003404606.1.55983 WP_003404606.1.56028 WP_003404606.1.56057 WP_003404606.1.56060 WP_003404606.1.56107 WP_003404606.1.56132 WP_003404606.1.56163 WP_003404606.1.56167 WP_003404606.1.56178 WP_003404606.1.56287 WP_003404606.1.56292 WP_003404606.1.56327 WP_003404606.1.56341 WP_003404606.1.56359 WP_003404606.1.56365 WP_003404606.1.56394 WP_003404606.1.56443 WP_003404606.1.56473 WP_003404606.1.56478 WP_003404606.1.56500 WP_003404606.1.56517 WP_003404606.1.56534 WP_003404606.1.5656 WP_003404606.1.56577 WP_003404606.1.56593 WP_003404606.1.56625 WP_003404606.1.56637 WP_003404606.1.56670 WP_003404606.1.56697 WP_003404606.1.567 WP_003404606.1.56701 WP_003404606.1.56709 WP_003404606.1.56729 WP_003404606.1.56743 WP_003404606.1.56755 WP_003404606.1.56764 WP_003404606.1.56769 WP_003404606.1.56770 WP_003404606.1.56795 WP_003404606.1.5681 WP_003404606.1.56827 WP_003404606.1.56839 WP_003404606.1.56863 WP_003404606.1.56868 WP_003404606.1.56869 WP_003404606.1.56915 WP_003404606.1.56926 WP_003404606.1.56961 WP_003404606.1.56971 WP_003404606.1.56972 WP_003404606.1.57023 WP_003404606.1.57035 WP_003404606.1.57077 WP_003404606.1.57087 WP_003404606.1.57094 WP_003404606.1.57134 WP_003404606.1.57151 WP_003404606.1.57169 WP_003404606.1.57208 WP_003404606.1.57212 WP_003404606.1.57230 WP_003404606.1.5724 WP_003404606.1.5725 WP_003404606.1.5727 WP_003404606.1.57273 WP_003404606.1.573 WP_003404606.1.57314 WP_003404606.1.57326 WP_003404606.1.57328 WP_003404606.1.57331 WP_003404606.1.57340 WP_003404606.1.57351 WP_003404606.1.57352 WP_003404606.1.57380 WP_003404606.1.57430 WP_003404606.1.5744 WP_003404606.1.57440 WP_003404606.1.5745 WP_003404606.1.57461 WP_003404606.1.57469 WP_003404606.1.57489 WP_003404606.1.575 WP_003404606.1.57509 WP_003404606.1.57519 WP_003404606.1.57525 WP_003404606.1.57551 WP_003404606.1.5758 WP_003404606.1.57596 WP_003404606.1.57604 WP_003404606.1.57616 WP_003404606.1.57617 WP_003404606.1.57619 WP_003404606.1.57627 WP_003404606.1.57642 WP_003404606.1.57658 WP_003404606.1.57667 WP_003404606.1.57675 WP_003404606.1.57689 WP_003404606.1.57708 WP_003404606.1.57794 WP_003404606.1.57821 WP_003404606.1.57825 WP_003404606.1.57843 WP_003404606.1.57906 WP_003404606.1.57924 WP_003404606.1.57926 WP_003404606.1.57930 WP_003404606.1.57957 WP_003404606.1.57960 WP_003404606.1.57964 WP_003404606.1.57991 WP_003404606.1.58000 WP_003404606.1.58086 WP_003404606.1.58101 WP_003404606.1.58103 WP_003404606.1.58108 WP_003404606.1.5811 WP_003404606.1.58121 WP_003404606.1.58145 WP_003404606.1.58164 WP_003404606.1.58174 WP_003404606.1.582 WP_003404606.1.58202 WP_003404606.1.58209 WP_003404606.1.5824 WP_003404606.1.58250 WP_003404606.1.58259 WP_003404606.1.58283 WP_003404606.1.58288 WP_003404606.1.5830 WP_003404606.1.58303 WP_003404606.1.58311 WP_003404606.1.58330 WP_003404606.1.58359 WP_003404606.1.58386 WP_003404606.1.58393 WP_003404606.1.58431 WP_003404606.1.5844 WP_003404606.1.58457 WP_003404606.1.58488 WP_003404606.1.58518 WP_003404606.1.58534 WP_003404606.1.58559 WP_003404606.1.58567 WP_003404606.1.58573 WP_003404606.1.58602 WP_003404606.1.58612 WP_003404606.1.58619 WP_003404606.1.58630 WP_003404606.1.5865 WP_003404606.1.58671 WP_003404606.1.58690 WP_003404606.1.58702 WP_003404606.1.58754 WP_003404606.1.5879 WP_003404606.1.5881 WP_003404606.1.58824 WP_003404606.1.58848 WP_003404606.1.58857 WP_003404606.1.58891 WP_003404606.1.58892 WP_003404606.1.5890 WP_003404606.1.58904 WP_003404606.1.58921 WP_003404606.1.58930 WP_003404606.1.58939 WP_003404606.1.58941 WP_003404606.1.58953 WP_003404606.1.58961 WP_003404606.1.5898 WP_003404606.1.59025 WP_003404606.1.59029 WP_003404606.1.59037 WP_003404606.1.59044 WP_003404606.1.59085 WP_003404606.1.59088 WP_003404606.1.59112 WP_003404606.1.59130 WP_003404606.1.5914 WP_003404606.1.59147 WP_003404606.1.59166 WP_003404606.1.59205 WP_003404606.1.59209 WP_003404606.1.59237 WP_003404606.1.59240 WP_003404606.1.59253 WP_003404606.1.59254 WP_003404606.1.59262 WP_003404606.1.59270 WP_003404606.1.5928 WP_003404606.1.59304 WP_003404606.1.59305 WP_003404606.1.59309 WP_003404606.1.59316 WP_003404606.1.59326 WP_003404606.1.59328 WP_003404606.1.59333 WP_003404606.1.59338 WP_003404606.1.59388 WP_003404606.1.59428 WP_003404606.1.59487 WP_003404606.1.59537 WP_003404606.1.59561 WP_003404606.1.59677 WP_003404606.1.59722 WP_003404606.1.59727 WP_003404606.1.59732 WP_003404606.1.59738 WP_003404606.1.59750 WP_003404606.1.59757 WP_003404606.1.59761 WP_003404606.1.59808 WP_003404606.1.59850 WP_003404606.1.59856 WP_003404606.1.59860 WP_003404606.1.59861 WP_003404606.1.5987 WP_003404606.1.59878 WP_003404606.1.59888 WP_003404606.1.5996 WP_003404606.1.59961 WP_003404606.1.59974 WP_003404606.1.6000 WP_003404606.1.60007 WP_003404606.1.60016 WP_003404606.1.6003 WP_003404606.1.60047 WP_003404606.1.6007 WP_003404606.1.60091 WP_003404606.1.60121 WP_003404606.1.60125 WP_003404606.1.60135 WP_003404606.1.60139 WP_003404606.1.60152 WP_003404606.1.60171 WP_003404606.1.60197 WP_003404606.1.6020 WP_003404606.1.60205 WP_003404606.1.60207 WP_003404606.1.60215 WP_003404606.1.60217 WP_003404606.1.60267 WP_003404606.1.60288 WP_003404606.1.60291 WP_003404606.1.60301 WP_003404606.1.60305 WP_003404606.1.60312 WP_003404606.1.60313 WP_003404606.1.60314 WP_003404606.1.60367 WP_003404606.1.60376 WP_003404606.1.60403 WP_003404606.1.60413 WP_003404606.1.60421 WP_003404606.1.60451 WP_003404606.1.60460 WP_003404606.1.60479 WP_003404606.1.60487 WP_003404606.1.60512 WP_003404606.1.60573 WP_003404606.1.60583 WP_003404606.1.60632 WP_003404606.1.60657 WP_003404606.1.60687 WP_003404606.1.60689 WP_003404606.1.60727 WP_003404606.1.60738 WP_003404606.1.60763 WP_003404606.1.6077 WP_003404606.1.60791 WP_003404606.1.60834 WP_003404606.1.60870 WP_003404606.1.60878 WP_003404606.1.60879 WP_003404606.1.60913 WP_003404606.1.60978 WP_003404606.1.61000 WP_003404606.1.61001 WP_003404606.1.61012 WP_003404606.1.61014 WP_003404606.1.61015 WP_003404606.1.61037 WP_003404606.1.61052 WP_003404606.1.61065 WP_003404606.1.61100 WP_003404606.1.61101 WP_003404606.1.61138 WP_003404606.1.61142 WP_003404606.1.61198 WP_003404606.1.612 WP_003404606.1.61234 WP_003404606.1.61256 WP_003404606.1.61281 WP_003404606.1.61314 WP_003404606.1.61321 WP_003404606.1.61326 WP_003404606.1.61328 WP_003404606.1.61368 WP_003404606.1.61391 WP_003404606.1.61406 WP_003404606.1.61409 WP_003404606.1.61420 WP_003404606.1.61422 WP_003404606.1.61425 WP_003404606.1.61428 WP_003404606.1.61469 WP_003404606.1.61494 WP_003404606.1.61522 WP_003404606.1.61552 WP_003404606.1.61557 WP_003404606.1.61567 WP_003404606.1.61571 WP_003404606.1.61573 WP_003404606.1.61584 WP_003404606.1.61586 WP_003404606.1.6159 WP_003404606.1.61592 WP_003404606.1.6160 WP_003404606.1.61614 WP_003404606.1.6163 WP_003404606.1.61655 WP_003404606.1.61665 WP_003404606.1.61669 WP_003404606.1.61682 WP_003404606.1.61692 WP_003404606.1.61719 WP_003404606.1.61728 WP_003404606.1.61750 WP_003404606.1.61754 WP_003404606.1.61755 WP_003404606.1.61757 WP_003404606.1.61778 WP_003404606.1.6179 WP_003404606.1.61793 WP_003404606.1.61816 WP_003404606.1.61842 WP_003404606.1.61850 WP_003404606.1.61862 WP_003404606.1.61865 WP_003404606.1.61868 WP_003404606.1.61911 WP_003404606.1.61925 WP_003404606.1.61941 WP_003404606.1.61953 WP_003404606.1.61979 WP_003404606.1.61986 WP_003404606.1.61987 WP_003404606.1.61998 WP_003404606.1.62021 WP_003404606.1.62087 WP_003404606.1.62089 WP_003404606.1.62101 WP_003404606.1.62104 WP_003404606.1.6211 WP_003404606.1.62132 WP_003404606.1.62162 WP_003404606.1.62225 WP_003404606.1.62230 WP_003404606.1.62238 WP_003404606.1.62249 WP_003404606.1.62270 WP_003404606.1.62281 WP_003404606.1.62307 WP_003404606.1.6231 WP_003404606.1.62359 WP_003404606.1.62360 WP_003404606.1.62371 WP_003404606.1.62379 WP_003404606.1.62395 WP_003404606.1.62449 WP_003404606.1.62468 WP_003404606.1.6248 WP_003404606.1.62508 WP_003404606.1.62565 WP_003404606.1.62594 WP_003404606.1.62606 WP_003404606.1.62616 WP_003404606.1.62666 WP_003404606.1.62687 WP_003404606.1.62715 WP_003404606.1.62730 WP_003404606.1.62738 WP_003404606.1.62761 WP_003404606.1.62766 WP_003404606.1.62786 WP_003404606.1.62813 WP_003404606.1.62839 WP_003404606.1.62841 WP_003404606.1.62909 WP_003404606.1.62936 WP_003404606.1.6294 WP_003404606.1.6295 WP_003404606.1.62962 WP_003404606.1.63007 WP_003404606.1.63019 WP_003404606.1.63032 WP_003404606.1.63037 WP_003404606.1.63064 WP_003404606.1.63066 WP_003404606.1.63072 WP_003404606.1.6308 WP_003404606.1.63081 WP_003404606.1.63096 WP_003404606.1.63106 WP_003404606.1.6314 WP_003404606.1.63144 WP_003404606.1.63154 WP_003404606.1.63160 WP_003404606.1.63161 WP_003404606.1.63166 WP_003404606.1.63175 WP_003404606.1.63194 WP_003404606.1.6322 WP_003404606.1.63222 WP_003404606.1.63247 WP_003404606.1.6328 WP_003404606.1.63291 WP_003404606.1.63312 WP_003404606.1.63317 WP_003404606.1.63331 WP_003404606.1.63373 WP_003404606.1.63384 WP_003404606.1.63403 WP_003404606.1.63424 WP_003404606.1.63428 WP_003404606.1.6345 WP_003404606.1.63464 WP_003404606.1.63483 WP_003404606.1.63502 WP_003404606.1.63504 WP_003404606.1.63522 WP_003404606.1.63530 WP_003404606.1.63538 WP_003404606.1.63564 WP_003404606.1.63567 WP_003404606.1.63596 WP_003404606.1.63600 WP_003404606.1.63623 WP_003404606.1.63624 WP_003404606.1.63625 WP_003404606.1.63627 WP_003404606.1.63654 WP_003404606.1.63662 WP_003404606.1.63711 WP_003404606.1.63734 WP_003404606.1.63807 WP_003404606.1.63819 WP_003404606.1.63844 WP_003404606.1.63888 WP_003404606.1.63913 WP_003404606.1.63915 WP_003404606.1.63918 WP_003404606.1.63961 WP_003404606.1.63970 WP_003404606.1.64000 WP_003404606.1.64027 WP_003404606.1.64058 WP_003404606.1.64065 WP_003404606.1.6407 WP_003404606.1.64082 WP_003404606.1.64091 WP_003404606.1.64102 WP_003404606.1.64104 WP_003404606.1.64119 WP_003404606.1.64169 WP_003404606.1.64219 WP_003404606.1.6422 WP_003404606.1.64222 WP_003404606.1.64223 WP_003404606.1.64228 WP_003404606.1.64235 WP_003404606.1.64249 WP_003404606.1.6427 WP_003404606.1.64278 WP_003404606.1.64287 WP_003404606.1.64414 WP_003404606.1.64419 WP_003404606.1.6443 WP_003404606.1.64463 WP_003404606.1.64480 WP_003404606.1.64497 WP_003404606.1.64506 WP_003404606.1.64511 WP_003404606.1.64513 WP_003404606.1.64514 WP_003404606.1.64515 WP_003404606.1.64522 WP_003404606.1.64526 WP_003404606.1.64543 WP_003404606.1.6456 WP_003404606.1.64567 WP_003404606.1.64588 WP_003404606.1.64589 WP_003404606.1.64594 WP_003404606.1.64595 WP_003404606.1.64608 WP_003404606.1.64619 WP_003404606.1.64629 WP_003404606.1.6464 WP_003404606.1.64664 WP_003404606.1.64669 WP_003404606.1.64680 WP_003404606.1.64682 WP_003404606.1.64727 WP_003404606.1.64729 WP_003404606.1.64774 WP_003404606.1.64776 WP_003404606.1.64802 WP_003404606.1.64832 WP_003404606.1.6486 WP_003404606.1.64870 WP_003404606.1.64898 WP_003404606.1.64922 WP_003404606.1.64924 WP_003404606.1.6493 WP_003404606.1.64937 WP_003404606.1.64941 WP_003404606.1.64966 WP_003404606.1.64973 WP_003404606.1.65001 WP_003404606.1.65026 WP_003404606.1.65053 WP_003404606.1.65070 WP_003404606.1.65079 WP_003404606.1.65102 WP_003404606.1.65157 WP_003404606.1.65181 WP_003404606.1.65212 WP_003404606.1.65229 WP_003404606.1.6523 WP_003404606.1.65253 WP_003404606.1.65289 WP_003404606.1.65291 WP_003404606.1.65315 WP_003404606.1.65329 WP_003404606.1.65359 WP_003404606.1.6536 WP_003404606.1.65374 WP_003404606.1.65414 WP_003404606.1.65416 WP_003404606.1.65433 WP_003404606.1.65455 WP_003404606.1.65467 WP_003404606.1.65488 WP_003404606.1.65529 WP_003404606.1.65539 WP_003404606.1.65583 WP_003404606.1.65612 WP_003404606.1.65623 WP_003404606.1.65635 WP_003404606.1.65637 WP_003404606.1.65648 WP_003404606.1.65683 WP_003404606.1.65686 WP_003404606.1.65688 WP_003404606.1.65707 WP_003404606.1.65733 WP_003404606.1.65746 WP_003404606.1.65747 WP_003404606.1.65759 WP_003404606.1.65816 WP_003404606.1.65830 WP_003404606.1.65858 WP_003404606.1.65862 WP_003404606.1.65869 WP_003404606.1.65893 WP_003404606.1.65929 WP_003404606.1.65932 WP_003404606.1.65958 WP_003404606.1.65974 WP_003404606.1.66004 WP_003404606.1.66013 WP_003404606.1.6606 WP_003404606.1.66089 WP_003404606.1.66149 WP_003404606.1.66151 WP_003404606.1.66229 WP_003404606.1.66276 WP_003404606.1.66293 WP_003404606.1.66297 WP_003404606.1.66323 WP_003404606.1.66325 WP_003404606.1.6633 WP_003404606.1.66334 WP_003404606.1.66355 WP_003404606.1.66367 WP_003404606.1.66394 WP_003404606.1.66396 WP_003404606.1.66451 WP_003404606.1.66455 WP_003404606.1.66457 WP_003404606.1.66460 WP_003404606.1.66464 WP_003404606.1.66466 WP_003404606.1.66487 WP_003404606.1.66504 WP_003404606.1.66544 WP_003404606.1.66558 WP_003404606.1.66580 WP_003404606.1.66582 WP_003404606.1.66612 WP_003404606.1.66615 WP_003404606.1.66617 WP_003404606.1.66635 WP_003404606.1.66656 WP_003404606.1.66663 WP_003404606.1.66675 WP_003404606.1.66715 WP_003404606.1.66718 WP_003404606.1.66762 WP_003404606.1.66776 WP_003404606.1.66808 WP_003404606.1.66817 WP_003404606.1.66819 WP_003404606.1.66826 WP_003404606.1.66830 WP_003404606.1.66842 WP_003404606.1.66868 WP_003404606.1.66878 WP_003404606.1.66880 WP_003404606.1.66893 WP_003404606.1.66961 WP_003404606.1.67005 WP_003404606.1.6704 WP_003404606.1.67044 WP_003404606.1.67061 WP_003404606.1.67089 WP_003404606.1.67098 WP_003404606.1.67146 WP_003404606.1.67170 WP_003404606.1.67197 WP_003404606.1.67198 WP_003404606.1.6720 WP_003404606.1.67207 WP_003404606.1.67218 WP_003404606.1.67220 WP_003404606.1.67225 WP_003404606.1.67231 WP_003404606.1.6724 WP_003404606.1.67257 WP_003404606.1.67298 WP_003404606.1.67307 WP_003404606.1.67324 WP_003404606.1.67332 WP_003404606.1.67346 WP_003404606.1.67354 WP_003404606.1.67360 WP_003404606.1.67381 WP_003404606.1.67396 WP_003404606.1.67417 WP_003404606.1.67422 WP_003404606.1.67453 WP_003404606.1.67459 WP_003404606.1.6746 WP_003404606.1.67473 WP_003404606.1.67481 WP_003404606.1.67482 WP_003404606.1.67496 WP_003404606.1.67499 WP_003404606.1.67516 WP_003404606.1.67523 WP_003404606.1.67536 WP_003404606.1.67575 WP_003404606.1.67587 WP_003404606.1.67598 WP_003404606.1.67600 WP_003404606.1.67602 WP_003404606.1.67630 WP_003404606.1.67679 WP_003404606.1.67692 WP_003404606.1.67744 WP_003404606.1.6775 WP_003404606.1.67750 WP_003404606.1.6777 WP_003404606.1.67809 WP_003404606.1.67816 WP_003404606.1.67844 WP_003404606.1.67848 WP_003404606.1.67870 WP_003404606.1.67888 WP_003404606.1.67915 WP_003404606.1.67945 WP_003404606.1.67949 WP_003404606.1.67980 WP_003404606.1.67982 WP_003404606.1.68022 WP_003404606.1.68029 WP_003404606.1.68037 WP_003404606.1.68038 WP_003404606.1.68045 WP_003404606.1.68057 WP_003404606.1.68083 WP_003404606.1.68088 WP_003404606.1.68106 WP_003404606.1.68110 WP_003404606.1.68153 WP_003404606.1.68164 WP_003404606.1.68169 WP_003404606.1.68193 WP_003404606.1.68212 WP_003404606.1.68227 WP_003404606.1.68243 WP_003404606.1.6825 WP_003404606.1.68297 WP_003404606.1.68309 WP_003404606.1.68325 WP_003404606.1.68329 WP_003404606.1.68340 WP_003404606.1.68384 WP_003404606.1.68388 WP_003404606.1.68429 WP_003404606.1.6843 WP_003404606.1.68433 WP_003404606.1.68444 WP_003404606.1.68465 WP_003404606.1.68484 WP_003404606.1.68518 WP_003404606.1.68569 WP_003404606.1.68576 WP_003404606.1.68580 WP_003404606.1.68586 WP_003404606.1.68623 WP_003404606.1.68624 WP_003404606.1.68637 WP_003404606.1.68646 WP_003404606.1.68667 WP_003404606.1.68669 WP_003404606.1.68672 WP_003404606.1.68684 WP_003404606.1.68704 WP_003404606.1.68708 WP_003404606.1.6872 WP_003404606.1.68730 WP_003404606.1.68734 WP_003404606.1.68748 WP_003404606.1.68754 WP_003404606.1.6876 WP_003404606.1.68761 WP_003404606.1.68763 WP_003404606.1.68766 WP_003404606.1.68774 WP_003404606.1.68796 WP_003404606.1.68824 WP_003404606.1.68832 WP_003404606.1.68833 WP_003404606.1.68841 WP_003404606.1.68859 WP_003404606.1.68876 WP_003404606.1.68906 WP_003404606.1.68916 WP_003404606.1.68923 WP_003404606.1.68945 WP_003404606.1.6896 WP_003404606.1.68981 WP_003404606.1.68984 WP_003404606.1.68997 WP_003404606.1.69008 WP_003404606.1.69076 WP_003404606.1.69079 WP_003404606.1.6908 WP_003404606.1.69082 WP_003404606.1.69178 WP_003404606.1.69181 WP_003404606.1.69208 WP_003404606.1.69231 WP_003404606.1.69256 WP_003404606.1.69311 WP_003404606.1.69315 WP_003404606.1.69322 WP_003404606.1.69342 WP_003404606.1.6935 WP_003404606.1.6936 WP_003404606.1.69369 WP_003404606.1.69374 WP_003404606.1.69398 WP_003404606.1.69401 WP_003404606.1.69426 WP_003404606.1.69427 WP_003404606.1.69429 WP_003404606.1.6949 WP_003404606.1.6951 WP_003404606.1.69511 WP_003404606.1.69526 WP_003404606.1.69528 WP_003404606.1.69547 WP_003404606.1.69573 WP_003404606.1.69581 WP_003404606.1.6960 WP_003404606.1.69617 WP_003404606.1.69634 WP_003404606.1.69647 WP_003404606.1.69659 WP_003404606.1.69673 WP_003404606.1.69682 WP_003404606.1.69684 WP_003404606.1.69707 WP_003404606.1.69709 WP_003404606.1.69723 WP_003404606.1.69736 WP_003404606.1.69778 WP_003404606.1.69800 WP_003404606.1.69802 WP_003404606.1.69845 WP_003404606.1.69870 WP_003404606.1.69873 WP_003404606.1.69898 WP_003404606.1.69913 WP_003404606.1.69925 WP_003404606.1.69931 WP_003404606.1.69938 WP_003404606.1.69955 WP_003404606.1.69957 WP_003404606.1.69981 WP_003404606.1.69990 WP_003404606.1.70 WP_003404606.1.70000 WP_003404606.1.70017 WP_003404606.1.70032 WP_003404606.1.70055 WP_003404606.1.70062 WP_003404606.1.70072 WP_003404606.1.70131 WP_003404606.1.70132 WP_003404606.1.7022 WP_003404606.1.70227 WP_003404606.1.70255 WP_003404606.1.70271 WP_003404606.1.70274 WP_003404606.1.7029 WP_003404606.1.70325 WP_003404606.1.70328 WP_003404606.1.70356 WP_003404606.1.70364 WP_003404606.1.70368 WP_003404606.1.70369 WP_003404606.1.70418 WP_003404606.1.70422 WP_003404606.1.70435 WP_003404606.1.70444 WP_003404606.1.70463 WP_003404606.1.70471 WP_003404606.1.70480 WP_003404606.1.70494 WP_003404606.1.70498 WP_003404606.1.70525 WP_003404606.1.70573 WP_003404606.1.70577 WP_003404606.1.70610 WP_003404606.1.70615 WP_003404606.1.70618 WP_003404606.1.70622 WP_003404606.1.70626 WP_003404606.1.70668 WP_003404606.1.70699 WP_003404606.1.70704 WP_003404606.1.70729 WP_003404606.1.70757 WP_003404606.1.70782 WP_003404606.1.70796 WP_003404606.1.70830 WP_003404606.1.70834 WP_003404606.1.7084 WP_003404606.1.70840 WP_003404606.1.70864 WP_003404606.1.70871 WP_003404606.1.70915 WP_003404606.1.70955 WP_003404606.1.70958 WP_003404606.1.70964 WP_003404606.1.70976 WP_003404606.1.71015 WP_003404606.1.71026 WP_003404606.1.71063 WP_003404606.1.71076 WP_003404606.1.71083 WP_003404606.1.7111 WP_003404606.1.71118 WP_003404606.1.71128 WP_003404606.1.7113 WP_003404606.1.71187 WP_003404606.1.71191 WP_003404606.1.71255 WP_003404606.1.71258 WP_003404606.1.71259 WP_003404606.1.71289 WP_003404606.1.71326 WP_003404606.1.71329 WP_003404606.1.71331 WP_003404606.1.71344 WP_003404606.1.71390 WP_003404606.1.71399 WP_003404606.1.71414 WP_003404606.1.71440 WP_003404606.1.71457 WP_003404606.1.7146 WP_003404606.1.71464 WP_003404606.1.71490 WP_003404606.1.71492 WP_003404606.1.71509 WP_003404606.1.71516 WP_003404606.1.71517 WP_003404606.1.71527 WP_003404606.1.71532 WP_003404606.1.71545 WP_003404606.1.71546 WP_003404606.1.71569 WP_003404606.1.71604 WP_003404606.1.71621 WP_003404606.1.71630 WP_003404606.1.71638 WP_003404606.1.71654 WP_003404606.1.71664 WP_003404606.1.71665 WP_003404606.1.71683 WP_003404606.1.71701 WP_003404606.1.71718 WP_003404606.1.71731 WP_003404606.1.71778 WP_003404606.1.71781 WP_003404606.1.71803 WP_003404606.1.71820 WP_003404606.1.71847 WP_003404606.1.7185 WP_003404606.1.71871 WP_003404606.1.71909 WP_003404606.1.71957 WP_003404606.1.71970 WP_003404606.1.72047 WP_003404606.1.72061 WP_003404606.1.72062 WP_003404606.1.72072 WP_003404606.1.72111 WP_003404606.1.72122 WP_003404606.1.72128 WP_003404606.1.72143 WP_003404606.1.7216 WP_003404606.1.72168 WP_003404606.1.72179 WP_003404606.1.72209 WP_003404606.1.72218 WP_003404606.1.72219 WP_003404606.1.72227 WP_003404606.1.7224 WP_003404606.1.72268 WP_003404606.1.72332 WP_003404606.1.72380 WP_003404606.1.72401 WP_003404606.1.72405 WP_003404606.1.72420 WP_003404606.1.72441 WP_003404606.1.72451 WP_003404606.1.72452 WP_003404606.1.72457 WP_003404606.1.72459 WP_003404606.1.72460 WP_003404606.1.72466 WP_003404606.1.72487 WP_003404606.1.72488 WP_003404606.1.72492 WP_003404606.1.72506 WP_003404606.1.72543 WP_003404606.1.7256 WP_003404606.1.72576 WP_003404606.1.72578 WP_003404606.1.72585 WP_003404606.1.72591 WP_003404606.1.72592 WP_003404606.1.72640 WP_003404606.1.7266 WP_003404606.1.72661 WP_003404606.1.72684 WP_003404606.1.72739 WP_003404606.1.72744 WP_003404606.1.72755 WP_003404606.1.72759 WP_003404606.1.72784 WP_003404606.1.72792 WP_003404606.1.72826 WP_003404606.1.72831 WP_003404606.1.72852 WP_003404606.1.72853 WP_003404606.1.72879 WP_003404606.1.72880 WP_003404606.1.72938 WP_003404606.1.72954 WP_003404606.1.72957 WP_003404606.1.72959 WP_003404606.1.72973 WP_003404606.1.7298 WP_003404606.1.72982 WP_003404606.1.72988 WP_003404606.1.72993 WP_003404606.1.73006 WP_003404606.1.73013 WP_003404606.1.73025 WP_003404606.1.73028 WP_003404606.1.73042 WP_003404606.1.73045 WP_003404606.1.73092 WP_003404606.1.73118 WP_003404606.1.7312 WP_003404606.1.73127 WP_003404606.1.73134 WP_003404606.1.73150 WP_003404606.1.73154 WP_003404606.1.73163 WP_003404606.1.73182 WP_003404606.1.73205 WP_003404606.1.7321 WP_003404606.1.73310 WP_003404606.1.73315 WP_003404606.1.73365 WP_003404606.1.73391 WP_003404606.1.73404 WP_003404606.1.73424 WP_003404606.1.73436 WP_003404606.1.73445 WP_003404606.1.73453 WP_003404606.1.73465 WP_003404606.1.73466 WP_003404606.1.73470 WP_003404606.1.73471 WP_003404606.1.73478 WP_003404606.1.73482 WP_003404606.1.73507 WP_003404606.1.73532 WP_003404606.1.73550 WP_003404606.1.73564 WP_003404606.1.73623 WP_003404606.1.73629 WP_003404606.1.7366 WP_003404606.1.73661 WP_003404606.1.7368 WP_003404606.1.73688 WP_003404606.1.73723 WP_003404606.1.73744 WP_003404606.1.73750 WP_003404606.1.73760 WP_003404606.1.73774 WP_003404606.1.7379 WP_003404606.1.73813 WP_003404606.1.73840 WP_003404606.1.73876 WP_003404606.1.7389 WP_003404606.1.73986 WP_003404606.1.74016 WP_003404606.1.74039 WP_003404606.1.74083 WP_003404606.1.74101 WP_003404606.1.74107 WP_003404606.1.74120 WP_003404606.1.74129 WP_003404606.1.74144 WP_003404606.1.7417 WP_003404606.1.74190 WP_003404606.1.74210 WP_003404606.1.7423 WP_003404606.1.74259 WP_003404606.1.74262 WP_003404606.1.74269 WP_003404606.1.74282 WP_003404606.1.74291 WP_003404606.1.74296 WP_003404606.1.74304 WP_003404606.1.7432 WP_003404606.1.74347 WP_003404606.1.7436 WP_003404606.1.74378 WP_003404606.1.74382 WP_003404606.1.74395 WP_003404606.1.74400 WP_003404606.1.74401 WP_003404606.1.74432 WP_003404606.1.74442 WP_003404606.1.74477 WP_003404606.1.74487 WP_003404606.1.74499 WP_003404606.1.74504 WP_003404606.1.74511 WP_003404606.1.74523 WP_003404606.1.74525 WP_003404606.1.74551 WP_003404606.1.74555 WP_003404606.1.74628 WP_003404606.1.74653 WP_003404606.1.74660 WP_003404606.1.74683 WP_003404606.1.7469 WP_003404606.1.74725 WP_003404606.1.74760 WP_003404606.1.74786 WP_003404606.1.74809 WP_003404606.1.74820 WP_003404606.1.74870 WP_003404606.1.74881 WP_003404606.1.74888 WP_003404606.1.74952 WP_003404606.1.7496 WP_003404606.1.74988 WP_003404606.1.75043 WP_003404606.1.75045 WP_003404606.1.75055 WP_003404606.1.75078 WP_003404606.1.75081 WP_003404606.1.75120 WP_003404606.1.75163 WP_003404606.1.75200 WP_003404606.1.75202 WP_003404606.1.75234 WP_003404606.1.75239 WP_003404606.1.75250 WP_003404606.1.75263 WP_003404606.1.75281 WP_003404606.1.75342 WP_003404606.1.7535 WP_003404606.1.75376 WP_003404606.1.75391 WP_003404606.1.75395 WP_003404606.1.75441 WP_003404606.1.75510 WP_003404606.1.75581 WP_003404606.1.75598 WP_003404606.1.75635 WP_003404606.1.75645 WP_003404606.1.75671 WP_003404606.1.75741 WP_003404606.1.75749 WP_003404606.1.75772 WP_003404606.1.75774 WP_003404606.1.75811 WP_003404606.1.75833 WP_003404606.1.7585 WP_003404606.1.75864 WP_003404606.1.75868 WP_003404606.1.75878 WP_003404606.1.75927 WP_003404606.1.75946 WP_003404606.1.75968 WP_003404606.1.75974 WP_003404606.1.76007 WP_003404606.1.76016 WP_003404606.1.76032 WP_003404606.1.76037 WP_003404606.1.7604 WP_003404606.1.76045 WP_003404606.1.76052 WP_003404606.1.76058 WP_003404606.1.76064 WP_003404606.1.76110 WP_003404606.1.76126 WP_003404606.1.76133 WP_003404606.1.76138 WP_003404606.1.76157 WP_003404606.1.76172 WP_003404606.1.76177 WP_003404606.1.76183 WP_003404606.1.76209 WP_003404606.1.76239 WP_003404606.1.76272 WP_003404606.1.76277 WP_003404606.1.76280 WP_003404606.1.76281 WP_003404606.1.76291 WP_003404606.1.76297 WP_003404606.1.76360 WP_003404606.1.76379 WP_003404606.1.76403 WP_003404606.1.76413 WP_003404606.1.76414 WP_003404606.1.76427 WP_003404606.1.76436 WP_003404606.1.76442 WP_003404606.1.76443 WP_003404606.1.76456 WP_003404606.1.76521 WP_003404606.1.76533 WP_003404606.1.76616 WP_003404606.1.76625 WP_003404606.1.76629 WP_003404606.1.76635 WP_003404606.1.76638 WP_003404606.1.76639 WP_003404606.1.76640 WP_003404606.1.76644 WP_003404606.1.76677 WP_003404606.1.76678 WP_003404606.1.76679 WP_003404606.1.76734 WP_003404606.1.76744 WP_003404606.1.76750 WP_003404606.1.76754 WP_003404606.1.76757 WP_003404606.1.76781 WP_003404606.1.76818 WP_003404606.1.76824 WP_003404606.1.76835 WP_003404606.1.76873 WP_003404606.1.76881 WP_003404606.1.76888 WP_003404606.1.76900 WP_003404606.1.7691 WP_003404606.1.76947 WP_003404606.1.76954 WP_003404606.1.76955 WP_003404606.1.76963 WP_003404606.1.76976 WP_003404606.1.770 WP_003404606.1.77000 WP_003404606.1.77008 WP_003404606.1.77021 WP_003404606.1.77056 WP_003404606.1.77065 WP_003404606.1.77075 WP_003404606.1.77093 WP_003404606.1.77107 WP_003404606.1.77115 WP_003404606.1.77118 WP_003404606.1.77125 WP_003404606.1.77141 WP_003404606.1.77142 WP_003404606.1.77166 WP_003404606.1.77250 WP_003404606.1.77252 WP_003404606.1.77260 WP_003404606.1.77266 WP_003404606.1.77280 WP_003404606.1.77285 WP_003404606.1.77312 WP_003404606.1.77348 WP_003404606.1.77351 WP_003404606.1.77352 WP_003404606.1.77361 WP_003404606.1.774 WP_003404606.1.7740 WP_003404606.1.77404 WP_003404606.1.77425 WP_003404606.1.77463 WP_003404606.1.77474 WP_003404606.1.7748 WP_003404606.1.77484 WP_003404606.1.77491 WP_003404606.1.77499 WP_003404606.1.77510 WP_003404606.1.77530 WP_003404606.1.77554 WP_003404606.1.77559 WP_003404606.1.77599 WP_003404606.1.77605 WP_003404606.1.7762 WP_003404606.1.77627 WP_003404606.1.77649 WP_003404606.1.77654 WP_003404606.1.7766 WP_003404606.1.77667 WP_003404606.1.77704 WP_003404606.1.77706 WP_003404606.1.77726 WP_003404606.1.77774 WP_003404606.1.7778 WP_003404606.1.77790 WP_003404606.1.77809 WP_003404606.1.77820 WP_003404606.1.77843 WP_003404606.1.77855 WP_003404606.1.77865 WP_003404606.1.77868 WP_003404606.1.77879 WP_003404606.1.77890 WP_003404606.1.77909 WP_003404606.1.77911 WP_003404606.1.77931 WP_003404606.1.77984 WP_003404606.1.78020 WP_003404606.1.78024 WP_003404606.1.78075 WP_003404606.1.78084 WP_003404606.1.78086 WP_003404606.1.7809 WP_003404606.1.78098 WP_003404606.1.78105 WP_003404606.1.78113 WP_003404606.1.78136 WP_003404606.1.78162 WP_003404606.1.7817 WP_003404606.1.78200 WP_003404606.1.78216 WP_003404606.1.78236 WP_003404606.1.78238 WP_003404606.1.78322 WP_003404606.1.78338 WP_003404606.1.7836 WP_003404606.1.78360 WP_003404606.1.78386 WP_003404606.1.78429 WP_003404606.1.78435 WP_003404606.1.7844 WP_003404606.1.78459 WP_003404606.1.78488 WP_003404606.1.7849 WP_003404606.1.78499 WP_003404606.1.785 WP_003404606.1.78516 WP_003404606.1.78524 WP_003404606.1.78526 WP_003404606.1.78538 WP_003404606.1.78544 WP_003404606.1.78545 WP_003404606.1.78547 WP_003404606.1.78574 WP_003404606.1.78580 WP_003404606.1.7860 WP_003404606.1.78620 WP_003404606.1.78646 WP_003404606.1.78648 WP_003404606.1.78649 WP_003404606.1.78655 WP_003404606.1.78657 WP_003404606.1.78659 WP_003404606.1.7869 WP_003404606.1.78692 WP_003404606.1.78760 WP_003404606.1.78766 WP_003404606.1.78776 WP_003404606.1.78778 WP_003404606.1.78784 WP_003404606.1.78788 WP_003404606.1.78790 WP_003404606.1.78793 WP_003404606.1.78848 WP_003404606.1.78860 WP_003404606.1.7887 WP_003404606.1.78884 WP_003404606.1.78932 WP_003404606.1.78969 WP_003404606.1.78977 WP_003404606.1.78980 WP_003404606.1.79005 WP_003404606.1.79016 WP_003404606.1.79064 WP_003404606.1.79066 WP_003404606.1.79068 WP_003404606.1.79077 WP_003404606.1.79095 WP_003404606.1.79112 WP_003404606.1.79122 WP_003404606.1.79145 WP_003404606.1.79152 WP_003404606.1.79163 WP_003404606.1.79182 WP_003404606.1.79198 WP_003404606.1.79213 WP_003404606.1.79218 WP_003404606.1.79268 WP_003404606.1.79273 WP_003404606.1.79278 WP_003404606.1.79290 WP_003404606.1.79319 WP_003404606.1.79325 WP_003404606.1.79326 WP_003404606.1.7933 WP_003404606.1.79330 WP_003404606.1.79339 WP_003404606.1.79394 WP_003404606.1.79399 WP_003404606.1.79413 WP_003404606.1.79422 WP_003404606.1.79445 WP_003404606.1.79447 WP_003404606.1.79455 WP_003404606.1.79471 WP_003404606.1.79480 WP_003404606.1.79482 WP_003404606.1.79488 WP_003404606.1.79500 WP_003404606.1.79502 WP_003404606.1.79508 WP_003404606.1.79514 WP_003404606.1.79561 WP_003404606.1.79565 WP_003404606.1.79578 WP_003404606.1.79588 WP_003404606.1.79598 WP_003404606.1.79615 WP_003404606.1.79684 WP_003404606.1.79698 WP_003404606.1.797 WP_003404606.1.79744 WP_003404606.1.79784 WP_003404606.1.79802 WP_003404606.1.79806 WP_003404606.1.79819 WP_003404606.1.79826 WP_003404606.1.79828 WP_003404606.1.79851 WP_003404606.1.79853 WP_003404606.1.79863 WP_003404606.1.79881 WP_003404606.1.79885 WP_003404606.1.79898 WP_003404606.1.7990 WP_003404606.1.79900 WP_003404606.1.79913 WP_003404606.1.79918 WP_003404606.1.79947 WP_003404606.1.79948 WP_003404606.1.7995 WP_003404606.1.7997 WP_003404606.1.80004 WP_003404606.1.80015 WP_003404606.1.80022 WP_003404606.1.80030 WP_003404606.1.80054 WP_003404606.1.80099 WP_003404606.1.80129 WP_003404606.1.80177 WP_003404606.1.80234 WP_003404606.1.8026 WP_003404606.1.80275 WP_003404606.1.8029 WP_003404606.1.80299 WP_003404606.1.80300 WP_003404606.1.80304 WP_003404606.1.80326 WP_003404606.1.80351 WP_003404606.1.8037 WP_003404606.1.80370 WP_003404606.1.80387 WP_003404606.1.80399 WP_003404606.1.8044 WP_003404606.1.80451 WP_003404606.1.80458 WP_003404606.1.80461 WP_003404606.1.80490 WP_003404606.1.80503 WP_003404606.1.80507 WP_003404606.1.80552 WP_003404606.1.80576 WP_003404606.1.80588 WP_003404606.1.80599 WP_003404606.1.8060 WP_003404606.1.80624 WP_003404606.1.80636 WP_003404606.1.80669 WP_003404606.1.80673 WP_003404606.1.80711 WP_003404606.1.80714 WP_003404606.1.80743 WP_003404606.1.80784 WP_003404606.1.80815 WP_003404606.1.80853 WP_003404606.1.80918 WP_003404606.1.8093 WP_003404606.1.80967 WP_003404606.1.8097 WP_003404606.1.80988 WP_003404606.1.81007 WP_003404606.1.81013 WP_003404606.1.8105 WP_003404606.1.81059 WP_003404606.1.81063 WP_003404606.1.81066 WP_003404606.1.81075 WP_003404606.1.81091 WP_003404606.1.81119 WP_003404606.1.81125 WP_003404606.1.81136 WP_003404606.1.8114 WP_003404606.1.81189 WP_003404606.1.81192 WP_003404606.1.812 WP_003404606.1.81230 WP_003404606.1.81249 WP_003404606.1.81250 WP_003404606.1.81264 WP_003404606.1.8128 WP_003404606.1.81287 WP_003404606.1.81297 WP_003404606.1.8138 WP_003404606.1.81407 WP_003404606.1.8143 WP_003404606.1.81439 WP_003404606.1.81465 WP_003404606.1.81505 WP_003404606.1.81529 WP_003404606.1.81538 WP_003404606.1.81541 WP_003404606.1.81560 WP_003404606.1.81561 WP_003404606.1.81567 WP_003404606.1.81583 WP_003404606.1.81712 WP_003404606.1.81720 WP_003404606.1.81731 WP_003404606.1.81774 WP_003404606.1.81788 WP_003404606.1.81809 WP_003404606.1.81820 WP_003404606.1.81850 WP_003404606.1.81883 WP_003404606.1.81891 WP_003404606.1.81911 WP_003404606.1.81918 WP_003404606.1.82011 WP_003404606.1.82048 WP_003404606.1.82069 WP_003404606.1.82071 WP_003404606.1.82108 WP_003404606.1.82136 WP_003404606.1.82142 WP_003404606.1.8215 WP_003404606.1.82158 WP_003404606.1.8217 WP_003404606.1.82209 WP_003404606.1.82210 WP_003404606.1.82228 WP_003404606.1.82236 WP_003404606.1.82251 WP_003404606.1.82271 WP_003404606.1.82305 WP_003404606.1.82307 WP_003404606.1.82309 WP_003404606.1.82317 WP_003404606.1.8232 WP_003404606.1.82346 WP_003404606.1.82374 WP_003404606.1.82385 WP_003404606.1.82429 WP_003404606.1.82460 WP_003404606.1.82462 WP_003404606.1.82483 WP_003404606.1.82494 WP_003404606.1.82531 WP_003404606.1.82546 WP_003404606.1.82547 WP_003404606.1.82549 WP_003404606.1.82577 WP_003404606.1.82592 WP_003404606.1.82597 WP_003404606.1.82598 WP_003404606.1.82625 WP_003404606.1.82642 WP_003404606.1.82651 WP_003404606.1.82653 WP_003404606.1.82681 WP_003404606.1.82685 WP_003404606.1.8271 WP_003404606.1.82712 WP_003404606.1.8273 WP_003404606.1.82743 WP_003404606.1.82757 WP_003404606.1.82774 WP_003404606.1.82803 WP_003404606.1.82836 WP_003404606.1.82860 WP_003404606.1.82871 WP_003404606.1.82892 WP_003404606.1.82935 WP_003404606.1.82957 WP_003404606.1.82973 WP_003404606.1.82981 WP_003404606.1.82983 WP_003404606.1.83004 WP_003404606.1.83009 WP_003404606.1.83044 WP_003404606.1.83065 WP_003404606.1.83074 WP_003404606.1.83110 WP_003404606.1.83146 WP_003404606.1.83149 WP_003404606.1.83159 WP_003404606.1.8317 WP_003404606.1.83173 WP_003404606.1.83181 WP_003404606.1.83182 WP_003404606.1.83191 WP_003404606.1.83197 WP_003404606.1.83212 WP_003404606.1.8326 WP_003404606.1.83262 WP_003404606.1.83268 WP_003404606.1.83309 WP_003404606.1.83332 WP_003404606.1.83334 WP_003404606.1.83341 WP_003404606.1.83349 WP_003404606.1.8335 WP_003404606.1.83353 WP_003404606.1.83367 WP_003404606.1.83380 WP_003404606.1.83381 WP_003404606.1.83389 WP_003404606.1.83408 WP_003404606.1.83409 WP_003404606.1.83435 WP_003404606.1.83470 WP_003404606.1.83524 WP_003404606.1.83526 WP_003404606.1.8358 WP_003404606.1.83589 WP_003404606.1.83601 WP_003404606.1.83611 WP_003404606.1.83638 WP_003404606.1.83648 WP_003404606.1.83656 WP_003404606.1.83667 WP_003404606.1.83689 WP_003404606.1.83692 WP_003404606.1.83704 WP_003404606.1.83705 WP_003404606.1.83766 WP_003404606.1.83793 WP_003404606.1.83794 WP_003404606.1.83802 WP_003404606.1.83805 WP_003404606.1.83839 WP_003404606.1.83842 WP_003404606.1.83850 WP_003404606.1.83861 WP_003404606.1.83884 WP_003404606.1.83920 WP_003404606.1.83929 WP_003404606.1.83930 WP_003404606.1.83975 WP_003404606.1.83991 WP_003404606.1.8400 WP_003404606.1.84027 WP_003404606.1.8404 WP_003404606.1.84057 WP_003404606.1.84070 WP_003404606.1.8409 WP_003404606.1.84112 WP_003404606.1.84146 WP_003404606.1.8415 WP_003404606.1.84176 WP_003404606.1.84186 WP_003404606.1.84192 WP_003404606.1.84228 WP_003404606.1.8424 WP_003404606.1.84244 WP_003404606.1.84259 WP_003404606.1.8426 WP_003404606.1.84277 WP_003404606.1.84287 WP_003404606.1.8434 WP_003404606.1.84388 WP_003404606.1.84408 WP_003404606.1.84409 WP_003404606.1.84438 WP_003404606.1.84460 WP_003404606.1.84488 WP_003404606.1.84504 WP_003404606.1.84525 WP_003404606.1.84620 WP_003404606.1.84623 WP_003404606.1.84641 WP_003404606.1.84655 WP_003404606.1.84666 WP_003404606.1.84670 WP_003404606.1.84739 WP_003404606.1.84748 WP_003404606.1.84766 WP_003404606.1.84772 WP_003404606.1.84774 WP_003404606.1.848 WP_003404606.1.84812 WP_003404606.1.84836 WP_003404606.1.84839 WP_003404606.1.84846 WP_003404606.1.84873 WP_003404606.1.84911 WP_003404606.1.84938 WP_003404606.1.84968 WP_003404606.1.84973 WP_003404606.1.84981 WP_003404606.1.84985 WP_003404606.1.8503 WP_003404606.1.85038 WP_003404606.1.85041 WP_003404606.1.85043 WP_003404606.1.8505 WP_003404606.1.85074 WP_003404606.1.8509 WP_003404606.1.8512 WP_003404606.1.85148 WP_003404606.1.8518 WP_003404606.1.8522 WP_003404606.1.85242 WP_003404606.1.85281 WP_003404606.1.85284 WP_003404606.1.85314 WP_003404606.1.85319 WP_003404606.1.85330 WP_003404606.1.85341 WP_003404606.1.85346 WP_003404606.1.8535 WP_003404606.1.85363 WP_003404606.1.85371 WP_003404606.1.85377 WP_003404606.1.85387 WP_003404606.1.85399 WP_003404606.1.85458 WP_003404606.1.8546 WP_003404606.1.85464 WP_003404606.1.85478 WP_003404606.1.85480 WP_003404606.1.85488 WP_003404606.1.85495 WP_003404606.1.85551 WP_003404606.1.85557 WP_003404606.1.85577 WP_003404606.1.85597 WP_003404606.1.85599 WP_003404606.1.85610 WP_003404606.1.8563 WP_003404606.1.85648 WP_003404606.1.85679 WP_003404606.1.85704 WP_003404606.1.85717 WP_003404606.1.85727 WP_003404606.1.85737 WP_003404606.1.85763 WP_003404606.1.85808 WP_003404606.1.85819 WP_003404606.1.85820 WP_003404606.1.85823 WP_003404606.1.85832 WP_003404606.1.8586 WP_003404606.1.85872 WP_003404606.1.85894 WP_003404606.1.85909 WP_003404606.1.85913 WP_003404606.1.85953 WP_003404606.1.85986 WP_003404606.1.86000 WP_003404606.1.86024 WP_003404606.1.86025 WP_003404606.1.86032 WP_003404606.1.86048 WP_003404606.1.86052 WP_003404606.1.86067 WP_003404606.1.86103 WP_003404606.1.86122 WP_003404606.1.86124 WP_003404606.1.86160 WP_003404606.1.86164 WP_003404606.1.86168 WP_003404606.1.86190 WP_003404606.1.86204 WP_003404606.1.86208 WP_003404606.1.86235 WP_003404606.1.86249 WP_003404606.1.86260 WP_003404606.1.86290 WP_003404606.1.863 WP_003404606.1.86327 WP_003404606.1.86334 WP_003404606.1.86337 WP_003404606.1.86368 WP_003404606.1.86377 WP_003404606.1.86425 WP_003404606.1.86459 WP_003404606.1.8649 WP_003404606.1.86499 WP_003404606.1.86520 WP_003404606.1.86561 WP_003404606.1.86568 WP_003404606.1.86575 WP_003404606.1.86584 WP_003404606.1.86605 WP_003404606.1.86626 WP_003404606.1.86648 WP_003404606.1.8666 WP_003404606.1.86684 WP_003404606.1.86696 WP_003404606.1.86705 WP_003404606.1.86718 WP_003404606.1.86725 WP_003404606.1.86757 WP_003404606.1.86766 WP_003404606.1.86801 WP_003404606.1.86814 WP_003404606.1.86820 WP_003404606.1.86825 WP_003404606.1.86834 WP_003404606.1.8685 WP_003404606.1.86851 WP_003404606.1.86867 WP_003404606.1.86877 WP_003404606.1.86883 WP_003404606.1.8689 WP_003404606.1.86892 WP_003404606.1.86933 WP_003404606.1.86941 WP_003404606.1.86950 WP_003404606.1.86962 WP_003404606.1.86963 WP_003404606.1.86979 WP_003404606.1.8700 WP_003404606.1.87001 WP_003404606.1.87002 WP_003404606.1.87031 WP_003404606.1.87116 WP_003404606.1.87117 WP_003404606.1.8714 WP_003404606.1.87162 WP_003404606.1.87178 WP_003404606.1.87191 WP_003404606.1.87201 WP_003404606.1.87209 WP_003404606.1.87240 WP_003404606.1.87266 WP_003404606.1.87275 WP_003404606.1.8733 WP_003404606.1.87345 WP_003404606.1.87369 WP_003404606.1.8737 WP_003404606.1.87401 WP_003404606.1.87404 WP_003404606.1.87406 WP_003404606.1.87409 WP_003404606.1.87444 WP_003404606.1.87446 WP_003404606.1.87459 WP_003404606.1.87472 WP_003404606.1.87489 WP_003404606.1.87494 WP_003404606.1.87496 WP_003404606.1.87582 WP_003404606.1.87588 WP_003404606.1.87617 WP_003404606.1.87619 WP_003404606.1.87620 WP_003404606.1.87634 WP_003404606.1.87643 WP_003404606.1.8765 WP_003404606.1.87650 WP_003404606.1.87654 WP_003404606.1.87658 WP_003404606.1.87665 WP_003404606.1.87676 WP_003404606.1.87677 WP_003404606.1.87684 WP_003404606.1.87692 WP_003404606.1.87707 WP_003404606.1.87732 WP_003404606.1.87784 WP_003404606.1.87796 WP_003404606.1.87809 WP_003404606.1.87817 WP_003404606.1.87827 WP_003404606.1.87831 WP_003404606.1.87835 WP_003404606.1.87837 WP_003404606.1.87866 WP_003404606.1.8789 WP_003404606.1.87911 WP_003404606.1.87924 WP_003404606.1.87951 WP_003404606.1.87955 WP_003404606.1.87956 WP_003404606.1.87991 WP_003404606.1.88 WP_003404606.1.88002 WP_003404606.1.88037 WP_003404606.1.88039 WP_003404606.1.88072 WP_003404606.1.88077 WP_003404606.1.88121 WP_003404606.1.88180 WP_003404606.1.88191 WP_003404606.1.88205 WP_003404606.1.88217 WP_003404606.1.88219 WP_003404606.1.88245 WP_003404606.1.88253 WP_003404606.1.88294 WP_003404606.1.88315 WP_003404606.1.88316 WP_003404606.1.88320 WP_003404606.1.88338 WP_003404606.1.8840 WP_003404606.1.88437 WP_003404606.1.88453 WP_003404606.1.88469 WP_003404606.1.88489 WP_003404606.1.88507 WP_003404606.1.88521 WP_003404606.1.88530 WP_003404606.1.88537 WP_003404606.1.88541 WP_003404606.1.88592 WP_003404606.1.88616 WP_003404606.1.88618 WP_003404606.1.8862 WP_003404606.1.88625 WP_003404606.1.88632 WP_003404606.1.88634 WP_003404606.1.88649 WP_003404606.1.8870 WP_003404606.1.88737 WP_003404606.1.88756 WP_003404606.1.888 WP_003404606.1.88824 WP_003404606.1.88886 WP_003404606.1.88965 WP_003404606.1.88985 WP_003404606.1.8902 WP_003404606.1.89025 WP_003404606.1.89041 WP_003404606.1.89082 WP_003404606.1.89162 WP_003404606.1.89168 WP_003404606.1.8917 WP_003404606.1.89193 WP_003404606.1.89205 WP_003404606.1.89207 WP_003404606.1.89225 WP_003404606.1.8925 WP_003404606.1.89277 WP_003404606.1.89286 WP_003404606.1.89293 WP_003404606.1.89320 WP_003404606.1.8935 WP_003404606.1.89371 WP_003404606.1.89378 WP_003404606.1.89392 WP_003404606.1.89406 WP_003404606.1.8943 WP_003404606.1.89451 WP_003404606.1.89453 WP_003404606.1.89473 WP_003404606.1.89475 WP_003404606.1.89483 WP_003404606.1.895 WP_003404606.1.89513 WP_003404606.1.89517 WP_003404606.1.89522 WP_003404606.1.8954 WP_003404606.1.89543 WP_003404606.1.89567 WP_003404606.1.8957 WP_003404606.1.89572 WP_003404606.1.89589 WP_003404606.1.89607 WP_003404606.1.89613 WP_003404606.1.89625 WP_003404606.1.89648 WP_003404606.1.8967 WP_003404606.1.89670 WP_003404606.1.89676 WP_003404606.1.89729 WP_003404606.1.89739 WP_003404606.1.89762 WP_003404606.1.8977 WP_003404606.1.89802 WP_003404606.1.89808 WP_003404606.1.8982 WP_003404606.1.89829 WP_003404606.1.89831 WP_003404606.1.89844 WP_003404606.1.89849 WP_003404606.1.8989 WP_003404606.1.89901 WP_003404606.1.89903 WP_003404606.1.89909 WP_003404606.1.8992 WP_003404606.1.89922 WP_003404606.1.89926 WP_003404606.1.89963 WP_003404606.1.89971 WP_003404606.1.8998 WP_003404606.1.89987 WP_003404606.1.900 WP_003404606.1.90048 WP_003404606.1.9007 WP_003404606.1.90080 WP_003404606.1.90130 WP_003404606.1.90134 WP_003404606.1.90137 WP_003404606.1.90157 WP_003404606.1.90184 WP_003404606.1.90199 WP_003404606.1.90231 WP_003404606.1.90245 WP_003404606.1.90308 WP_003404606.1.90322 WP_003404606.1.90328 WP_003404606.1.90372 WP_003404606.1.90439 WP_003404606.1.90481 WP_003404606.1.90499 WP_003404606.1.9050 WP_003404606.1.90527 WP_003404606.1.90550 WP_003404606.1.90560 WP_003404606.1.90612 WP_003404606.1.90640 WP_003404606.1.90672 WP_003404606.1.90687 WP_003404606.1.90691 WP_003404606.1.90711 WP_003404606.1.90722 WP_003404606.1.90744 WP_003404606.1.9075 WP_003404606.1.90756 WP_003404606.1.90767 WP_003404606.1.90771 WP_003404606.1.90785 WP_003404606.1.90788 WP_003404606.1.90800 WP_003404606.1.90810 WP_003404606.1.90816 WP_003404606.1.90819 WP_003404606.1.9082 WP_003404606.1.90831 WP_003404606.1.90884 WP_003404606.1.90899 WP_003404606.1.90906 WP_003404606.1.90958 WP_003404606.1.90976 WP_003404606.1.90977 WP_003404606.1.90987 WP_003404606.1.9102 WP_003404606.1.91026 WP_003404606.1.91032 WP_003404606.1.91043 WP_003404606.1.91053 WP_003404606.1.91082 WP_003404606.1.91106 WP_003404606.1.91112 WP_003404606.1.91144 WP_003404606.1.91151 WP_003404606.1.91157 WP_003404606.1.91167 WP_003404606.1.91169 WP_003404606.1.91192 WP_003404606.1.91201 WP_003404606.1.91207 WP_003404606.1.91208 WP_003404606.1.91211 WP_003404606.1.91214 WP_003404606.1.91230 WP_003404606.1.91244 WP_003404606.1.91251 WP_003404606.1.91260 WP_003404606.1.91265 WP_003404606.1.9128 WP_003404606.1.91284 WP_003404606.1.91294 WP_003404606.1.91303 WP_003404606.1.91322 WP_003404606.1.91352 WP_003404606.1.91386 WP_003404606.1.9139 WP_003404606.1.91398 WP_003404606.1.91411 WP_003404606.1.91430 WP_003404606.1.91436 WP_003404606.1.91483 WP_003404606.1.91496 WP_003404606.1.91507 WP_003404606.1.91508 WP_003404606.1.91576 WP_003404606.1.91589 WP_003404606.1.91694 WP_003404606.1.91695 WP_003404606.1.91713 WP_003404606.1.91716 WP_003404606.1.91717 WP_003404606.1.91728 WP_003404606.1.91743 WP_003404606.1.91759 WP_003404606.1.91784 WP_003404606.1.91785 WP_003404606.1.91786 WP_003404606.1.91802 WP_003404606.1.91822 WP_003404606.1.91828 WP_003404606.1.9189 WP_003404606.1.91896 WP_003404606.1.9190 WP_003404606.1.91915 WP_003404606.1.91931 WP_003404606.1.91937 WP_003404606.1.91944 WP_003404606.1.91953 WP_003404606.1.91957 WP_003404606.1.91976 WP_003404606.1.91978 WP_003404606.1.92021 WP_003404606.1.92083 WP_003404606.1.92127 WP_003404606.1.92144 WP_003404606.1.92150 WP_003404606.1.92153 WP_003404606.1.92190 WP_003404606.1.92192 WP_003404606.1.92200 WP_003404606.1.92220 WP_003404606.1.92221 WP_003404606.1.92222 WP_003404606.1.92273 WP_003404606.1.92289 WP_003404606.1.9229 WP_003404606.1.92294 WP_003404606.1.92300 WP_003404606.1.92317 WP_003404606.1.92334 WP_003404606.1.92338 WP_003404606.1.92345 WP_003404606.1.92356 WP_003404606.1.92364 WP_003404606.1.92380 WP_003404606.1.92416 WP_003404606.1.92428 WP_003404606.1.92447 WP_003404606.1.92456 WP_003404606.1.92467 WP_003404606.1.92471 WP_003404606.1.92490 WP_003404606.1.92508 WP_003404606.1.9251 WP_003404606.1.92511 WP_003404606.1.92523 WP_003404606.1.92527 WP_003404606.1.92536 WP_003404606.1.92592 WP_003404606.1.92597 WP_003404606.1.92603 WP_003404606.1.92610 WP_003404606.1.92613 WP_003404606.1.9263 WP_003404606.1.9265 WP_003404606.1.92650 WP_003404606.1.92660 WP_003404606.1.92677 WP_003404606.1.92685 WP_003404606.1.92689 WP_003404606.1.92690 WP_003404606.1.92706 WP_003404606.1.92714 WP_003404606.1.92736 WP_003404606.1.9274 WP_003404606.1.92752 WP_003404606.1.92760 WP_003404606.1.92777 WP_003404606.1.92803 WP_003404606.1.92833 WP_003404606.1.92856 WP_003404606.1.92892 WP_003404606.1.92907 WP_003404606.1.92908 WP_003404606.1.9291 WP_003404606.1.92917 WP_003404606.1.92996 WP_003404606.1.93006 WP_003404606.1.93008 WP_003404606.1.93009 WP_003404606.1.93015 WP_003404606.1.93043 WP_003404606.1.9307 WP_003404606.1.93083 WP_003404606.1.93097 WP_003404606.1.93137 WP_003404606.1.93192 WP_003404606.1.93199 WP_003404606.1.93203 WP_003404606.1.93212 WP_003404606.1.93234 WP_003404606.1.93245 WP_003404606.1.93257 WP_003404606.1.93265 WP_003404606.1.93297 WP_003404606.1.93320 WP_003404606.1.93328 WP_003404606.1.93337 WP_003404606.1.93343 WP_003404606.1.93349 WP_003404606.1.93363 WP_003404606.1.93377 WP_003404606.1.9338 WP_003404606.1.93407 WP_003404606.1.93417 WP_003404606.1.93419 WP_003404606.1.93426 WP_003404606.1.9344 WP_003404606.1.93443 WP_003404606.1.93447 WP_003404606.1.93470 WP_003404606.1.93483 WP_003404606.1.93487 WP_003404606.1.93495 WP_003404606.1.93499 WP_003404606.1.93516 WP_003404606.1.93536 WP_003404606.1.93544 WP_003404606.1.93555 WP_003404606.1.93560 WP_003404606.1.93564 WP_003404606.1.9357 WP_003404606.1.93573 WP_003404606.1.93576 WP_003404606.1.93588 WP_003404606.1.9363 WP_003404606.1.93645 WP_003404606.1.93649 WP_003404606.1.93659 WP_003404606.1.93677 WP_003404606.1.9368 WP_003404606.1.93689 WP_003404606.1.93693 WP_003404606.1.93698 WP_003404606.1.93706 WP_003404606.1.9371 WP_003404606.1.93792 WP_003404606.1.93823 WP_003404606.1.93871 WP_003404606.1.9388 WP_003404606.1.93894 WP_003404606.1.93903 WP_003404606.1.93907 WP_003404606.1.93913 WP_003404606.1.93946 WP_003404606.1.93950 WP_003404606.1.93953 WP_003404606.1.93954 WP_003404606.1.93988 WP_003404606.1.9407 WP_003404606.1.94143 WP_003404606.1.94154 WP_003404606.1.94184 WP_003404606.1.94204 WP_003404606.1.94205 WP_003404606.1.94226 WP_003404606.1.94231 WP_003404606.1.94256 WP_003404606.1.94261 WP_003404606.1.94281 WP_003404606.1.94292 WP_003404606.1.94297 WP_003404606.1.9431 WP_003404606.1.94326 WP_003404606.1.94339 WP_003404606.1.94392 WP_003404606.1.94416 WP_003404606.1.94421 WP_003404606.1.94456 WP_003404606.1.94470 WP_003404606.1.94480 WP_003404606.1.94495 WP_003404606.1.94511 WP_003404606.1.94512 WP_003404606.1.94525 WP_003404606.1.94528 WP_003404606.1.94564 WP_003404606.1.946 WP_003404606.1.94602 WP_003404606.1.94623 WP_003404606.1.94629 WP_003404606.1.9465 WP_003404606.1.94673 WP_003404606.1.94714 WP_003404606.1.94730 WP_003404606.1.94736 WP_003404606.1.94776 WP_003404606.1.9478 WP_003404606.1.94834 WP_003404606.1.94852 WP_003404606.1.94872 WP_003404606.1.9488 WP_003404606.1.94902 WP_003404606.1.94916 WP_003404606.1.94979 WP_003404606.1.94994 WP_003404606.1.94996 WP_003404606.1.94998 WP_003404606.1.95007 WP_003404606.1.95010 WP_003404606.1.95015 WP_003404606.1.95034 WP_003404606.1.95068 WP_003404606.1.95081 WP_003404606.1.95082 WP_003404606.1.9509 WP_003404606.1.95096 WP_003404606.1.95112 WP_003404606.1.95138 WP_003404606.1.9514 WP_003404606.1.95179 WP_003404606.1.95188 WP_003404606.1.95190 WP_003404606.1.95234 WP_003404606.1.95241 WP_003404606.1.95245 WP_003404606.1.95257 WP_003404606.1.95279 WP_003404606.1.9531 WP_003404606.1.95335 WP_003404606.1.95344 WP_003404606.1.9535 WP_003404606.1.95370 WP_003404606.1.95392 WP_003404606.1.95416 WP_003404606.1.95417 WP_003404606.1.95454 WP_003404606.1.95455 WP_003404606.1.95491 WP_003404606.1.95497 WP_003404606.1.95508 WP_003404606.1.95509 WP_003404606.1.95529 WP_003404606.1.95556 WP_003404606.1.95557 WP_003404606.1.95565 WP_003404606.1.95578 WP_003404606.1.95580 WP_003404606.1.95585 WP_003404606.1.95643 WP_003404606.1.95679 WP_003404606.1.95685 WP_003404606.1.957 WP_003404606.1.95724 WP_003404606.1.95727 WP_003404606.1.95730 WP_003404606.1.95735 WP_003404606.1.95758 WP_003404606.1.95772 WP_003404606.1.95797 WP_003404606.1.95839 WP_003404606.1.9585 WP_003404606.1.9590 WP_003404606.1.95902 WP_003404606.1.95908 WP_003404606.1.95924 WP_003404606.1.95926 WP_003404606.1.95953 WP_003404606.1.95958 WP_003404606.1.95964 WP_003404606.1.95973 WP_003404606.1.96006 WP_003404606.1.9602 WP_003404606.1.96036 WP_003404606.1.96062 WP_003404606.1.96065 WP_003404606.1.96098 WP_003404606.1.96146 WP_003404606.1.96166 WP_003404606.1.96171 WP_003404606.1.96182 WP_003404606.1.96204 WP_003404606.1.96230 WP_003404606.1.96235 WP_003404606.1.96242 WP_003404606.1.96245 WP_003404606.1.96254 WP_003404606.1.96259 WP_003404606.1.96286 WP_003404606.1.96313 WP_003404606.1.96318 WP_003404606.1.96345 WP_003404606.1.96360 WP_003404606.1.96373 WP_003404606.1.96456 WP_003404606.1.96486 WP_003404606.1.96560 WP_003404606.1.96569 WP_003404606.1.96573 WP_003404606.1.96575 WP_003404606.1.96576 WP_003404606.1.96611 WP_003404606.1.96621 WP_003404606.1.9667 WP_003404606.1.96681 WP_003404606.1.96726 WP_003404606.1.96733 WP_003404606.1.96742 WP_003404606.1.96754 WP_003404606.1.9678 WP_003404606.1.96832 WP_003404606.1.9685 WP_003404606.1.97008 WP_003404606.1.97009 WP_003404606.1.97056 WP_003404606.1.97084 WP_003404606.1.97087 WP_003404606.1.97094 WP_003404606.1.97096 WP_003404606.1.97099 WP_003404606.1.97108 WP_003404606.1.97113 WP_003404606.1.97122 WP_003404606.1.97127 WP_003404606.1.97129 WP_003404606.1.97136 WP_003404606.1.9716 WP_003404606.1.97176 WP_003404606.1.97222 WP_003404606.1.97223 WP_003404606.1.97237 WP_003404606.1.97242 WP_003404606.1.97283 WP_003404606.1.97296 WP_003404606.1.97321 WP_003404606.1.97325 WP_003404606.1.97330 WP_003404606.1.97366 WP_003404606.1.97376 WP_003404606.1.97380 WP_003404606.1.9739 WP_003404606.1.97462 WP_003404606.1.97517 WP_003404606.1.97519 WP_003404606.1.97535 WP_003404606.1.97540 WP_003404606.1.97545 WP_003404606.1.97546 WP_003404606.1.97550 WP_003404606.1.97568 WP_003404606.1.97577 WP_003404606.1.97584 WP_003404606.1.9759 WP_003404606.1.97591 WP_003404606.1.97596 WP_003404606.1.97609 WP_003404606.1.97618 WP_003404606.1.9763 WP_003404606.1.97669 WP_003404606.1.97673 WP_003404606.1.97700 WP_003404606.1.97701 WP_003404606.1.9773 WP_003404606.1.97730 WP_003404606.1.97740 WP_003404606.1.97751 WP_003404606.1.97754 WP_003404606.1.97797 WP_003404606.1.9782 WP_003404606.1.9784 WP_003404606.1.9790 WP_003404606.1.9795 WP_003404606.1.97951 WP_003404606.1.97958 WP_003404606.1.97966 WP_003404606.1.97979 WP_003404606.1.97995 WP_003404606.1.98018 WP_003404606.1.98034 WP_003404606.1.98052 WP_003404606.1.98071 WP_003404606.1.98072 WP_003404606.1.98113 WP_003404606.1.98114 WP_003404606.1.98128 WP_003404606.1.98181 WP_003404606.1.98188 WP_003404606.1.98189 WP_003404606.1.98213 WP_003404606.1.98225 WP_003404606.1.98291 WP_003404606.1.98335 WP_003404606.1.98350 WP_003404606.1.98395 WP_003404606.1.98412 WP_003404606.1.98441 WP_003404606.1.98443 WP_003404606.1.98462 WP_003404606.1.9848 WP_003404606.1.98482 WP_003404606.1.98486 WP_003404606.1.98488 WP_003404606.1.98503 WP_003404606.1.98516 WP_003404606.1.98524 WP_003404606.1.98536 WP_003404606.1.98541 WP_003404606.1.98566 WP_003404606.1.98576 WP_003404606.1.98590 WP_003404606.1.98594 WP_003404606.1.98599 WP_003404606.1.98629 WP_003404606.1.98645 WP_003404606.1.98646 WP_003404606.1.98649 WP_003404606.1.98656 WP_003404606.1.9867 WP_003404606.1.98674 WP_003404606.1.98697 WP_003404606.1.98701 WP_003404606.1.98739 WP_003404606.1.98749 WP_003404606.1.98765 WP_003404606.1.98770 WP_003404606.1.98777 WP_003404606.1.98778 WP_003404606.1.98802 WP_003404606.1.98838 WP_003404606.1.98850 WP_003404606.1.98906 WP_003404606.1.98935 WP_003404606.1.98948 WP_003404606.1.98953 WP_003404606.1.98984 WP_003404606.1.99000 WP_003404606.1.99023 WP_003404606.1.99030 WP_003404606.1.99037 WP_003404606.1.99055 WP_003404606.1.99062 WP_003404606.1.99086 WP_003404606.1.99115 WP_003404606.1.99117 WP_003404606.1.99161 WP_003404606.1.99176 WP_003404606.1.99205 WP_003404606.1.99211 WP_003404606.1.99216 WP_003404606.1.99222 WP_003404606.1.99251 WP_003404606.1.99269 WP_003404606.1.99294 WP_003404606.1.99312 WP_003404606.1.99315 WP_003404606.1.99316 WP_003404606.1.99322 WP_003404606.1.99328 WP_003404606.1.99365 WP_003404606.1.99368 WP_003404606.1.99379 WP_003404606.1.99396 WP_003404606.1.99402 WP_003404606.1.99404 WP_003404606.1.99419 WP_003404606.1.99438 WP_003404606.1.99460 WP_003404606.1.99468 WP_003404606.1.99473 WP_003404606.1.99513 WP_003404606.1.99529 WP_003404606.1.99548 WP_003404606.1.99572 WP_003404606.1.99575 WP_003404606.1.99578 WP_003404606.1.99605 WP_003404606.1.99609 WP_003404606.1.99617 WP_003404606.1.99635 WP_003404606.1.99650 WP_003404606.1.99672 WP_003404606.1.99701 WP_003404606.1.99711 WP_003404606.1.99716 WP_003404606.1.99740 WP_003404606.1.99745 WP_003404606.1.99749 WP_003404606.1.9976 WP_003404606.1.99798 WP_003404606.1.99817 WP_003404606.1.99832 WP_003404606.1.99847 WP_003404606.1.99852 WP_003404606.1.99886 WP_003404606.1.99897 WP_003404606.1.99899 WP_003404606.1.99915 WP_003404606.1.9993 WP_003404606.1.99982 WP_003404606.1.99991 gi|31792068|ref|NP_854561.1| gi|433625964|ref|YP_007259593.1| gi|506925309|ref|YP_008005759.1| gi|433641001|ref|YP_007286760.1| gi|375297331|ref|YP_005101598.1| gi|494699268|ref|YP_007964750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]