SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197739780|ref|YP_002161094.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197739780|ref|YP_002161094.1|
Domain Number 1 Region: 8-130
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.48e-26
Family MarR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197739780|ref|YP_002161094.1|
Sequence length 148
Comment transcriptional repressor [Mycobacterium tuberculosis str. Haarlem]
Sequence
MGKGAAFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGSAGIDLTMS
ELAARIGVERTTLTRNLEVMRRDGLVRVMAGADARCKRIELTAKGRAALQKAVPLWRGVQ
AEVTASVGDWPRVRRDIANLGQAAEACR
Download sequence
Identical sequences A0A045JAN6 A0A083WDG6 A0A089QN92 A0A0H3L877 A0A0H3MBZ5 A0A0K2HU42 A0A109SLV8 A0A197J273 A0A1R3XX75 A0A1S1BF71 A5U194 F8M558 I6Y5H3 M8CPU9 O53397 R4MF32
gi|253799918|ref|YP_003032919.1| gi|479055006|ref|YP_007350812.1| gi|471336938|ref|YP_007609651.1| gi|148660833|ref|YP_001282356.1| gi|506925496|ref|YP_008005946.1| gi|15608189|ref|NP_215565.1| gi|375297158|ref|YP_005101425.1| gi|449063102|ref|YP_007430185.1| gi|494695454|ref|YP_007960957.1| gi|15840480|ref|NP_335517.1| NP_215565.1.84033 WP_003405595.1.100000 WP_003405595.1.100021 WP_003405595.1.100069 WP_003405595.1.100087 WP_003405595.1.10015 WP_003405595.1.100208 WP_003405595.1.100216 WP_003405595.1.10022 WP_003405595.1.100255 WP_003405595.1.100260 WP_003405595.1.100270 WP_003405595.1.100279 WP_003405595.1.100286 WP_003405595.1.100308 WP_003405595.1.100309 WP_003405595.1.100318 WP_003405595.1.100337 WP_003405595.1.100338 WP_003405595.1.10037 WP_003405595.1.100383 WP_003405595.1.100395 WP_003405595.1.100396 WP_003405595.1.1004 WP_003405595.1.100401 WP_003405595.1.100459 WP_003405595.1.100460 WP_003405595.1.100552 WP_003405595.1.100581 WP_003405595.1.100600 WP_003405595.1.100625 WP_003405595.1.10064 WP_003405595.1.100666 WP_003405595.1.100671 WP_003405595.1.100677 WP_003405595.1.100682 WP_003405595.1.100697 WP_003405595.1.100703 WP_003405595.1.100716 WP_003405595.1.100722 WP_003405595.1.100754 WP_003405595.1.100757 WP_003405595.1.100772 WP_003405595.1.1008 WP_003405595.1.100812 WP_003405595.1.100845 WP_003405595.1.100866 WP_003405595.1.10088 WP_003405595.1.100889 WP_003405595.1.10090 WP_003405595.1.100910 WP_003405595.1.100915 WP_003405595.1.100918 WP_003405595.1.100935 WP_003405595.1.100984 WP_003405595.1.100992 WP_003405595.1.100998 WP_003405595.1.101 WP_003405595.1.101025 WP_003405595.1.101028 WP_003405595.1.10104 WP_003405595.1.101048 WP_003405595.1.101054 WP_003405595.1.101075 WP_003405595.1.101143 WP_003405595.1.101146 WP_003405595.1.10116 WP_003405595.1.10117 WP_003405595.1.101209 WP_003405595.1.10125 WP_003405595.1.101290 WP_003405595.1.101323 WP_003405595.1.101324 WP_003405595.1.101350 WP_003405595.1.101367 WP_003405595.1.101398 WP_003405595.1.101403 WP_003405595.1.101421 WP_003405595.1.10144 WP_003405595.1.101442 WP_003405595.1.10145 WP_003405595.1.101452 WP_003405595.1.101456 WP_003405595.1.101481 WP_003405595.1.101493 WP_003405595.1.101496 WP_003405595.1.101525 WP_003405595.1.101533 WP_003405595.1.101535 WP_003405595.1.101553 WP_003405595.1.101558 WP_003405595.1.10156 WP_003405595.1.101573 WP_003405595.1.101576 WP_003405595.1.10159 WP_003405595.1.101604 WP_003405595.1.101607 WP_003405595.1.101622 WP_003405595.1.101644 WP_003405595.1.101659 WP_003405595.1.101671 WP_003405595.1.101687 WP_003405595.1.101698 WP_003405595.1.10170 WP_003405595.1.101713 WP_003405595.1.101722 WP_003405595.1.101733 WP_003405595.1.101743 WP_003405595.1.101753 WP_003405595.1.101754 WP_003405595.1.101764 WP_003405595.1.101773 WP_003405595.1.101795 WP_003405595.1.101797 WP_003405595.1.101798 WP_003405595.1.101802 WP_003405595.1.101826 WP_003405595.1.101836 WP_003405595.1.101858 WP_003405595.1.101859 WP_003405595.1.101862 WP_003405595.1.101888 WP_003405595.1.101894 WP_003405595.1.101899 WP_003405595.1.1019 WP_003405595.1.101923 WP_003405595.1.101925 WP_003405595.1.10193 WP_003405595.1.101996 WP_003405595.1.102 WP_003405595.1.102008 WP_003405595.1.102017 WP_003405595.1.102053 WP_003405595.1.102055 WP_003405595.1.102063 WP_003405595.1.102099 WP_003405595.1.1021 WP_003405595.1.10211 WP_003405595.1.102119 WP_003405595.1.102121 WP_003405595.1.102143 WP_003405595.1.10216 WP_003405595.1.10224 WP_003405595.1.10253 WP_003405595.1.10262 WP_003405595.1.10272 WP_003405595.1.10277 WP_003405595.1.1033 WP_003405595.1.10350 WP_003405595.1.10362 WP_003405595.1.10366 WP_003405595.1.10376 WP_003405595.1.10396 WP_003405595.1.10410 WP_003405595.1.10414 WP_003405595.1.10421 WP_003405595.1.1044 WP_003405595.1.10440 WP_003405595.1.10445 WP_003405595.1.10471 WP_003405595.1.10472 WP_003405595.1.10489 WP_003405595.1.105 WP_003405595.1.10518 WP_003405595.1.10523 WP_003405595.1.10545 WP_003405595.1.1057 WP_003405595.1.10594 WP_003405595.1.10603 WP_003405595.1.10606 WP_003405595.1.10615 WP_003405595.1.10623 WP_003405595.1.10635 WP_003405595.1.10643 WP_003405595.1.10648 WP_003405595.1.10662 WP_003405595.1.10709 WP_003405595.1.10735 WP_003405595.1.10740 WP_003405595.1.10756 WP_003405595.1.1078 WP_003405595.1.10791 WP_003405595.1.10799 WP_003405595.1.10825 WP_003405595.1.10848 WP_003405595.1.10863 WP_003405595.1.10879 WP_003405595.1.10912 WP_003405595.1.10916 WP_003405595.1.10923 WP_003405595.1.10927 WP_003405595.1.1095 WP_003405595.1.10956 WP_003405595.1.10958 WP_003405595.1.10962 WP_003405595.1.10980 WP_003405595.1.10981 WP_003405595.1.10993 WP_003405595.1.1100 WP_003405595.1.11040 WP_003405595.1.11061 WP_003405595.1.11070 WP_003405595.1.11141 WP_003405595.1.11171 WP_003405595.1.11175 WP_003405595.1.11176 WP_003405595.1.11222 WP_003405595.1.11236 WP_003405595.1.11329 WP_003405595.1.1133 WP_003405595.1.11342 WP_003405595.1.11373 WP_003405595.1.11376 WP_003405595.1.11390 WP_003405595.1.11402 WP_003405595.1.11481 WP_003405595.1.11487 WP_003405595.1.11489 WP_003405595.1.11491 WP_003405595.1.11514 WP_003405595.1.11587 WP_003405595.1.11589 WP_003405595.1.11596 WP_003405595.1.11604 WP_003405595.1.11610 WP_003405595.1.11697 WP_003405595.1.11707 WP_003405595.1.11752 WP_003405595.1.11758 WP_003405595.1.11761 WP_003405595.1.11775 WP_003405595.1.11804 WP_003405595.1.11822 WP_003405595.1.11826 WP_003405595.1.11856 WP_003405595.1.11898 WP_003405595.1.11906 WP_003405595.1.11939 WP_003405595.1.11960 WP_003405595.1.11961 WP_003405595.1.11972 WP_003405595.1.11984 WP_003405595.1.120 WP_003405595.1.12001 WP_003405595.1.12049 WP_003405595.1.12052 WP_003405595.1.12116 WP_003405595.1.12130 WP_003405595.1.12133 WP_003405595.1.12161 WP_003405595.1.12165 WP_003405595.1.12184 WP_003405595.1.12187 WP_003405595.1.12190 WP_003405595.1.12216 WP_003405595.1.12265 WP_003405595.1.12275 WP_003405595.1.12293 WP_003405595.1.12294 WP_003405595.1.123 WP_003405595.1.1231 WP_003405595.1.12314 WP_003405595.1.12327 WP_003405595.1.12338 WP_003405595.1.1236 WP_003405595.1.12371 WP_003405595.1.12372 WP_003405595.1.12389 WP_003405595.1.12406 WP_003405595.1.1241 WP_003405595.1.12421 WP_003405595.1.12424 WP_003405595.1.12446 WP_003405595.1.12464 WP_003405595.1.12479 WP_003405595.1.12519 WP_003405595.1.12523 WP_003405595.1.12526 WP_003405595.1.1255 WP_003405595.1.12550 WP_003405595.1.12551 WP_003405595.1.12563 WP_003405595.1.12611 WP_003405595.1.12669 WP_003405595.1.1267 WP_003405595.1.12672 WP_003405595.1.12692 WP_003405595.1.1271 WP_003405595.1.12710 WP_003405595.1.12768 WP_003405595.1.1279 WP_003405595.1.12794 WP_003405595.1.12801 WP_003405595.1.12804 WP_003405595.1.12841 WP_003405595.1.12854 WP_003405595.1.12871 WP_003405595.1.12901 WP_003405595.1.12941 WP_003405595.1.12947 WP_003405595.1.12957 WP_003405595.1.12972 WP_003405595.1.13028 WP_003405595.1.13043 WP_003405595.1.13086 WP_003405595.1.13087 WP_003405595.1.13090 WP_003405595.1.13096 WP_003405595.1.13163 WP_003405595.1.13175 WP_003405595.1.13183 WP_003405595.1.132 WP_003405595.1.13249 WP_003405595.1.13282 WP_003405595.1.13284 WP_003405595.1.13296 WP_003405595.1.13298 WP_003405595.1.13302 WP_003405595.1.13306 WP_003405595.1.13312 WP_003405595.1.13313 WP_003405595.1.13321 WP_003405595.1.13345 WP_003405595.1.13358 WP_003405595.1.13370 WP_003405595.1.13375 WP_003405595.1.1338 WP_003405595.1.13420 WP_003405595.1.13433 WP_003405595.1.13435 WP_003405595.1.13438 WP_003405595.1.13461 WP_003405595.1.13466 WP_003405595.1.13489 WP_003405595.1.13526 WP_003405595.1.13551 WP_003405595.1.13561 WP_003405595.1.13564 WP_003405595.1.13579 WP_003405595.1.13647 WP_003405595.1.13667 WP_003405595.1.13687 WP_003405595.1.13697 WP_003405595.1.13719 WP_003405595.1.13763 WP_003405595.1.1377 WP_003405595.1.13774 WP_003405595.1.13786 WP_003405595.1.13793 WP_003405595.1.13794 WP_003405595.1.13817 WP_003405595.1.13834 WP_003405595.1.13866 WP_003405595.1.13880 WP_003405595.1.13899 WP_003405595.1.13909 WP_003405595.1.13910 WP_003405595.1.13919 WP_003405595.1.13920 WP_003405595.1.13952 WP_003405595.1.13953 WP_003405595.1.13962 WP_003405595.1.1398 WP_003405595.1.13988 WP_003405595.1.14027 WP_003405595.1.14115 WP_003405595.1.1415 WP_003405595.1.14152 WP_003405595.1.14158 WP_003405595.1.14162 WP_003405595.1.14175 WP_003405595.1.14178 WP_003405595.1.14194 WP_003405595.1.14195 WP_003405595.1.14208 WP_003405595.1.14238 WP_003405595.1.14266 WP_003405595.1.14273 WP_003405595.1.14303 WP_003405595.1.14306 WP_003405595.1.14307 WP_003405595.1.14310 WP_003405595.1.14341 WP_003405595.1.14382 WP_003405595.1.14416 WP_003405595.1.14428 WP_003405595.1.14441 WP_003405595.1.14469 WP_003405595.1.14477 WP_003405595.1.14504 WP_003405595.1.14514 WP_003405595.1.1452 WP_003405595.1.14527 WP_003405595.1.1454 WP_003405595.1.14544 WP_003405595.1.14548 WP_003405595.1.14551 WP_003405595.1.14561 WP_003405595.1.14573 WP_003405595.1.1462 WP_003405595.1.14658 WP_003405595.1.14667 WP_003405595.1.14668 WP_003405595.1.14675 WP_003405595.1.14694 WP_003405595.1.14695 WP_003405595.1.14709 WP_003405595.1.14766 WP_003405595.1.14783 WP_003405595.1.14865 WP_003405595.1.14872 WP_003405595.1.14905 WP_003405595.1.14926 WP_003405595.1.14951 WP_003405595.1.14955 WP_003405595.1.15003 WP_003405595.1.15009 WP_003405595.1.15028 WP_003405595.1.15040 WP_003405595.1.15052 WP_003405595.1.15065 WP_003405595.1.15072 WP_003405595.1.15089 WP_003405595.1.1509 WP_003405595.1.15126 WP_003405595.1.15131 WP_003405595.1.15168 WP_003405595.1.15172 WP_003405595.1.15174 WP_003405595.1.15187 WP_003405595.1.15196 WP_003405595.1.15210 WP_003405595.1.15216 WP_003405595.1.15217 WP_003405595.1.1523 WP_003405595.1.15232 WP_003405595.1.15238 WP_003405595.1.15240 WP_003405595.1.15253 WP_003405595.1.15267 WP_003405595.1.1527 WP_003405595.1.15292 WP_003405595.1.15299 WP_003405595.1.15302 WP_003405595.1.15322 WP_003405595.1.1534 WP_003405595.1.15345 WP_003405595.1.15365 WP_003405595.1.15372 WP_003405595.1.15386 WP_003405595.1.15387 WP_003405595.1.15442 WP_003405595.1.15447 WP_003405595.1.15449 WP_003405595.1.15477 WP_003405595.1.15481 WP_003405595.1.15492 WP_003405595.1.15511 WP_003405595.1.15512 WP_003405595.1.15558 WP_003405595.1.15559 WP_003405595.1.15566 WP_003405595.1.15599 WP_003405595.1.1560 WP_003405595.1.15611 WP_003405595.1.1563 WP_003405595.1.15633 WP_003405595.1.15643 WP_003405595.1.15688 WP_003405595.1.15755 WP_003405595.1.15763 WP_003405595.1.15774 WP_003405595.1.1578 WP_003405595.1.15780 WP_003405595.1.15827 WP_003405595.1.15834 WP_003405595.1.15842 WP_003405595.1.15848 WP_003405595.1.15853 WP_003405595.1.15870 WP_003405595.1.15877 WP_003405595.1.15893 WP_003405595.1.15896 WP_003405595.1.15926 WP_003405595.1.15933 WP_003405595.1.15946 WP_003405595.1.15958 WP_003405595.1.15973 WP_003405595.1.15987 WP_003405595.1.15993 WP_003405595.1.16009 WP_003405595.1.16025 WP_003405595.1.16043 WP_003405595.1.16055 WP_003405595.1.16066 WP_003405595.1.16069 WP_003405595.1.16077 WP_003405595.1.16106 WP_003405595.1.16108 WP_003405595.1.16110 WP_003405595.1.16130 WP_003405595.1.16136 WP_003405595.1.16139 WP_003405595.1.16141 WP_003405595.1.16143 WP_003405595.1.1630 WP_003405595.1.16318 WP_003405595.1.1632 WP_003405595.1.16327 WP_003405595.1.16334 WP_003405595.1.16341 WP_003405595.1.16345 WP_003405595.1.16374 WP_003405595.1.16384 WP_003405595.1.16386 WP_003405595.1.1642 WP_003405595.1.16421 WP_003405595.1.16424 WP_003405595.1.16426 WP_003405595.1.16431 WP_003405595.1.1644 WP_003405595.1.16442 WP_003405595.1.16448 WP_003405595.1.16451 WP_003405595.1.16476 WP_003405595.1.16480 WP_003405595.1.16494 WP_003405595.1.1652 WP_003405595.1.16549 WP_003405595.1.16560 WP_003405595.1.16598 WP_003405595.1.16609 WP_003405595.1.16619 WP_003405595.1.16620 WP_003405595.1.16622 WP_003405595.1.16637 WP_003405595.1.1669 WP_003405595.1.16707 WP_003405595.1.16724 WP_003405595.1.16731 WP_003405595.1.16743 WP_003405595.1.1683 WP_003405595.1.16837 WP_003405595.1.16852 WP_003405595.1.16940 WP_003405595.1.16950 WP_003405595.1.16959 WP_003405595.1.1697 WP_003405595.1.16973 WP_003405595.1.16977 WP_003405595.1.16987 WP_003405595.1.17005 WP_003405595.1.17006 WP_003405595.1.17010 WP_003405595.1.17015 WP_003405595.1.17019 WP_003405595.1.17039 WP_003405595.1.17041 WP_003405595.1.17052 WP_003405595.1.17057 WP_003405595.1.17062 WP_003405595.1.1707 WP_003405595.1.17094 WP_003405595.1.17130 WP_003405595.1.17138 WP_003405595.1.17147 WP_003405595.1.17167 WP_003405595.1.17224 WP_003405595.1.17251 WP_003405595.1.17288 WP_003405595.1.17304 WP_003405595.1.17314 WP_003405595.1.17345 WP_003405595.1.17381 WP_003405595.1.17391 WP_003405595.1.17412 WP_003405595.1.1743 WP_003405595.1.17440 WP_003405595.1.17466 WP_003405595.1.17477 WP_003405595.1.17483 WP_003405595.1.17505 WP_003405595.1.17527 WP_003405595.1.17535 WP_003405595.1.17540 WP_003405595.1.17553 WP_003405595.1.17558 WP_003405595.1.17599 WP_003405595.1.17635 WP_003405595.1.17655 WP_003405595.1.17679 WP_003405595.1.1768 WP_003405595.1.17687 WP_003405595.1.17700 WP_003405595.1.17710 WP_003405595.1.17713 WP_003405595.1.17722 WP_003405595.1.17746 WP_003405595.1.17788 WP_003405595.1.17798 WP_003405595.1.17803 WP_003405595.1.17816 WP_003405595.1.17821 WP_003405595.1.17830 WP_003405595.1.17868 WP_003405595.1.17878 WP_003405595.1.1792 WP_003405595.1.17923 WP_003405595.1.1795 WP_003405595.1.17955 WP_003405595.1.17973 WP_003405595.1.18009 WP_003405595.1.18013 WP_003405595.1.18033 WP_003405595.1.18057 WP_003405595.1.18065 WP_003405595.1.18070 WP_003405595.1.18116 WP_003405595.1.18120 WP_003405595.1.18126 WP_003405595.1.1817 WP_003405595.1.18170 WP_003405595.1.18206 WP_003405595.1.18216 WP_003405595.1.18240 WP_003405595.1.18257 WP_003405595.1.18306 WP_003405595.1.18364 WP_003405595.1.18399 WP_003405595.1.18411 WP_003405595.1.18444 WP_003405595.1.18448 WP_003405595.1.18467 WP_003405595.1.18476 WP_003405595.1.18522 WP_003405595.1.18580 WP_003405595.1.18582 WP_003405595.1.18587 WP_003405595.1.186 WP_003405595.1.18601 WP_003405595.1.18639 WP_003405595.1.18646 WP_003405595.1.18647 WP_003405595.1.1868 WP_003405595.1.18694 WP_003405595.1.18710 WP_003405595.1.18751 WP_003405595.1.18781 WP_003405595.1.18793 WP_003405595.1.18804 WP_003405595.1.18816 WP_003405595.1.18823 WP_003405595.1.18827 WP_003405595.1.18838 WP_003405595.1.18849 WP_003405595.1.18856 WP_003405595.1.18945 WP_003405595.1.1898 WP_003405595.1.19005 WP_003405595.1.19056 WP_003405595.1.19063 WP_003405595.1.19066 WP_003405595.1.19071 WP_003405595.1.19085 WP_003405595.1.19094 WP_003405595.1.19144 WP_003405595.1.19159 WP_003405595.1.19193 WP_003405595.1.19231 WP_003405595.1.19243 WP_003405595.1.19264 WP_003405595.1.19295 WP_003405595.1.19307 WP_003405595.1.19326 WP_003405595.1.1933 WP_003405595.1.19364 WP_003405595.1.19382 WP_003405595.1.19400 WP_003405595.1.19426 WP_003405595.1.19429 WP_003405595.1.19464 WP_003405595.1.19480 WP_003405595.1.19512 WP_003405595.1.19553 WP_003405595.1.19562 WP_003405595.1.19564 WP_003405595.1.19568 WP_003405595.1.19572 WP_003405595.1.19595 WP_003405595.1.19596 WP_003405595.1.19600 WP_003405595.1.19630 WP_003405595.1.1967 WP_003405595.1.19694 WP_003405595.1.1970 WP_003405595.1.19707 WP_003405595.1.19742 WP_003405595.1.19785 WP_003405595.1.19820 WP_003405595.1.19868 WP_003405595.1.19890 WP_003405595.1.19900 WP_003405595.1.19922 WP_003405595.1.19936 WP_003405595.1.19946 WP_003405595.1.19949 WP_003405595.1.19960 WP_003405595.1.19964 WP_003405595.1.20007 WP_003405595.1.20016 WP_003405595.1.20028 WP_003405595.1.2003 WP_003405595.1.20037 WP_003405595.1.20039 WP_003405595.1.20082 WP_003405595.1.20085 WP_003405595.1.20097 WP_003405595.1.20116 WP_003405595.1.20130 WP_003405595.1.20140 WP_003405595.1.20141 WP_003405595.1.20142 WP_003405595.1.20158 WP_003405595.1.20239 WP_003405595.1.20243 WP_003405595.1.20259 WP_003405595.1.20262 WP_003405595.1.20268 WP_003405595.1.20272 WP_003405595.1.20273 WP_003405595.1.20280 WP_003405595.1.20294 WP_003405595.1.20300 WP_003405595.1.20309 WP_003405595.1.20322 WP_003405595.1.2037 WP_003405595.1.20372 WP_003405595.1.20381 WP_003405595.1.204 WP_003405595.1.20427 WP_003405595.1.20432 WP_003405595.1.20457 WP_003405595.1.20459 WP_003405595.1.20460 WP_003405595.1.20542 WP_003405595.1.20578 WP_003405595.1.20608 WP_003405595.1.20624 WP_003405595.1.20628 WP_003405595.1.2066 WP_003405595.1.20707 WP_003405595.1.20722 WP_003405595.1.20729 WP_003405595.1.20742 WP_003405595.1.20751 WP_003405595.1.20776 WP_003405595.1.20843 WP_003405595.1.20850 WP_003405595.1.2086 WP_003405595.1.20868 WP_003405595.1.20876 WP_003405595.1.20897 WP_003405595.1.20898 WP_003405595.1.2090 WP_003405595.1.20911 WP_003405595.1.20916 WP_003405595.1.20921 WP_003405595.1.20926 WP_003405595.1.20927 WP_003405595.1.20951 WP_003405595.1.20970 WP_003405595.1.2104 WP_003405595.1.21127 WP_003405595.1.21135 WP_003405595.1.21173 WP_003405595.1.21187 WP_003405595.1.212 WP_003405595.1.2120 WP_003405595.1.21218 WP_003405595.1.21219 WP_003405595.1.2123 WP_003405595.1.21231 WP_003405595.1.21234 WP_003405595.1.2126 WP_003405595.1.21292 WP_003405595.1.21307 WP_003405595.1.2131 WP_003405595.1.21311 WP_003405595.1.21365 WP_003405595.1.2137 WP_003405595.1.21392 WP_003405595.1.21397 WP_003405595.1.21403 WP_003405595.1.21415 WP_003405595.1.21418 WP_003405595.1.21430 WP_003405595.1.21444 WP_003405595.1.21468 WP_003405595.1.21498 WP_003405595.1.21509 WP_003405595.1.21513 WP_003405595.1.21560 WP_003405595.1.21565 WP_003405595.1.21591 WP_003405595.1.21594 WP_003405595.1.21602 WP_003405595.1.21615 WP_003405595.1.21638 WP_003405595.1.21639 WP_003405595.1.21655 WP_003405595.1.21658 WP_003405595.1.2168 WP_003405595.1.2174 WP_003405595.1.21741 WP_003405595.1.21742 WP_003405595.1.21777 WP_003405595.1.21786 WP_003405595.1.21795 WP_003405595.1.218 WP_003405595.1.21826 WP_003405595.1.21829 WP_003405595.1.21840 WP_003405595.1.21843 WP_003405595.1.21872 WP_003405595.1.21873 WP_003405595.1.2188 WP_003405595.1.21882 WP_003405595.1.21906 WP_003405595.1.21912 WP_003405595.1.2194 WP_003405595.1.21941 WP_003405595.1.21956 WP_003405595.1.21958 WP_003405595.1.21960 WP_003405595.1.21971 WP_003405595.1.21973 WP_003405595.1.21983 WP_003405595.1.22003 WP_003405595.1.22013 WP_003405595.1.22025 WP_003405595.1.22036 WP_003405595.1.22075 WP_003405595.1.22092 WP_003405595.1.2212 WP_003405595.1.22127 WP_003405595.1.22140 WP_003405595.1.22233 WP_003405595.1.22255 WP_003405595.1.22277 WP_003405595.1.22305 WP_003405595.1.22348 WP_003405595.1.22356 WP_003405595.1.22366 WP_003405595.1.2238 WP_003405595.1.22380 WP_003405595.1.22437 WP_003405595.1.22438 WP_003405595.1.22445 WP_003405595.1.22490 WP_003405595.1.22511 WP_003405595.1.22524 WP_003405595.1.2253 WP_003405595.1.22585 WP_003405595.1.22589 WP_003405595.1.22606 WP_003405595.1.22608 WP_003405595.1.22609 WP_003405595.1.22618 WP_003405595.1.2262 WP_003405595.1.22624 WP_003405595.1.22629 WP_003405595.1.22647 WP_003405595.1.22664 WP_003405595.1.22665 WP_003405595.1.22670 WP_003405595.1.22674 WP_003405595.1.22680 WP_003405595.1.22725 WP_003405595.1.22728 WP_003405595.1.22733 WP_003405595.1.22737 WP_003405595.1.2275 WP_003405595.1.22754 WP_003405595.1.22797 WP_003405595.1.22800 WP_003405595.1.22804 WP_003405595.1.22829 WP_003405595.1.22840 WP_003405595.1.22844 WP_003405595.1.22963 WP_003405595.1.22970 WP_003405595.1.22996 WP_003405595.1.22997 WP_003405595.1.22999 WP_003405595.1.23015 WP_003405595.1.23032 WP_003405595.1.231 WP_003405595.1.23101 WP_003405595.1.2312 WP_003405595.1.23140 WP_003405595.1.23153 WP_003405595.1.23171 WP_003405595.1.23199 WP_003405595.1.2320 WP_003405595.1.23204 WP_003405595.1.23216 WP_003405595.1.23229 WP_003405595.1.23233 WP_003405595.1.2326 WP_003405595.1.23261 WP_003405595.1.23272 WP_003405595.1.23289 WP_003405595.1.2329 WP_003405595.1.23308 WP_003405595.1.23316 WP_003405595.1.23321 WP_003405595.1.23325 WP_003405595.1.2339 WP_003405595.1.23406 WP_003405595.1.23438 WP_003405595.1.23445 WP_003405595.1.23447 WP_003405595.1.23452 WP_003405595.1.23461 WP_003405595.1.2349 WP_003405595.1.23496 WP_003405595.1.23497 WP_003405595.1.23506 WP_003405595.1.23530 WP_003405595.1.23539 WP_003405595.1.23546 WP_003405595.1.23551 WP_003405595.1.23573 WP_003405595.1.23583 WP_003405595.1.23588 WP_003405595.1.23628 WP_003405595.1.23677 WP_003405595.1.23683 WP_003405595.1.23692 WP_003405595.1.23694 WP_003405595.1.23699 WP_003405595.1.2371 WP_003405595.1.23807 WP_003405595.1.23825 WP_003405595.1.23832 WP_003405595.1.2384 WP_003405595.1.23843 WP_003405595.1.23863 WP_003405595.1.2387 WP_003405595.1.23894 WP_003405595.1.23993 WP_003405595.1.2400 WP_003405595.1.24007 WP_003405595.1.24008 WP_003405595.1.24046 WP_003405595.1.24057 WP_003405595.1.24062 WP_003405595.1.24113 WP_003405595.1.24119 WP_003405595.1.24128 WP_003405595.1.24140 WP_003405595.1.24176 WP_003405595.1.24190 WP_003405595.1.24202 WP_003405595.1.24244 WP_003405595.1.24261 WP_003405595.1.24284 WP_003405595.1.24294 WP_003405595.1.24357 WP_003405595.1.24396 WP_003405595.1.24414 WP_003405595.1.24423 WP_003405595.1.2443 WP_003405595.1.24446 WP_003405595.1.24461 WP_003405595.1.24500 WP_003405595.1.24507 WP_003405595.1.24509 WP_003405595.1.24529 WP_003405595.1.24553 WP_003405595.1.24599 WP_003405595.1.24629 WP_003405595.1.24638 WP_003405595.1.24648 WP_003405595.1.2466 WP_003405595.1.24767 WP_003405595.1.24824 WP_003405595.1.24831 WP_003405595.1.24840 WP_003405595.1.24848 WP_003405595.1.24857 WP_003405595.1.2487 WP_003405595.1.24893 WP_003405595.1.24907 WP_003405595.1.24933 WP_003405595.1.24956 WP_003405595.1.24958 WP_003405595.1.24985 WP_003405595.1.2499 WP_003405595.1.25004 WP_003405595.1.2505 WP_003405595.1.25051 WP_003405595.1.2507 WP_003405595.1.25096 WP_003405595.1.25103 WP_003405595.1.25129 WP_003405595.1.25171 WP_003405595.1.25184 WP_003405595.1.25247 WP_003405595.1.25252 WP_003405595.1.25278 WP_003405595.1.25283 WP_003405595.1.25309 WP_003405595.1.25313 WP_003405595.1.25338 WP_003405595.1.25342 WP_003405595.1.25343 WP_003405595.1.25367 WP_003405595.1.25393 WP_003405595.1.25406 WP_003405595.1.25435 WP_003405595.1.25437 WP_003405595.1.25445 WP_003405595.1.25455 WP_003405595.1.25473 WP_003405595.1.25504 WP_003405595.1.25513 WP_003405595.1.25542 WP_003405595.1.25579 WP_003405595.1.25594 WP_003405595.1.25606 WP_003405595.1.25645 WP_003405595.1.2566 WP_003405595.1.25673 WP_003405595.1.25674 WP_003405595.1.25693 WP_003405595.1.25699 WP_003405595.1.25727 WP_003405595.1.25736 WP_003405595.1.25738 WP_003405595.1.25756 WP_003405595.1.25759 WP_003405595.1.2580 WP_003405595.1.25813 WP_003405595.1.25853 WP_003405595.1.25854 WP_003405595.1.25874 WP_003405595.1.25885 WP_003405595.1.25892 WP_003405595.1.25906 WP_003405595.1.25914 WP_003405595.1.25916 WP_003405595.1.2594 WP_003405595.1.25954 WP_003405595.1.25965 WP_003405595.1.25972 WP_003405595.1.26017 WP_003405595.1.26032 WP_003405595.1.26038 WP_003405595.1.26072 WP_003405595.1.26089 WP_003405595.1.26097 WP_003405595.1.26098 WP_003405595.1.26108 WP_003405595.1.26109 WP_003405595.1.26118 WP_003405595.1.26126 WP_003405595.1.2614 WP_003405595.1.26168 WP_003405595.1.26182 WP_003405595.1.26190 WP_003405595.1.2620 WP_003405595.1.26234 WP_003405595.1.26243 WP_003405595.1.26265 WP_003405595.1.26267 WP_003405595.1.26292 WP_003405595.1.26310 WP_003405595.1.26328 WP_003405595.1.26349 WP_003405595.1.26366 WP_003405595.1.26374 WP_003405595.1.26407 WP_003405595.1.26412 WP_003405595.1.26454 WP_003405595.1.26464 WP_003405595.1.2653 WP_003405595.1.26560 WP_003405595.1.26571 WP_003405595.1.2659 WP_003405595.1.26597 WP_003405595.1.26603 WP_003405595.1.26629 WP_003405595.1.26651 WP_003405595.1.26702 WP_003405595.1.26707 WP_003405595.1.26710 WP_003405595.1.26719 WP_003405595.1.26737 WP_003405595.1.26738 WP_003405595.1.26745 WP_003405595.1.26756 WP_003405595.1.2676 WP_003405595.1.2677 WP_003405595.1.26779 WP_003405595.1.26780 WP_003405595.1.26798 WP_003405595.1.26854 WP_003405595.1.26868 WP_003405595.1.26876 WP_003405595.1.26888 WP_003405595.1.26914 WP_003405595.1.26945 WP_003405595.1.26959 WP_003405595.1.26969 WP_003405595.1.26984 WP_003405595.1.26992 WP_003405595.1.27004 WP_003405595.1.27017 WP_003405595.1.27045 WP_003405595.1.27074 WP_003405595.1.27075 WP_003405595.1.27128 WP_003405595.1.27130 WP_003405595.1.27139 WP_003405595.1.27152 WP_003405595.1.27162 WP_003405595.1.27164 WP_003405595.1.27193 WP_003405595.1.27235 WP_003405595.1.27254 WP_003405595.1.27278 WP_003405595.1.27343 WP_003405595.1.27352 WP_003405595.1.27369 WP_003405595.1.27391 WP_003405595.1.27398 WP_003405595.1.27402 WP_003405595.1.27410 WP_003405595.1.27411 WP_003405595.1.27449 WP_003405595.1.27460 WP_003405595.1.27463 WP_003405595.1.27492 WP_003405595.1.27528 WP_003405595.1.27541 WP_003405595.1.27576 WP_003405595.1.27582 WP_003405595.1.27596 WP_003405595.1.27607 WP_003405595.1.2766 WP_003405595.1.277 WP_003405595.1.27724 WP_003405595.1.27730 WP_003405595.1.27736 WP_003405595.1.27743 WP_003405595.1.27750 WP_003405595.1.27771 WP_003405595.1.27779 WP_003405595.1.27795 WP_003405595.1.27803 WP_003405595.1.27819 WP_003405595.1.27835 WP_003405595.1.27915 WP_003405595.1.27935 WP_003405595.1.27962 WP_003405595.1.28053 WP_003405595.1.28092 WP_003405595.1.28106 WP_003405595.1.28131 WP_003405595.1.28142 WP_003405595.1.28159 WP_003405595.1.2816 WP_003405595.1.28161 WP_003405595.1.28192 WP_003405595.1.28202 WP_003405595.1.28241 WP_003405595.1.28242 WP_003405595.1.28251 WP_003405595.1.28255 WP_003405595.1.28269 WP_003405595.1.28276 WP_003405595.1.28293 WP_003405595.1.28331 WP_003405595.1.28367 WP_003405595.1.28378 WP_003405595.1.28391 WP_003405595.1.2842 WP_003405595.1.28448 WP_003405595.1.2847 WP_003405595.1.28471 WP_003405595.1.28473 WP_003405595.1.28493 WP_003405595.1.28497 WP_003405595.1.28530 WP_003405595.1.28545 WP_003405595.1.28561 WP_003405595.1.28567 WP_003405595.1.28585 WP_003405595.1.286 WP_003405595.1.28610 WP_003405595.1.28617 WP_003405595.1.28634 WP_003405595.1.28642 WP_003405595.1.28671 WP_003405595.1.28682 WP_003405595.1.28698 WP_003405595.1.28703 WP_003405595.1.28739 WP_003405595.1.28758 WP_003405595.1.28781 WP_003405595.1.28787 WP_003405595.1.28827 WP_003405595.1.28839 WP_003405595.1.28847 WP_003405595.1.28850 WP_003405595.1.28851 WP_003405595.1.28865 WP_003405595.1.28897 WP_003405595.1.28914 WP_003405595.1.28935 WP_003405595.1.28936 WP_003405595.1.28939 WP_003405595.1.28943 WP_003405595.1.28952 WP_003405595.1.28975 WP_003405595.1.2899 WP_003405595.1.28993 WP_003405595.1.29000 WP_003405595.1.2901 WP_003405595.1.29028 WP_003405595.1.29033 WP_003405595.1.29058 WP_003405595.1.29078 WP_003405595.1.29102 WP_003405595.1.29115 WP_003405595.1.2916 WP_003405595.1.29217 WP_003405595.1.29223 WP_003405595.1.29234 WP_003405595.1.29264 WP_003405595.1.29275 WP_003405595.1.29306 WP_003405595.1.29339 WP_003405595.1.29348 WP_003405595.1.29364 WP_003405595.1.29367 WP_003405595.1.2938 WP_003405595.1.29399 WP_003405595.1.29426 WP_003405595.1.2944 WP_003405595.1.29449 WP_003405595.1.29450 WP_003405595.1.29452 WP_003405595.1.2949 WP_003405595.1.29510 WP_003405595.1.29515 WP_003405595.1.29525 WP_003405595.1.2953 WP_003405595.1.29559 WP_003405595.1.29587 WP_003405595.1.2959 WP_003405595.1.29592 WP_003405595.1.29599 WP_003405595.1.29611 WP_003405595.1.29632 WP_003405595.1.29649 WP_003405595.1.2965 WP_003405595.1.29659 WP_003405595.1.2969 WP_003405595.1.29696 WP_003405595.1.29698 WP_003405595.1.29742 WP_003405595.1.29745 WP_003405595.1.29747 WP_003405595.1.29769 WP_003405595.1.29825 WP_003405595.1.29830 WP_003405595.1.29847 WP_003405595.1.29861 WP_003405595.1.29869 WP_003405595.1.29883 WP_003405595.1.29890 WP_003405595.1.299 WP_003405595.1.29931 WP_003405595.1.29960 WP_003405595.1.30014 WP_003405595.1.3004 WP_003405595.1.30040 WP_003405595.1.30043 WP_003405595.1.30074 WP_003405595.1.30097 WP_003405595.1.30101 WP_003405595.1.30106 WP_003405595.1.30114 WP_003405595.1.30126 WP_003405595.1.30131 WP_003405595.1.30138 WP_003405595.1.30139 WP_003405595.1.30145 WP_003405595.1.30211 WP_003405595.1.30224 WP_003405595.1.30235 WP_003405595.1.30237 WP_003405595.1.3027 WP_003405595.1.30279 WP_003405595.1.30282 WP_003405595.1.30283 WP_003405595.1.30288 WP_003405595.1.30291 WP_003405595.1.30363 WP_003405595.1.30374 WP_003405595.1.30404 WP_003405595.1.3043 WP_003405595.1.30433 WP_003405595.1.30438 WP_003405595.1.30462 WP_003405595.1.30464 WP_003405595.1.30468 WP_003405595.1.30500 WP_003405595.1.3057 WP_003405595.1.30574 WP_003405595.1.30628 WP_003405595.1.30641 WP_003405595.1.30642 WP_003405595.1.30661 WP_003405595.1.30669 WP_003405595.1.30683 WP_003405595.1.30699 WP_003405595.1.30709 WP_003405595.1.30713 WP_003405595.1.30716 WP_003405595.1.30719 WP_003405595.1.30730 WP_003405595.1.30732 WP_003405595.1.30736 WP_003405595.1.30745 WP_003405595.1.30760 WP_003405595.1.30791 WP_003405595.1.308 WP_003405595.1.30807 WP_003405595.1.30818 WP_003405595.1.30824 WP_003405595.1.30848 WP_003405595.1.30877 WP_003405595.1.30888 WP_003405595.1.30901 WP_003405595.1.30903 WP_003405595.1.30912 WP_003405595.1.30913 WP_003405595.1.30914 WP_003405595.1.30919 WP_003405595.1.30977 WP_003405595.1.3100 WP_003405595.1.31002 WP_003405595.1.3101 WP_003405595.1.31034 WP_003405595.1.31047 WP_003405595.1.31070 WP_003405595.1.31074 WP_003405595.1.31102 WP_003405595.1.31127 WP_003405595.1.31184 WP_003405595.1.31199 WP_003405595.1.31226 WP_003405595.1.31230 WP_003405595.1.31233 WP_003405595.1.31263 WP_003405595.1.31264 WP_003405595.1.31270 WP_003405595.1.31287 WP_003405595.1.31290 WP_003405595.1.31304 WP_003405595.1.31346 WP_003405595.1.31348 WP_003405595.1.31354 WP_003405595.1.31390 WP_003405595.1.31414 WP_003405595.1.31417 WP_003405595.1.31428 WP_003405595.1.3143 WP_003405595.1.31458 WP_003405595.1.31483 WP_003405595.1.3149 WP_003405595.1.31498 WP_003405595.1.31507 WP_003405595.1.31537 WP_003405595.1.31548 WP_003405595.1.31569 WP_003405595.1.31573 WP_003405595.1.316 WP_003405595.1.31629 WP_003405595.1.31666 WP_003405595.1.31693 WP_003405595.1.31703 WP_003405595.1.31744 WP_003405595.1.31770 WP_003405595.1.31776 WP_003405595.1.31783 WP_003405595.1.318 WP_003405595.1.3184 WP_003405595.1.31840 WP_003405595.1.31880 WP_003405595.1.31911 WP_003405595.1.31930 WP_003405595.1.31932 WP_003405595.1.31955 WP_003405595.1.31991 WP_003405595.1.31995 WP_003405595.1.32004 WP_003405595.1.32039 WP_003405595.1.3204 WP_003405595.1.32045 WP_003405595.1.32071 WP_003405595.1.32098 WP_003405595.1.32132 WP_003405595.1.32157 WP_003405595.1.32164 WP_003405595.1.32179 WP_003405595.1.32297 WP_003405595.1.32317 WP_003405595.1.32383 WP_003405595.1.32400 WP_003405595.1.32403 WP_003405595.1.32416 WP_003405595.1.32421 WP_003405595.1.32433 WP_003405595.1.32461 WP_003405595.1.32482 WP_003405595.1.32503 WP_003405595.1.32556 WP_003405595.1.32562 WP_003405595.1.32569 WP_003405595.1.32592 WP_003405595.1.32620 WP_003405595.1.32647 WP_003405595.1.32653 WP_003405595.1.32654 WP_003405595.1.3268 WP_003405595.1.32695 WP_003405595.1.32706 WP_003405595.1.32716 WP_003405595.1.32738 WP_003405595.1.32752 WP_003405595.1.32780 WP_003405595.1.32781 WP_003405595.1.32793 WP_003405595.1.32799 WP_003405595.1.32822 WP_003405595.1.32833 WP_003405595.1.32862 WP_003405595.1.32880 WP_003405595.1.32897 WP_003405595.1.32909 WP_003405595.1.32935 WP_003405595.1.32974 WP_003405595.1.33007 WP_003405595.1.3302 WP_003405595.1.33028 WP_003405595.1.33035 WP_003405595.1.33044 WP_003405595.1.33054 WP_003405595.1.33082 WP_003405595.1.33141 WP_003405595.1.33148 WP_003405595.1.33155 WP_003405595.1.33168 WP_003405595.1.3321 WP_003405595.1.33215 WP_003405595.1.3325 WP_003405595.1.3327 WP_003405595.1.33278 WP_003405595.1.33288 WP_003405595.1.33305 WP_003405595.1.3331 WP_003405595.1.33319 WP_003405595.1.3333 WP_003405595.1.33393 WP_003405595.1.33403 WP_003405595.1.33452 WP_003405595.1.33467 WP_003405595.1.33477 WP_003405595.1.3349 WP_003405595.1.33519 WP_003405595.1.33542 WP_003405595.1.33601 WP_003405595.1.33602 WP_003405595.1.33633 WP_003405595.1.33646 WP_003405595.1.33673 WP_003405595.1.3369 WP_003405595.1.33705 WP_003405595.1.33762 WP_003405595.1.33783 WP_003405595.1.33789 WP_003405595.1.3383 WP_003405595.1.33832 WP_003405595.1.33839 WP_003405595.1.33848 WP_003405595.1.3387 WP_003405595.1.33886 WP_003405595.1.33895 WP_003405595.1.33906 WP_003405595.1.33912 WP_003405595.1.33954 WP_003405595.1.3399 WP_003405595.1.34042 WP_003405595.1.3405 WP_003405595.1.34055 WP_003405595.1.34056 WP_003405595.1.34065 WP_003405595.1.3408 WP_003405595.1.34090 WP_003405595.1.34109 WP_003405595.1.34111 WP_003405595.1.34131 WP_003405595.1.34152 WP_003405595.1.34153 WP_003405595.1.34163 WP_003405595.1.34181 WP_003405595.1.34197 WP_003405595.1.34198 WP_003405595.1.34215 WP_003405595.1.34219 WP_003405595.1.34255 WP_003405595.1.34260 WP_003405595.1.34275 WP_003405595.1.343 WP_003405595.1.34347 WP_003405595.1.34358 WP_003405595.1.34392 WP_003405595.1.344 WP_003405595.1.34428 WP_003405595.1.3443 WP_003405595.1.34435 WP_003405595.1.34446 WP_003405595.1.34499 WP_003405595.1.34505 WP_003405595.1.34516 WP_003405595.1.34551 WP_003405595.1.34563 WP_003405595.1.34576 WP_003405595.1.34581 WP_003405595.1.34588 WP_003405595.1.34596 WP_003405595.1.34599 WP_003405595.1.34639 WP_003405595.1.34673 WP_003405595.1.34724 WP_003405595.1.34740 WP_003405595.1.34755 WP_003405595.1.34777 WP_003405595.1.34783 WP_003405595.1.34841 WP_003405595.1.34908 WP_003405595.1.34919 WP_003405595.1.3492 WP_003405595.1.34933 WP_003405595.1.34945 WP_003405595.1.34946 WP_003405595.1.34954 WP_003405595.1.34960 WP_003405595.1.34961 WP_003405595.1.34963 WP_003405595.1.34965 WP_003405595.1.34968 WP_003405595.1.35023 WP_003405595.1.35069 WP_003405595.1.35072 WP_003405595.1.35078 WP_003405595.1.35100 WP_003405595.1.35146 WP_003405595.1.35156 WP_003405595.1.35160 WP_003405595.1.35162 WP_003405595.1.35173 WP_003405595.1.35176 WP_003405595.1.3520 WP_003405595.1.35213 WP_003405595.1.35221 WP_003405595.1.35246 WP_003405595.1.35278 WP_003405595.1.35301 WP_003405595.1.35311 WP_003405595.1.35312 WP_003405595.1.35317 WP_003405595.1.35319 WP_003405595.1.35347 WP_003405595.1.35363 WP_003405595.1.35382 WP_003405595.1.35385 WP_003405595.1.35396 WP_003405595.1.35397 WP_003405595.1.35426 WP_003405595.1.35439 WP_003405595.1.35455 WP_003405595.1.3548 WP_003405595.1.35484 WP_003405595.1.35492 WP_003405595.1.3553 WP_003405595.1.35553 WP_003405595.1.35555 WP_003405595.1.35561 WP_003405595.1.35602 WP_003405595.1.35610 WP_003405595.1.35657 WP_003405595.1.35680 WP_003405595.1.35687 WP_003405595.1.35689 WP_003405595.1.35732 WP_003405595.1.35754 WP_003405595.1.35767 WP_003405595.1.35770 WP_003405595.1.35771 WP_003405595.1.35780 WP_003405595.1.35805 WP_003405595.1.35811 WP_003405595.1.35821 WP_003405595.1.3584 WP_003405595.1.35848 WP_003405595.1.35864 WP_003405595.1.35874 WP_003405595.1.35876 WP_003405595.1.35897 WP_003405595.1.35899 WP_003405595.1.35923 WP_003405595.1.3593 WP_003405595.1.35954 WP_003405595.1.36005 WP_003405595.1.36014 WP_003405595.1.36023 WP_003405595.1.36051 WP_003405595.1.36053 WP_003405595.1.36075 WP_003405595.1.36089 WP_003405595.1.36097 WP_003405595.1.36098 WP_003405595.1.36145 WP_003405595.1.36156 WP_003405595.1.36205 WP_003405595.1.36228 WP_003405595.1.36246 WP_003405595.1.36252 WP_003405595.1.36260 WP_003405595.1.36270 WP_003405595.1.36271 WP_003405595.1.36303 WP_003405595.1.36309 WP_003405595.1.36315 WP_003405595.1.36319 WP_003405595.1.36321 WP_003405595.1.36326 WP_003405595.1.3634 WP_003405595.1.36357 WP_003405595.1.3636 WP_003405595.1.36385 WP_003405595.1.36399 WP_003405595.1.36436 WP_003405595.1.36465 WP_003405595.1.36469 WP_003405595.1.36473 WP_003405595.1.36485 WP_003405595.1.36508 WP_003405595.1.36540 WP_003405595.1.36561 WP_003405595.1.36571 WP_003405595.1.36573 WP_003405595.1.36578 WP_003405595.1.36585 WP_003405595.1.36597 WP_003405595.1.36614 WP_003405595.1.36657 WP_003405595.1.36674 WP_003405595.1.36720 WP_003405595.1.36727 WP_003405595.1.36733 WP_003405595.1.36785 WP_003405595.1.36810 WP_003405595.1.36844 WP_003405595.1.36851 WP_003405595.1.36862 WP_003405595.1.36893 WP_003405595.1.36921 WP_003405595.1.36935 WP_003405595.1.36941 WP_003405595.1.3695 WP_003405595.1.36951 WP_003405595.1.36968 WP_003405595.1.3700 WP_003405595.1.37004 WP_003405595.1.37012 WP_003405595.1.37071 WP_003405595.1.37088 WP_003405595.1.37131 WP_003405595.1.37157 WP_003405595.1.37175 WP_003405595.1.37188 WP_003405595.1.37213 WP_003405595.1.37229 WP_003405595.1.3724 WP_003405595.1.37277 WP_003405595.1.37305 WP_003405595.1.37330 WP_003405595.1.37389 WP_003405595.1.37400 WP_003405595.1.37440 WP_003405595.1.37459 WP_003405595.1.37468 WP_003405595.1.37475 WP_003405595.1.37484 WP_003405595.1.37601 WP_003405595.1.37612 WP_003405595.1.37632 WP_003405595.1.37643 WP_003405595.1.37655 WP_003405595.1.37660 WP_003405595.1.37700 WP_003405595.1.37701 WP_003405595.1.37709 WP_003405595.1.37711 WP_003405595.1.37721 WP_003405595.1.37722 WP_003405595.1.37747 WP_003405595.1.37765 WP_003405595.1.37772 WP_003405595.1.37804 WP_003405595.1.37809 WP_003405595.1.37859 WP_003405595.1.37877 WP_003405595.1.37912 WP_003405595.1.37913 WP_003405595.1.37943 WP_003405595.1.37950 WP_003405595.1.37973 WP_003405595.1.37975 WP_003405595.1.37983 WP_003405595.1.38 WP_003405595.1.38002 WP_003405595.1.3802 WP_003405595.1.38039 WP_003405595.1.38040 WP_003405595.1.38067 WP_003405595.1.38068 WP_003405595.1.38135 WP_003405595.1.38138 WP_003405595.1.38144 WP_003405595.1.38158 WP_003405595.1.38159 WP_003405595.1.38210 WP_003405595.1.38233 WP_003405595.1.38240 WP_003405595.1.38299 WP_003405595.1.38332 WP_003405595.1.38347 WP_003405595.1.38354 WP_003405595.1.38380 WP_003405595.1.38384 WP_003405595.1.38389 WP_003405595.1.38398 WP_003405595.1.38402 WP_003405595.1.38418 WP_003405595.1.38421 WP_003405595.1.38466 WP_003405595.1.38477 WP_003405595.1.38483 WP_003405595.1.3849 WP_003405595.1.385 WP_003405595.1.38530 WP_003405595.1.38535 WP_003405595.1.38539 WP_003405595.1.38594 WP_003405595.1.38601 WP_003405595.1.38611 WP_003405595.1.38638 WP_003405595.1.38639 WP_003405595.1.38646 WP_003405595.1.38648 WP_003405595.1.38654 WP_003405595.1.38659 WP_003405595.1.38660 WP_003405595.1.38666 WP_003405595.1.38671 WP_003405595.1.38672 WP_003405595.1.38677 WP_003405595.1.38750 WP_003405595.1.38772 WP_003405595.1.38812 WP_003405595.1.38821 WP_003405595.1.38844 WP_003405595.1.38863 WP_003405595.1.38865 WP_003405595.1.38873 WP_003405595.1.3889 WP_003405595.1.38894 WP_003405595.1.38909 WP_003405595.1.38939 WP_003405595.1.38974 WP_003405595.1.38975 WP_003405595.1.38991 WP_003405595.1.39025 WP_003405595.1.39070 WP_003405595.1.39072 WP_003405595.1.39095 WP_003405595.1.39106 WP_003405595.1.39165 WP_003405595.1.39174 WP_003405595.1.39176 WP_003405595.1.39178 WP_003405595.1.39190 WP_003405595.1.39201 WP_003405595.1.39207 WP_003405595.1.39211 WP_003405595.1.39236 WP_003405595.1.39239 WP_003405595.1.39252 WP_003405595.1.39288 WP_003405595.1.39295 WP_003405595.1.39306 WP_003405595.1.39359 WP_003405595.1.39364 WP_003405595.1.39400 WP_003405595.1.39447 WP_003405595.1.3945 WP_003405595.1.39450 WP_003405595.1.39455 WP_003405595.1.3949 WP_003405595.1.39521 WP_003405595.1.39560 WP_003405595.1.39592 WP_003405595.1.39593 WP_003405595.1.396 WP_003405595.1.3960 WP_003405595.1.39616 WP_003405595.1.39654 WP_003405595.1.39657 WP_003405595.1.39661 WP_003405595.1.39674 WP_003405595.1.39678 WP_003405595.1.3968 WP_003405595.1.39694 WP_003405595.1.3971 WP_003405595.1.39718 WP_003405595.1.39728 WP_003405595.1.39739 WP_003405595.1.39748 WP_003405595.1.39751 WP_003405595.1.39759 WP_003405595.1.39801 WP_003405595.1.39804 WP_003405595.1.39848 WP_003405595.1.39877 WP_003405595.1.39925 WP_003405595.1.3994 WP_003405595.1.39959 WP_003405595.1.3996 WP_003405595.1.39960 WP_003405595.1.3997 WP_003405595.1.39980 WP_003405595.1.40000 WP_003405595.1.40028 WP_003405595.1.40029 WP_003405595.1.4003 WP_003405595.1.40094 WP_003405595.1.40096 WP_003405595.1.40150 WP_003405595.1.40156 WP_003405595.1.40174 WP_003405595.1.40186 WP_003405595.1.40276 WP_003405595.1.40277 WP_003405595.1.40323 WP_003405595.1.40336 WP_003405595.1.40353 WP_003405595.1.4036 WP_003405595.1.40372 WP_003405595.1.40402 WP_003405595.1.40413 WP_003405595.1.40440 WP_003405595.1.40446 WP_003405595.1.40451 WP_003405595.1.40455 WP_003405595.1.40523 WP_003405595.1.40543 WP_003405595.1.40641 WP_003405595.1.40646 WP_003405595.1.40651 WP_003405595.1.40653 WP_003405595.1.4067 WP_003405595.1.40705 WP_003405595.1.40723 WP_003405595.1.40731 WP_003405595.1.40735 WP_003405595.1.40795 WP_003405595.1.40799 WP_003405595.1.40852 WP_003405595.1.40876 WP_003405595.1.40881 WP_003405595.1.40922 WP_003405595.1.40948 WP_003405595.1.4095 WP_003405595.1.40956 WP_003405595.1.40957 WP_003405595.1.40964 WP_003405595.1.4097 WP_003405595.1.410 WP_003405595.1.41000 WP_003405595.1.41055 WP_003405595.1.41108 WP_003405595.1.41123 WP_003405595.1.41177 WP_003405595.1.41202 WP_003405595.1.41219 WP_003405595.1.41231 WP_003405595.1.41249 WP_003405595.1.4127 WP_003405595.1.41296 WP_003405595.1.41355 WP_003405595.1.41376 WP_003405595.1.41430 WP_003405595.1.41447 WP_003405595.1.41469 WP_003405595.1.41504 WP_003405595.1.41553 WP_003405595.1.41564 WP_003405595.1.41583 WP_003405595.1.41616 WP_003405595.1.41632 WP_003405595.1.41635 WP_003405595.1.41636 WP_003405595.1.41648 WP_003405595.1.41660 WP_003405595.1.41685 WP_003405595.1.41695 WP_003405595.1.41704 WP_003405595.1.4171 WP_003405595.1.41719 WP_003405595.1.41733 WP_003405595.1.41744 WP_003405595.1.41774 WP_003405595.1.41791 WP_003405595.1.41803 WP_003405595.1.41820 WP_003405595.1.41828 WP_003405595.1.41829 WP_003405595.1.41860 WP_003405595.1.41912 WP_003405595.1.41921 WP_003405595.1.41933 WP_003405595.1.41944 WP_003405595.1.42075 WP_003405595.1.42078 WP_003405595.1.42094 WP_003405595.1.42112 WP_003405595.1.4212 WP_003405595.1.42122 WP_003405595.1.42134 WP_003405595.1.42183 WP_003405595.1.42188 WP_003405595.1.42201 WP_003405595.1.42202 WP_003405595.1.42208 WP_003405595.1.42247 WP_003405595.1.42255 WP_003405595.1.42273 WP_003405595.1.42278 WP_003405595.1.42304 WP_003405595.1.42309 WP_003405595.1.42370 WP_003405595.1.42385 WP_003405595.1.42400 WP_003405595.1.42409 WP_003405595.1.42414 WP_003405595.1.42417 WP_003405595.1.42430 WP_003405595.1.42461 WP_003405595.1.42465 WP_003405595.1.42467 WP_003405595.1.42473 WP_003405595.1.42474 WP_003405595.1.4248 WP_003405595.1.42494 WP_003405595.1.42519 WP_003405595.1.42524 WP_003405595.1.42534 WP_003405595.1.4255 WP_003405595.1.42562 WP_003405595.1.42568 WP_003405595.1.42570 WP_003405595.1.42618 WP_003405595.1.42660 WP_003405595.1.42695 WP_003405595.1.42704 WP_003405595.1.42705 WP_003405595.1.42722 WP_003405595.1.42777 WP_003405595.1.42782 WP_003405595.1.42835 WP_003405595.1.42839 WP_003405595.1.42842 WP_003405595.1.42905 WP_003405595.1.42916 WP_003405595.1.42930 WP_003405595.1.42971 WP_003405595.1.43005 WP_003405595.1.43009 WP_003405595.1.43053 WP_003405595.1.43082 WP_003405595.1.43087 WP_003405595.1.43098 WP_003405595.1.43208 WP_003405595.1.43236 WP_003405595.1.43246 WP_003405595.1.43255 WP_003405595.1.43266 WP_003405595.1.43269 WP_003405595.1.43273 WP_003405595.1.43296 WP_003405595.1.43306 WP_003405595.1.4335 WP_003405595.1.43368 WP_003405595.1.43395 WP_003405595.1.43457 WP_003405595.1.43462 WP_003405595.1.43478 WP_003405595.1.43484 WP_003405595.1.43557 WP_003405595.1.43578 WP_003405595.1.43588 WP_003405595.1.43643 WP_003405595.1.43664 WP_003405595.1.43684 WP_003405595.1.43686 WP_003405595.1.43706 WP_003405595.1.43716 WP_003405595.1.4377 WP_003405595.1.43781 WP_003405595.1.43794 WP_003405595.1.43815 WP_003405595.1.43846 WP_003405595.1.43861 WP_003405595.1.43863 WP_003405595.1.43866 WP_003405595.1.43885 WP_003405595.1.43897 WP_003405595.1.4390 WP_003405595.1.43902 WP_003405595.1.43921 WP_003405595.1.43936 WP_003405595.1.43937 WP_003405595.1.43960 WP_003405595.1.43965 WP_003405595.1.4399 WP_003405595.1.43993 WP_003405595.1.43996 WP_003405595.1.44 WP_003405595.1.44001 WP_003405595.1.44008 WP_003405595.1.44016 WP_003405595.1.44033 WP_003405595.1.44037 WP_003405595.1.44041 WP_003405595.1.44070 WP_003405595.1.44071 WP_003405595.1.44076 WP_003405595.1.44104 WP_003405595.1.44111 WP_003405595.1.44124 WP_003405595.1.44169 WP_003405595.1.44237 WP_003405595.1.44277 WP_003405595.1.44279 WP_003405595.1.44336 WP_003405595.1.44355 WP_003405595.1.44358 WP_003405595.1.4438 WP_003405595.1.44392 WP_003405595.1.4441 WP_003405595.1.44415 WP_003405595.1.44464 WP_003405595.1.44466 WP_003405595.1.44489 WP_003405595.1.44492 WP_003405595.1.44494 WP_003405595.1.44500 WP_003405595.1.44519 WP_003405595.1.44526 WP_003405595.1.44532 WP_003405595.1.44534 WP_003405595.1.44562 WP_003405595.1.44589 WP_003405595.1.44597 WP_003405595.1.44600 WP_003405595.1.44602 WP_003405595.1.44615 WP_003405595.1.4464 WP_003405595.1.44651 WP_003405595.1.44659 WP_003405595.1.44665 WP_003405595.1.44694 WP_003405595.1.44700 WP_003405595.1.44713 WP_003405595.1.44735 WP_003405595.1.44740 WP_003405595.1.44757 WP_003405595.1.4476 WP_003405595.1.44761 WP_003405595.1.44767 WP_003405595.1.44776 WP_003405595.1.44779 WP_003405595.1.44786 WP_003405595.1.44808 WP_003405595.1.44864 WP_003405595.1.44901 WP_003405595.1.44908 WP_003405595.1.44913 WP_003405595.1.4492 WP_003405595.1.44939 WP_003405595.1.44979 WP_003405595.1.44981 WP_003405595.1.45002 WP_003405595.1.45011 WP_003405595.1.4504 WP_003405595.1.45066 WP_003405595.1.45081 WP_003405595.1.45113 WP_003405595.1.45129 WP_003405595.1.45135 WP_003405595.1.45147 WP_003405595.1.45168 WP_003405595.1.4517 WP_003405595.1.45181 WP_003405595.1.45192 WP_003405595.1.45200 WP_003405595.1.45205 WP_003405595.1.45211 WP_003405595.1.45249 WP_003405595.1.4526 WP_003405595.1.45286 WP_003405595.1.45326 WP_003405595.1.45347 WP_003405595.1.45390 WP_003405595.1.454 WP_003405595.1.45407 WP_003405595.1.45451 WP_003405595.1.45453 WP_003405595.1.45460 WP_003405595.1.45463 WP_003405595.1.45470 WP_003405595.1.45474 WP_003405595.1.45491 WP_003405595.1.45510 WP_003405595.1.45563 WP_003405595.1.45584 WP_003405595.1.45619 WP_003405595.1.45626 WP_003405595.1.45666 WP_003405595.1.45697 WP_003405595.1.4571 WP_003405595.1.45731 WP_003405595.1.45743 WP_003405595.1.45765 WP_003405595.1.45776 WP_003405595.1.45783 WP_003405595.1.45805 WP_003405595.1.45815 WP_003405595.1.45849 WP_003405595.1.45867 WP_003405595.1.45884 WP_003405595.1.4590 WP_003405595.1.45923 WP_003405595.1.45926 WP_003405595.1.45989 WP_003405595.1.45992 WP_003405595.1.46025 WP_003405595.1.46083 WP_003405595.1.46090 WP_003405595.1.46092 WP_003405595.1.46100 WP_003405595.1.46101 WP_003405595.1.46103 WP_003405595.1.46107 WP_003405595.1.46127 WP_003405595.1.46128 WP_003405595.1.46129 WP_003405595.1.46141 WP_003405595.1.46150 WP_003405595.1.46201 WP_003405595.1.46226 WP_003405595.1.4624 WP_003405595.1.46253 WP_003405595.1.46268 WP_003405595.1.46285 WP_003405595.1.46300 WP_003405595.1.46313 WP_003405595.1.46336 WP_003405595.1.46365 WP_003405595.1.46370 WP_003405595.1.46381 WP_003405595.1.46402 WP_003405595.1.46411 WP_003405595.1.4644 WP_003405595.1.46453 WP_003405595.1.46463 WP_003405595.1.46478 WP_003405595.1.46492 WP_003405595.1.46521 WP_003405595.1.4653 WP_003405595.1.46532 WP_003405595.1.46539 WP_003405595.1.46568 WP_003405595.1.46585 WP_003405595.1.46609 WP_003405595.1.46613 WP_003405595.1.46625 WP_003405595.1.46642 WP_003405595.1.46647 WP_003405595.1.46674 WP_003405595.1.46724 WP_003405595.1.46758 WP_003405595.1.46773 WP_003405595.1.46777 WP_003405595.1.46786 WP_003405595.1.46792 WP_003405595.1.46847 WP_003405595.1.46851 WP_003405595.1.4687 WP_003405595.1.46897 WP_003405595.1.46936 WP_003405595.1.46980 WP_003405595.1.47011 WP_003405595.1.47012 WP_003405595.1.47066 WP_003405595.1.47077 WP_003405595.1.47083 WP_003405595.1.47106 WP_003405595.1.47142 WP_003405595.1.47147 WP_003405595.1.47166 WP_003405595.1.47178 WP_003405595.1.47179 WP_003405595.1.47194 WP_003405595.1.47207 WP_003405595.1.47210 WP_003405595.1.47261 WP_003405595.1.47262 WP_003405595.1.47402 WP_003405595.1.47423 WP_003405595.1.47467 WP_003405595.1.47502 WP_003405595.1.4751 WP_003405595.1.47511 WP_003405595.1.47537 WP_003405595.1.47540 WP_003405595.1.47568 WP_003405595.1.47572 WP_003405595.1.47588 WP_003405595.1.47636 WP_003405595.1.4764 WP_003405595.1.47653 WP_003405595.1.47679 WP_003405595.1.47681 WP_003405595.1.47690 WP_003405595.1.4771 WP_003405595.1.47717 WP_003405595.1.47743 WP_003405595.1.47754 WP_003405595.1.47773 WP_003405595.1.47776 WP_003405595.1.47780 WP_003405595.1.47805 WP_003405595.1.47832 WP_003405595.1.47847 WP_003405595.1.47858 WP_003405595.1.47861 WP_003405595.1.47868 WP_003405595.1.47893 WP_003405595.1.47899 WP_003405595.1.479 WP_003405595.1.47912 WP_003405595.1.47913 WP_003405595.1.47926 WP_003405595.1.4794 WP_003405595.1.47943 WP_003405595.1.47944 WP_003405595.1.47959 WP_003405595.1.47974 WP_003405595.1.48004 WP_003405595.1.48039 WP_003405595.1.48050 WP_003405595.1.48084 WP_003405595.1.48097 WP_003405595.1.48101 WP_003405595.1.48109 WP_003405595.1.4813 WP_003405595.1.48130 WP_003405595.1.48135 WP_003405595.1.48143 WP_003405595.1.48152 WP_003405595.1.48155 WP_003405595.1.48170 WP_003405595.1.48173 WP_003405595.1.48177 WP_003405595.1.48185 WP_003405595.1.48204 WP_003405595.1.48219 WP_003405595.1.4823 WP_003405595.1.48240 WP_003405595.1.48256 WP_003405595.1.48264 WP_003405595.1.48287 WP_003405595.1.48330 WP_003405595.1.48333 WP_003405595.1.48348 WP_003405595.1.48354 WP_003405595.1.48372 WP_003405595.1.48383 WP_003405595.1.48388 WP_003405595.1.48419 WP_003405595.1.48423 WP_003405595.1.48443 WP_003405595.1.48450 WP_003405595.1.48462 WP_003405595.1.48543 WP_003405595.1.48550 WP_003405595.1.48605 WP_003405595.1.48618 WP_003405595.1.4863 WP_003405595.1.48648 WP_003405595.1.48658 WP_003405595.1.48666 WP_003405595.1.48687 WP_003405595.1.48779 WP_003405595.1.4878 WP_003405595.1.48798 WP_003405595.1.48802 WP_003405595.1.48826 WP_003405595.1.48831 WP_003405595.1.48843 WP_003405595.1.48857 WP_003405595.1.4890 WP_003405595.1.48946 WP_003405595.1.48979 WP_003405595.1.49017 WP_003405595.1.49048 WP_003405595.1.49059 WP_003405595.1.4906 WP_003405595.1.4907 WP_003405595.1.49103 WP_003405595.1.49110 WP_003405595.1.49111 WP_003405595.1.49112 WP_003405595.1.4919 WP_003405595.1.49251 WP_003405595.1.49254 WP_003405595.1.49263 WP_003405595.1.49291 WP_003405595.1.49296 WP_003405595.1.49335 WP_003405595.1.49337 WP_003405595.1.49419 WP_003405595.1.49426 WP_003405595.1.49437 WP_003405595.1.49439 WP_003405595.1.49474 WP_003405595.1.49506 WP_003405595.1.49516 WP_003405595.1.49523 WP_003405595.1.49526 WP_003405595.1.49532 WP_003405595.1.49588 WP_003405595.1.4959 WP_003405595.1.49678 WP_003405595.1.49687 WP_003405595.1.49699 WP_003405595.1.49709 WP_003405595.1.4971 WP_003405595.1.4972 WP_003405595.1.49736 WP_003405595.1.49746 WP_003405595.1.49764 WP_003405595.1.49773 WP_003405595.1.49796 WP_003405595.1.49814 WP_003405595.1.49815 WP_003405595.1.49816 WP_003405595.1.49839 WP_003405595.1.49857 WP_003405595.1.49878 WP_003405595.1.49880 WP_003405595.1.49944 WP_003405595.1.4999 WP_003405595.1.49990 WP_003405595.1.50068 WP_003405595.1.50077 WP_003405595.1.5008 WP_003405595.1.50081 WP_003405595.1.50122 WP_003405595.1.50126 WP_003405595.1.50149 WP_003405595.1.50162 WP_003405595.1.5018 WP_003405595.1.50194 WP_003405595.1.50218 WP_003405595.1.50235 WP_003405595.1.50249 WP_003405595.1.50265 WP_003405595.1.50271 WP_003405595.1.50324 WP_003405595.1.50347 WP_003405595.1.50372 WP_003405595.1.50398 WP_003405595.1.50407 WP_003405595.1.50444 WP_003405595.1.50466 WP_003405595.1.50472 WP_003405595.1.5048 WP_003405595.1.50498 WP_003405595.1.5050 WP_003405595.1.50540 WP_003405595.1.50554 WP_003405595.1.50557 WP_003405595.1.50601 WP_003405595.1.50610 WP_003405595.1.50632 WP_003405595.1.50633 WP_003405595.1.50642 WP_003405595.1.50655 WP_003405595.1.50659 WP_003405595.1.50683 WP_003405595.1.50689 WP_003405595.1.50692 WP_003405595.1.50714 WP_003405595.1.50729 WP_003405595.1.50756 WP_003405595.1.50784 WP_003405595.1.50794 WP_003405595.1.50841 WP_003405595.1.50860 WP_003405595.1.50868 WP_003405595.1.50877 WP_003405595.1.5096 WP_003405595.1.50981 WP_003405595.1.50987 WP_003405595.1.51003 WP_003405595.1.51009 WP_003405595.1.51037 WP_003405595.1.51074 WP_003405595.1.51082 WP_003405595.1.51101 WP_003405595.1.51116 WP_003405595.1.51149 WP_003405595.1.51156 WP_003405595.1.51157 WP_003405595.1.51213 WP_003405595.1.51232 WP_003405595.1.51239 WP_003405595.1.51247 WP_003405595.1.51266 WP_003405595.1.51279 WP_003405595.1.51291 WP_003405595.1.51294 WP_003405595.1.51301 WP_003405595.1.51329 WP_003405595.1.51391 WP_003405595.1.51422 WP_003405595.1.51445 WP_003405595.1.51455 WP_003405595.1.51466 WP_003405595.1.51468 WP_003405595.1.51478 WP_003405595.1.51497 WP_003405595.1.51520 WP_003405595.1.51593 WP_003405595.1.51628 WP_003405595.1.5164 WP_003405595.1.51647 WP_003405595.1.51660 WP_003405595.1.51696 WP_003405595.1.51721 WP_003405595.1.51788 WP_003405595.1.51795 WP_003405595.1.51801 WP_003405595.1.51817 WP_003405595.1.51819 WP_003405595.1.51854 WP_003405595.1.51923 WP_003405595.1.51942 WP_003405595.1.51948 WP_003405595.1.51963 WP_003405595.1.51969 WP_003405595.1.52000 WP_003405595.1.52001 WP_003405595.1.52003 WP_003405595.1.52006 WP_003405595.1.52036 WP_003405595.1.52038 WP_003405595.1.52046 WP_003405595.1.52059 WP_003405595.1.52069 WP_003405595.1.52082 WP_003405595.1.52102 WP_003405595.1.52106 WP_003405595.1.52166 WP_003405595.1.52168 WP_003405595.1.52173 WP_003405595.1.52178 WP_003405595.1.52206 WP_003405595.1.52216 WP_003405595.1.52238 WP_003405595.1.52241 WP_003405595.1.52280 WP_003405595.1.52385 WP_003405595.1.52390 WP_003405595.1.524 WP_003405595.1.52460 WP_003405595.1.52485 WP_003405595.1.52486 WP_003405595.1.52495 WP_003405595.1.52504 WP_003405595.1.52522 WP_003405595.1.52531 WP_003405595.1.52533 WP_003405595.1.52545 WP_003405595.1.52553 WP_003405595.1.52563 WP_003405595.1.52564 WP_003405595.1.52574 WP_003405595.1.52641 WP_003405595.1.52673 WP_003405595.1.52674 WP_003405595.1.52708 WP_003405595.1.52713 WP_003405595.1.52761 WP_003405595.1.52778 WP_003405595.1.52791 WP_003405595.1.52797 WP_003405595.1.52818 WP_003405595.1.52872 WP_003405595.1.52873 WP_003405595.1.52891 WP_003405595.1.52892 WP_003405595.1.52909 WP_003405595.1.52970 WP_003405595.1.52998 WP_003405595.1.53053 WP_003405595.1.53056 WP_003405595.1.5306 WP_003405595.1.53088 WP_003405595.1.5309 WP_003405595.1.531 WP_003405595.1.53117 WP_003405595.1.53118 WP_003405595.1.53142 WP_003405595.1.53143 WP_003405595.1.53157 WP_003405595.1.53200 WP_003405595.1.53204 WP_003405595.1.53213 WP_003405595.1.53217 WP_003405595.1.53226 WP_003405595.1.53229 WP_003405595.1.53230 WP_003405595.1.53237 WP_003405595.1.53254 WP_003405595.1.53257 WP_003405595.1.5327 WP_003405595.1.53276 WP_003405595.1.53278 WP_003405595.1.533 WP_003405595.1.53302 WP_003405595.1.53306 WP_003405595.1.5334 WP_003405595.1.5335 WP_003405595.1.53353 WP_003405595.1.53381 WP_003405595.1.53413 WP_003405595.1.53458 WP_003405595.1.53460 WP_003405595.1.53480 WP_003405595.1.53517 WP_003405595.1.53522 WP_003405595.1.53525 WP_003405595.1.53526 WP_003405595.1.53553 WP_003405595.1.53606 WP_003405595.1.53609 WP_003405595.1.53628 WP_003405595.1.53643 WP_003405595.1.53667 WP_003405595.1.53679 WP_003405595.1.53715 WP_003405595.1.53730 WP_003405595.1.53742 WP_003405595.1.53743 WP_003405595.1.53754 WP_003405595.1.53775 WP_003405595.1.53787 WP_003405595.1.53803 WP_003405595.1.53818 WP_003405595.1.53822 WP_003405595.1.53853 WP_003405595.1.53865 WP_003405595.1.53888 WP_003405595.1.53900 WP_003405595.1.53912 WP_003405595.1.53914 WP_003405595.1.53952 WP_003405595.1.5398 WP_003405595.1.5408 WP_003405595.1.54089 WP_003405595.1.54093 WP_003405595.1.54099 WP_003405595.1.54112 WP_003405595.1.54125 WP_003405595.1.54141 WP_003405595.1.54162 WP_003405595.1.54179 WP_003405595.1.54206 WP_003405595.1.54218 WP_003405595.1.54225 WP_003405595.1.54227 WP_003405595.1.54232 WP_003405595.1.54245 WP_003405595.1.54247 WP_003405595.1.54260 WP_003405595.1.54275 WP_003405595.1.54280 WP_003405595.1.5429 WP_003405595.1.54294 WP_003405595.1.54314 WP_003405595.1.54347 WP_003405595.1.54351 WP_003405595.1.54370 WP_003405595.1.54428 WP_003405595.1.54449 WP_003405595.1.54494 WP_003405595.1.54502 WP_003405595.1.54514 WP_003405595.1.54519 WP_003405595.1.5452 WP_003405595.1.54531 WP_003405595.1.54537 WP_003405595.1.54553 WP_003405595.1.54555 WP_003405595.1.54575 WP_003405595.1.54633 WP_003405595.1.54686 WP_003405595.1.54687 WP_003405595.1.54705 WP_003405595.1.54730 WP_003405595.1.54732 WP_003405595.1.5475 WP_003405595.1.54797 WP_003405595.1.54836 WP_003405595.1.54838 WP_003405595.1.54860 WP_003405595.1.54888 WP_003405595.1.54897 WP_003405595.1.54905 WP_003405595.1.54909 WP_003405595.1.54937 WP_003405595.1.54939 WP_003405595.1.54944 WP_003405595.1.54945 WP_003405595.1.54953 WP_003405595.1.54964 WP_003405595.1.55015 WP_003405595.1.55022 WP_003405595.1.55023 WP_003405595.1.55051 WP_003405595.1.55088 WP_003405595.1.55106 WP_003405595.1.55126 WP_003405595.1.55128 WP_003405595.1.55140 WP_003405595.1.55150 WP_003405595.1.55210 WP_003405595.1.55227 WP_003405595.1.55248 WP_003405595.1.55257 WP_003405595.1.55258 WP_003405595.1.55267 WP_003405595.1.55279 WP_003405595.1.55307 WP_003405595.1.55326 WP_003405595.1.55328 WP_003405595.1.5533 WP_003405595.1.55345 WP_003405595.1.55396 WP_003405595.1.55398 WP_003405595.1.55441 WP_003405595.1.55459 WP_003405595.1.55504 WP_003405595.1.55578 WP_003405595.1.55626 WP_003405595.1.55641 WP_003405595.1.5569 WP_003405595.1.55723 WP_003405595.1.55735 WP_003405595.1.5574 WP_003405595.1.55772 WP_003405595.1.55802 WP_003405595.1.55807 WP_003405595.1.55819 WP_003405595.1.55821 WP_003405595.1.5583 WP_003405595.1.55849 WP_003405595.1.55856 WP_003405595.1.55860 WP_003405595.1.55882 WP_003405595.1.55883 WP_003405595.1.55894 WP_003405595.1.55902 WP_003405595.1.55908 WP_003405595.1.55909 WP_003405595.1.5591 WP_003405595.1.55961 WP_003405595.1.55977 WP_003405595.1.55983 WP_003405595.1.56028 WP_003405595.1.56057 WP_003405595.1.56060 WP_003405595.1.56107 WP_003405595.1.56132 WP_003405595.1.56163 WP_003405595.1.56167 WP_003405595.1.56178 WP_003405595.1.56287 WP_003405595.1.56292 WP_003405595.1.56327 WP_003405595.1.56341 WP_003405595.1.56359 WP_003405595.1.56365 WP_003405595.1.56394 WP_003405595.1.56443 WP_003405595.1.56473 WP_003405595.1.56478 WP_003405595.1.56500 WP_003405595.1.56517 WP_003405595.1.56534 WP_003405595.1.5656 WP_003405595.1.56577 WP_003405595.1.56593 WP_003405595.1.56625 WP_003405595.1.56637 WP_003405595.1.56670 WP_003405595.1.56697 WP_003405595.1.567 WP_003405595.1.56701 WP_003405595.1.56709 WP_003405595.1.56729 WP_003405595.1.56743 WP_003405595.1.56755 WP_003405595.1.56764 WP_003405595.1.56769 WP_003405595.1.56770 WP_003405595.1.56795 WP_003405595.1.5681 WP_003405595.1.56827 WP_003405595.1.56839 WP_003405595.1.56863 WP_003405595.1.56868 WP_003405595.1.56869 WP_003405595.1.56915 WP_003405595.1.56926 WP_003405595.1.56961 WP_003405595.1.56971 WP_003405595.1.56972 WP_003405595.1.57023 WP_003405595.1.57035 WP_003405595.1.57077 WP_003405595.1.57087 WP_003405595.1.57094 WP_003405595.1.57134 WP_003405595.1.57151 WP_003405595.1.57169 WP_003405595.1.57208 WP_003405595.1.57212 WP_003405595.1.57230 WP_003405595.1.5724 WP_003405595.1.5725 WP_003405595.1.5727 WP_003405595.1.57273 WP_003405595.1.573 WP_003405595.1.57314 WP_003405595.1.57326 WP_003405595.1.57328 WP_003405595.1.57331 WP_003405595.1.57340 WP_003405595.1.57351 WP_003405595.1.57352 WP_003405595.1.57380 WP_003405595.1.57430 WP_003405595.1.5744 WP_003405595.1.57440 WP_003405595.1.5745 WP_003405595.1.57461 WP_003405595.1.57469 WP_003405595.1.57489 WP_003405595.1.575 WP_003405595.1.57509 WP_003405595.1.57519 WP_003405595.1.57525 WP_003405595.1.57551 WP_003405595.1.5758 WP_003405595.1.57596 WP_003405595.1.57604 WP_003405595.1.57616 WP_003405595.1.57617 WP_003405595.1.57619 WP_003405595.1.57627 WP_003405595.1.57642 WP_003405595.1.57658 WP_003405595.1.57667 WP_003405595.1.57675 WP_003405595.1.57689 WP_003405595.1.57708 WP_003405595.1.57794 WP_003405595.1.57821 WP_003405595.1.57825 WP_003405595.1.57843 WP_003405595.1.57906 WP_003405595.1.57924 WP_003405595.1.57926 WP_003405595.1.57930 WP_003405595.1.57957 WP_003405595.1.57960 WP_003405595.1.57964 WP_003405595.1.57991 WP_003405595.1.58000 WP_003405595.1.58086 WP_003405595.1.58101 WP_003405595.1.58103 WP_003405595.1.58108 WP_003405595.1.5811 WP_003405595.1.58121 WP_003405595.1.58145 WP_003405595.1.58164 WP_003405595.1.58174 WP_003405595.1.582 WP_003405595.1.58202 WP_003405595.1.58209 WP_003405595.1.58215 WP_003405595.1.5824 WP_003405595.1.58250 WP_003405595.1.58259 WP_003405595.1.58283 WP_003405595.1.58288 WP_003405595.1.5830 WP_003405595.1.58303 WP_003405595.1.58311 WP_003405595.1.58359 WP_003405595.1.58386 WP_003405595.1.58393 WP_003405595.1.58431 WP_003405595.1.5844 WP_003405595.1.58457 WP_003405595.1.58488 WP_003405595.1.58518 WP_003405595.1.58534 WP_003405595.1.58559 WP_003405595.1.58567 WP_003405595.1.58573 WP_003405595.1.58602 WP_003405595.1.58612 WP_003405595.1.58619 WP_003405595.1.58630 WP_003405595.1.5865 WP_003405595.1.58671 WP_003405595.1.58690 WP_003405595.1.58702 WP_003405595.1.58743 WP_003405595.1.58754 WP_003405595.1.5879 WP_003405595.1.5881 WP_003405595.1.58824 WP_003405595.1.58848 WP_003405595.1.58857 WP_003405595.1.58891 WP_003405595.1.58892 WP_003405595.1.5890 WP_003405595.1.58904 WP_003405595.1.58921 WP_003405595.1.58930 WP_003405595.1.58939 WP_003405595.1.58941 WP_003405595.1.58953 WP_003405595.1.58961 WP_003405595.1.5898 WP_003405595.1.59025 WP_003405595.1.59029 WP_003405595.1.59037 WP_003405595.1.59044 WP_003405595.1.59085 WP_003405595.1.59088 WP_003405595.1.59112 WP_003405595.1.59130 WP_003405595.1.5914 WP_003405595.1.59147 WP_003405595.1.59166 WP_003405595.1.59205 WP_003405595.1.59209 WP_003405595.1.59237 WP_003405595.1.59240 WP_003405595.1.59253 WP_003405595.1.59254 WP_003405595.1.59262 WP_003405595.1.59270 WP_003405595.1.5928 WP_003405595.1.59304 WP_003405595.1.59305 WP_003405595.1.59309 WP_003405595.1.59316 WP_003405595.1.59326 WP_003405595.1.59328 WP_003405595.1.59333 WP_003405595.1.59338 WP_003405595.1.59388 WP_003405595.1.59428 WP_003405595.1.59487 WP_003405595.1.59537 WP_003405595.1.59561 WP_003405595.1.59677 WP_003405595.1.59722 WP_003405595.1.59727 WP_003405595.1.59732 WP_003405595.1.59738 WP_003405595.1.59750 WP_003405595.1.59757 WP_003405595.1.59761 WP_003405595.1.59808 WP_003405595.1.59850 WP_003405595.1.59856 WP_003405595.1.59860 WP_003405595.1.59861 WP_003405595.1.5987 WP_003405595.1.59878 WP_003405595.1.59888 WP_003405595.1.59952 WP_003405595.1.5996 WP_003405595.1.59961 WP_003405595.1.59974 WP_003405595.1.6000 WP_003405595.1.60007 WP_003405595.1.60016 WP_003405595.1.6003 WP_003405595.1.60047 WP_003405595.1.6007 WP_003405595.1.60121 WP_003405595.1.60125 WP_003405595.1.60135 WP_003405595.1.60139 WP_003405595.1.60152 WP_003405595.1.60171 WP_003405595.1.60197 WP_003405595.1.6020 WP_003405595.1.60205 WP_003405595.1.60207 WP_003405595.1.60215 WP_003405595.1.60217 WP_003405595.1.60267 WP_003405595.1.60288 WP_003405595.1.60291 WP_003405595.1.60301 WP_003405595.1.60305 WP_003405595.1.60312 WP_003405595.1.60313 WP_003405595.1.60314 WP_003405595.1.60367 WP_003405595.1.60376 WP_003405595.1.60403 WP_003405595.1.60413 WP_003405595.1.60421 WP_003405595.1.60451 WP_003405595.1.60460 WP_003405595.1.60479 WP_003405595.1.60487 WP_003405595.1.60512 WP_003405595.1.60573 WP_003405595.1.60583 WP_003405595.1.60632 WP_003405595.1.60657 WP_003405595.1.60687 WP_003405595.1.60689 WP_003405595.1.60727 WP_003405595.1.60738 WP_003405595.1.60763 WP_003405595.1.6077 WP_003405595.1.60791 WP_003405595.1.60834 WP_003405595.1.60870 WP_003405595.1.60878 WP_003405595.1.60879 WP_003405595.1.60913 WP_003405595.1.60978 WP_003405595.1.61000 WP_003405595.1.61001 WP_003405595.1.61012 WP_003405595.1.61014 WP_003405595.1.61015 WP_003405595.1.61037 WP_003405595.1.61052 WP_003405595.1.61065 WP_003405595.1.61100 WP_003405595.1.61101 WP_003405595.1.61138 WP_003405595.1.61142 WP_003405595.1.61198 WP_003405595.1.612 WP_003405595.1.61234 WP_003405595.1.61256 WP_003405595.1.61281 WP_003405595.1.61314 WP_003405595.1.61321 WP_003405595.1.61326 WP_003405595.1.61328 WP_003405595.1.61368 WP_003405595.1.61391 WP_003405595.1.61406 WP_003405595.1.61409 WP_003405595.1.61420 WP_003405595.1.61425 WP_003405595.1.61428 WP_003405595.1.61469 WP_003405595.1.61494 WP_003405595.1.61522 WP_003405595.1.61552 WP_003405595.1.61557 WP_003405595.1.61567 WP_003405595.1.61571 WP_003405595.1.61573 WP_003405595.1.61584 WP_003405595.1.61586 WP_003405595.1.6159 WP_003405595.1.61592 WP_003405595.1.6160 WP_003405595.1.61614 WP_003405595.1.6163 WP_003405595.1.61655 WP_003405595.1.61665 WP_003405595.1.61669 WP_003405595.1.61682 WP_003405595.1.61692 WP_003405595.1.61719 WP_003405595.1.61728 WP_003405595.1.61750 WP_003405595.1.61754 WP_003405595.1.61755 WP_003405595.1.61757 WP_003405595.1.61778 WP_003405595.1.6179 WP_003405595.1.61793 WP_003405595.1.61816 WP_003405595.1.61842 WP_003405595.1.61862 WP_003405595.1.61865 WP_003405595.1.61868 WP_003405595.1.61911 WP_003405595.1.61925 WP_003405595.1.61941 WP_003405595.1.61953 WP_003405595.1.61979 WP_003405595.1.61986 WP_003405595.1.61987 WP_003405595.1.61998 WP_003405595.1.62021 WP_003405595.1.62087 WP_003405595.1.62089 WP_003405595.1.62101 WP_003405595.1.62104 WP_003405595.1.6211 WP_003405595.1.62132 WP_003405595.1.62162 WP_003405595.1.62225 WP_003405595.1.62230 WP_003405595.1.62238 WP_003405595.1.62249 WP_003405595.1.62270 WP_003405595.1.62281 WP_003405595.1.62307 WP_003405595.1.6231 WP_003405595.1.62359 WP_003405595.1.62360 WP_003405595.1.62371 WP_003405595.1.62379 WP_003405595.1.62395 WP_003405595.1.62408 WP_003405595.1.62449 WP_003405595.1.62468 WP_003405595.1.6248 WP_003405595.1.62508 WP_003405595.1.62565 WP_003405595.1.62594 WP_003405595.1.62606 WP_003405595.1.62616 WP_003405595.1.62666 WP_003405595.1.62687 WP_003405595.1.62715 WP_003405595.1.62730 WP_003405595.1.62738 WP_003405595.1.62761 WP_003405595.1.62766 WP_003405595.1.62786 WP_003405595.1.62813 WP_003405595.1.62839 WP_003405595.1.62841 WP_003405595.1.62909 WP_003405595.1.62936 WP_003405595.1.6294 WP_003405595.1.6295 WP_003405595.1.62962 WP_003405595.1.63007 WP_003405595.1.63019 WP_003405595.1.63032 WP_003405595.1.63037 WP_003405595.1.63064 WP_003405595.1.63066 WP_003405595.1.63072 WP_003405595.1.6308 WP_003405595.1.63081 WP_003405595.1.63096 WP_003405595.1.63106 WP_003405595.1.6314 WP_003405595.1.63144 WP_003405595.1.63154 WP_003405595.1.63160 WP_003405595.1.63161 WP_003405595.1.63166 WP_003405595.1.63175 WP_003405595.1.63194 WP_003405595.1.6322 WP_003405595.1.63222 WP_003405595.1.63247 WP_003405595.1.6328 WP_003405595.1.63291 WP_003405595.1.63312 WP_003405595.1.63317 WP_003405595.1.63331 WP_003405595.1.63373 WP_003405595.1.63403 WP_003405595.1.63424 WP_003405595.1.63428 WP_003405595.1.6345 WP_003405595.1.63464 WP_003405595.1.63483 WP_003405595.1.63502 WP_003405595.1.63504 WP_003405595.1.63522 WP_003405595.1.63530 WP_003405595.1.63538 WP_003405595.1.63564 WP_003405595.1.63567 WP_003405595.1.63596 WP_003405595.1.63600 WP_003405595.1.63623 WP_003405595.1.63624 WP_003405595.1.63625 WP_003405595.1.63627 WP_003405595.1.63654 WP_003405595.1.63662 WP_003405595.1.63711 WP_003405595.1.63734 WP_003405595.1.63807 WP_003405595.1.63819 WP_003405595.1.63844 WP_003405595.1.63888 WP_003405595.1.63913 WP_003405595.1.63915 WP_003405595.1.63918 WP_003405595.1.63961 WP_003405595.1.63970 WP_003405595.1.64000 WP_003405595.1.64058 WP_003405595.1.64065 WP_003405595.1.6407 WP_003405595.1.64082 WP_003405595.1.64091 WP_003405595.1.64102 WP_003405595.1.64104 WP_003405595.1.64119 WP_003405595.1.64169 WP_003405595.1.64219 WP_003405595.1.6422 WP_003405595.1.64222 WP_003405595.1.64223 WP_003405595.1.64228 WP_003405595.1.64235 WP_003405595.1.64249 WP_003405595.1.6427 WP_003405595.1.64278 WP_003405595.1.64287 WP_003405595.1.64414 WP_003405595.1.64419 WP_003405595.1.6443 WP_003405595.1.64463 WP_003405595.1.64480 WP_003405595.1.64497 WP_003405595.1.64506 WP_003405595.1.64511 WP_003405595.1.64513 WP_003405595.1.64514 WP_003405595.1.64515 WP_003405595.1.64522 WP_003405595.1.64526 WP_003405595.1.64543 WP_003405595.1.6456 WP_003405595.1.64567 WP_003405595.1.64588 WP_003405595.1.64589 WP_003405595.1.64594 WP_003405595.1.64595 WP_003405595.1.64608 WP_003405595.1.64619 WP_003405595.1.64629 WP_003405595.1.6464 WP_003405595.1.64664 WP_003405595.1.64669 WP_003405595.1.64672 WP_003405595.1.64680 WP_003405595.1.64682 WP_003405595.1.64727 WP_003405595.1.64729 WP_003405595.1.64774 WP_003405595.1.64776 WP_003405595.1.64802 WP_003405595.1.64832 WP_003405595.1.6486 WP_003405595.1.64870 WP_003405595.1.64898 WP_003405595.1.64922 WP_003405595.1.64924 WP_003405595.1.6493 WP_003405595.1.64937 WP_003405595.1.64941 WP_003405595.1.64966 WP_003405595.1.64973 WP_003405595.1.65001 WP_003405595.1.65026 WP_003405595.1.65053 WP_003405595.1.65070 WP_003405595.1.65079 WP_003405595.1.65102 WP_003405595.1.65157 WP_003405595.1.65181 WP_003405595.1.65212 WP_003405595.1.65229 WP_003405595.1.6523 WP_003405595.1.65253 WP_003405595.1.65289 WP_003405595.1.65291 WP_003405595.1.65315 WP_003405595.1.65329 WP_003405595.1.65359 WP_003405595.1.6536 WP_003405595.1.65374 WP_003405595.1.65386 WP_003405595.1.65414 WP_003405595.1.65416 WP_003405595.1.65433 WP_003405595.1.65455 WP_003405595.1.65467 WP_003405595.1.65488 WP_003405595.1.65529 WP_003405595.1.65539 WP_003405595.1.65583 WP_003405595.1.65612 WP_003405595.1.65623 WP_003405595.1.65635 WP_003405595.1.65637 WP_003405595.1.65648 WP_003405595.1.65683 WP_003405595.1.65686 WP_003405595.1.65688 WP_003405595.1.65707 WP_003405595.1.65733 WP_003405595.1.65746 WP_003405595.1.65747 WP_003405595.1.65759 WP_003405595.1.65816 WP_003405595.1.65830 WP_003405595.1.65858 WP_003405595.1.65862 WP_003405595.1.65869 WP_003405595.1.65893 WP_003405595.1.65929 WP_003405595.1.65932 WP_003405595.1.65958 WP_003405595.1.65974 WP_003405595.1.66004 WP_003405595.1.66013 WP_003405595.1.6606 WP_003405595.1.66089 WP_003405595.1.66149 WP_003405595.1.66151 WP_003405595.1.66229 WP_003405595.1.66276 WP_003405595.1.66293 WP_003405595.1.66297 WP_003405595.1.66323 WP_003405595.1.66325 WP_003405595.1.6633 WP_003405595.1.66334 WP_003405595.1.66355 WP_003405595.1.66367 WP_003405595.1.66394 WP_003405595.1.66396 WP_003405595.1.66451 WP_003405595.1.66455 WP_003405595.1.66457 WP_003405595.1.66460 WP_003405595.1.66464 WP_003405595.1.66466 WP_003405595.1.66487 WP_003405595.1.66504 WP_003405595.1.66544 WP_003405595.1.66558 WP_003405595.1.66580 WP_003405595.1.66582 WP_003405595.1.66612 WP_003405595.1.66615 WP_003405595.1.66617 WP_003405595.1.66635 WP_003405595.1.66656 WP_003405595.1.66663 WP_003405595.1.66675 WP_003405595.1.66715 WP_003405595.1.66718 WP_003405595.1.66762 WP_003405595.1.66776 WP_003405595.1.66808 WP_003405595.1.66817 WP_003405595.1.66819 WP_003405595.1.66826 WP_003405595.1.66830 WP_003405595.1.66842 WP_003405595.1.66868 WP_003405595.1.66878 WP_003405595.1.66880 WP_003405595.1.66893 WP_003405595.1.66961 WP_003405595.1.67005 WP_003405595.1.6704 WP_003405595.1.67044 WP_003405595.1.67061 WP_003405595.1.67098 WP_003405595.1.67146 WP_003405595.1.67170 WP_003405595.1.67197 WP_003405595.1.67198 WP_003405595.1.6720 WP_003405595.1.67207 WP_003405595.1.67218 WP_003405595.1.67220 WP_003405595.1.67225 WP_003405595.1.67231 WP_003405595.1.6724 WP_003405595.1.67257 WP_003405595.1.67298 WP_003405595.1.67307 WP_003405595.1.67324 WP_003405595.1.67332 WP_003405595.1.67346 WP_003405595.1.67354 WP_003405595.1.67360 WP_003405595.1.67381 WP_003405595.1.67396 WP_003405595.1.67422 WP_003405595.1.67453 WP_003405595.1.67459 WP_003405595.1.6746 WP_003405595.1.67473 WP_003405595.1.67481 WP_003405595.1.67482 WP_003405595.1.67496 WP_003405595.1.67499 WP_003405595.1.67516 WP_003405595.1.67523 WP_003405595.1.67536 WP_003405595.1.67575 WP_003405595.1.67587 WP_003405595.1.67598 WP_003405595.1.67600 WP_003405595.1.67602 WP_003405595.1.67630 WP_003405595.1.67679 WP_003405595.1.67692 WP_003405595.1.67744 WP_003405595.1.6775 WP_003405595.1.67750 WP_003405595.1.6777 WP_003405595.1.67809 WP_003405595.1.67816 WP_003405595.1.67844 WP_003405595.1.67848 WP_003405595.1.67870 WP_003405595.1.67888 WP_003405595.1.67915 WP_003405595.1.67945 WP_003405595.1.67949 WP_003405595.1.67980 WP_003405595.1.67982 WP_003405595.1.68022 WP_003405595.1.68029 WP_003405595.1.68037 WP_003405595.1.68038 WP_003405595.1.68045 WP_003405595.1.68057 WP_003405595.1.68083 WP_003405595.1.68088 WP_003405595.1.68106 WP_003405595.1.68110 WP_003405595.1.68153 WP_003405595.1.68164 WP_003405595.1.68169 WP_003405595.1.68193 WP_003405595.1.68212 WP_003405595.1.68227 WP_003405595.1.68243 WP_003405595.1.6825 WP_003405595.1.68297 WP_003405595.1.68309 WP_003405595.1.68325 WP_003405595.1.68329 WP_003405595.1.68340 WP_003405595.1.68384 WP_003405595.1.68388 WP_003405595.1.68429 WP_003405595.1.6843 WP_003405595.1.68433 WP_003405595.1.68444 WP_003405595.1.68465 WP_003405595.1.68484 WP_003405595.1.68518 WP_003405595.1.68569 WP_003405595.1.68576 WP_003405595.1.68580 WP_003405595.1.68586 WP_003405595.1.68623 WP_003405595.1.68624 WP_003405595.1.68637 WP_003405595.1.68646 WP_003405595.1.68667 WP_003405595.1.68669 WP_003405595.1.68672 WP_003405595.1.68684 WP_003405595.1.68704 WP_003405595.1.68708 WP_003405595.1.6872 WP_003405595.1.68730 WP_003405595.1.68734 WP_003405595.1.68748 WP_003405595.1.68754 WP_003405595.1.6876 WP_003405595.1.68761 WP_003405595.1.68763 WP_003405595.1.68766 WP_003405595.1.68774 WP_003405595.1.68796 WP_003405595.1.68824 WP_003405595.1.68832 WP_003405595.1.68833 WP_003405595.1.68841 WP_003405595.1.68859 WP_003405595.1.68876 WP_003405595.1.68906 WP_003405595.1.68916 WP_003405595.1.68923 WP_003405595.1.68945 WP_003405595.1.6896 WP_003405595.1.68981 WP_003405595.1.68984 WP_003405595.1.68997 WP_003405595.1.69008 WP_003405595.1.69076 WP_003405595.1.69079 WP_003405595.1.6908 WP_003405595.1.69082 WP_003405595.1.69178 WP_003405595.1.69181 WP_003405595.1.69208 WP_003405595.1.69231 WP_003405595.1.69256 WP_003405595.1.69311 WP_003405595.1.69315 WP_003405595.1.69322 WP_003405595.1.69342 WP_003405595.1.6935 WP_003405595.1.6936 WP_003405595.1.69369 WP_003405595.1.69374 WP_003405595.1.69398 WP_003405595.1.69401 WP_003405595.1.69426 WP_003405595.1.69427 WP_003405595.1.69429 WP_003405595.1.6949 WP_003405595.1.6951 WP_003405595.1.69511 WP_003405595.1.69526 WP_003405595.1.69528 WP_003405595.1.69547 WP_003405595.1.69573 WP_003405595.1.69581 WP_003405595.1.6960 WP_003405595.1.69617 WP_003405595.1.69634 WP_003405595.1.69647 WP_003405595.1.69659 WP_003405595.1.69673 WP_003405595.1.69682 WP_003405595.1.69684 WP_003405595.1.69686 WP_003405595.1.69707 WP_003405595.1.69709 WP_003405595.1.69723 WP_003405595.1.69736 WP_003405595.1.69778 WP_003405595.1.69800 WP_003405595.1.69802 WP_003405595.1.69845 WP_003405595.1.69870 WP_003405595.1.69873 WP_003405595.1.69898 WP_003405595.1.69913 WP_003405595.1.69925 WP_003405595.1.69931 WP_003405595.1.69938 WP_003405595.1.69955 WP_003405595.1.69957 WP_003405595.1.69981 WP_003405595.1.69990 WP_003405595.1.70 WP_003405595.1.70000 WP_003405595.1.70017 WP_003405595.1.70032 WP_003405595.1.70055 WP_003405595.1.70062 WP_003405595.1.70072 WP_003405595.1.70131 WP_003405595.1.70132 WP_003405595.1.7022 WP_003405595.1.70227 WP_003405595.1.70255 WP_003405595.1.70274 WP_003405595.1.7029 WP_003405595.1.70325 WP_003405595.1.70328 WP_003405595.1.70356 WP_003405595.1.70368 WP_003405595.1.70369 WP_003405595.1.70418 WP_003405595.1.70422 WP_003405595.1.70435 WP_003405595.1.70444 WP_003405595.1.70463 WP_003405595.1.70471 WP_003405595.1.70480 WP_003405595.1.70494 WP_003405595.1.70498 WP_003405595.1.70505 WP_003405595.1.70525 WP_003405595.1.70573 WP_003405595.1.70577 WP_003405595.1.70610 WP_003405595.1.70615 WP_003405595.1.70618 WP_003405595.1.70622 WP_003405595.1.70626 WP_003405595.1.70668 WP_003405595.1.70699 WP_003405595.1.70704 WP_003405595.1.70729 WP_003405595.1.70757 WP_003405595.1.70782 WP_003405595.1.70796 WP_003405595.1.70830 WP_003405595.1.70834 WP_003405595.1.7084 WP_003405595.1.70840 WP_003405595.1.70864 WP_003405595.1.70871 WP_003405595.1.70915 WP_003405595.1.70955 WP_003405595.1.70958 WP_003405595.1.70964 WP_003405595.1.70976 WP_003405595.1.71015 WP_003405595.1.71026 WP_003405595.1.71063 WP_003405595.1.71076 WP_003405595.1.71083 WP_003405595.1.7111 WP_003405595.1.71118 WP_003405595.1.71128 WP_003405595.1.7113 WP_003405595.1.71187 WP_003405595.1.71191 WP_003405595.1.71255 WP_003405595.1.71258 WP_003405595.1.71259 WP_003405595.1.71289 WP_003405595.1.71326 WP_003405595.1.71329 WP_003405595.1.71331 WP_003405595.1.71344 WP_003405595.1.71390 WP_003405595.1.71414 WP_003405595.1.71440 WP_003405595.1.71457 WP_003405595.1.7146 WP_003405595.1.71464 WP_003405595.1.71490 WP_003405595.1.71492 WP_003405595.1.71509 WP_003405595.1.71516 WP_003405595.1.71517 WP_003405595.1.71527 WP_003405595.1.71532 WP_003405595.1.71545 WP_003405595.1.71546 WP_003405595.1.71569 WP_003405595.1.71604 WP_003405595.1.71621 WP_003405595.1.71630 WP_003405595.1.71638 WP_003405595.1.71654 WP_003405595.1.71664 WP_003405595.1.71665 WP_003405595.1.71683 WP_003405595.1.71701 WP_003405595.1.71718 WP_003405595.1.71731 WP_003405595.1.71778 WP_003405595.1.71781 WP_003405595.1.71803 WP_003405595.1.71820 WP_003405595.1.71847 WP_003405595.1.7185 WP_003405595.1.71851 WP_003405595.1.71871 WP_003405595.1.71957 WP_003405595.1.71970 WP_003405595.1.72047 WP_003405595.1.72061 WP_003405595.1.72062 WP_003405595.1.72072 WP_003405595.1.72111 WP_003405595.1.72122 WP_003405595.1.72128 WP_003405595.1.72143 WP_003405595.1.7216 WP_003405595.1.72168 WP_003405595.1.72179 WP_003405595.1.72209 WP_003405595.1.72218 WP_003405595.1.72219 WP_003405595.1.72227 WP_003405595.1.7224 WP_003405595.1.72268 WP_003405595.1.72332 WP_003405595.1.72380 WP_003405595.1.72401 WP_003405595.1.72405 WP_003405595.1.72420 WP_003405595.1.72441 WP_003405595.1.72451 WP_003405595.1.72452 WP_003405595.1.72457 WP_003405595.1.72459 WP_003405595.1.72460 WP_003405595.1.72466 WP_003405595.1.72487 WP_003405595.1.72488 WP_003405595.1.72492 WP_003405595.1.72506 WP_003405595.1.72543 WP_003405595.1.7256 WP_003405595.1.72576 WP_003405595.1.72578 WP_003405595.1.72585 WP_003405595.1.72591 WP_003405595.1.72592 WP_003405595.1.72640 WP_003405595.1.7266 WP_003405595.1.72661 WP_003405595.1.72739 WP_003405595.1.72744 WP_003405595.1.72755 WP_003405595.1.72759 WP_003405595.1.72784 WP_003405595.1.72792 WP_003405595.1.72826 WP_003405595.1.72831 WP_003405595.1.72852 WP_003405595.1.72853 WP_003405595.1.72879 WP_003405595.1.72880 WP_003405595.1.72938 WP_003405595.1.72954 WP_003405595.1.72957 WP_003405595.1.72959 WP_003405595.1.72973 WP_003405595.1.7298 WP_003405595.1.72982 WP_003405595.1.72988 WP_003405595.1.72993 WP_003405595.1.73006 WP_003405595.1.73013 WP_003405595.1.73025 WP_003405595.1.73028 WP_003405595.1.73042 WP_003405595.1.73045 WP_003405595.1.73092 WP_003405595.1.73118 WP_003405595.1.7312 WP_003405595.1.73127 WP_003405595.1.73134 WP_003405595.1.73150 WP_003405595.1.73154 WP_003405595.1.73163 WP_003405595.1.73182 WP_003405595.1.73205 WP_003405595.1.7321 WP_003405595.1.73310 WP_003405595.1.73365 WP_003405595.1.73391 WP_003405595.1.73404 WP_003405595.1.73424 WP_003405595.1.73436 WP_003405595.1.73445 WP_003405595.1.73453 WP_003405595.1.73465 WP_003405595.1.73470 WP_003405595.1.73471 WP_003405595.1.73478 WP_003405595.1.73482 WP_003405595.1.73507 WP_003405595.1.73532 WP_003405595.1.73550 WP_003405595.1.73564 WP_003405595.1.73623 WP_003405595.1.73629 WP_003405595.1.73644 WP_003405595.1.7366 WP_003405595.1.73661 WP_003405595.1.7368 WP_003405595.1.73688 WP_003405595.1.73723 WP_003405595.1.73744 WP_003405595.1.73750 WP_003405595.1.73760 WP_003405595.1.73774 WP_003405595.1.7379 WP_003405595.1.73813 WP_003405595.1.73840 WP_003405595.1.73876 WP_003405595.1.7389 WP_003405595.1.73986 WP_003405595.1.74016 WP_003405595.1.74039 WP_003405595.1.74083 WP_003405595.1.74101 WP_003405595.1.74107 WP_003405595.1.74120 WP_003405595.1.74129 WP_003405595.1.74144 WP_003405595.1.7417 WP_003405595.1.74190 WP_003405595.1.74210 WP_003405595.1.7423 WP_003405595.1.74259 WP_003405595.1.74262 WP_003405595.1.74269 WP_003405595.1.74282 WP_003405595.1.74291 WP_003405595.1.74296 WP_003405595.1.74304 WP_003405595.1.7432 WP_003405595.1.74347 WP_003405595.1.7436 WP_003405595.1.74378 WP_003405595.1.74382 WP_003405595.1.74395 WP_003405595.1.74400 WP_003405595.1.74401 WP_003405595.1.74432 WP_003405595.1.74442 WP_003405595.1.74477 WP_003405595.1.74487 WP_003405595.1.74499 WP_003405595.1.74504 WP_003405595.1.74511 WP_003405595.1.74523 WP_003405595.1.74525 WP_003405595.1.74551 WP_003405595.1.74555 WP_003405595.1.74628 WP_003405595.1.74641 WP_003405595.1.74653 WP_003405595.1.74660 WP_003405595.1.74683 WP_003405595.1.7469 WP_003405595.1.74725 WP_003405595.1.74760 WP_003405595.1.74809 WP_003405595.1.74820 WP_003405595.1.74870 WP_003405595.1.74881 WP_003405595.1.74888 WP_003405595.1.74952 WP_003405595.1.7496 WP_003405595.1.74988 WP_003405595.1.75043 WP_003405595.1.75045 WP_003405595.1.75055 WP_003405595.1.75078 WP_003405595.1.75081 WP_003405595.1.75120 WP_003405595.1.75163 WP_003405595.1.75188 WP_003405595.1.75200 WP_003405595.1.75202 WP_003405595.1.75234 WP_003405595.1.75239 WP_003405595.1.75250 WP_003405595.1.75263 WP_003405595.1.75281 WP_003405595.1.75342 WP_003405595.1.7535 WP_003405595.1.75376 WP_003405595.1.75391 WP_003405595.1.75395 WP_003405595.1.75441 WP_003405595.1.75510 WP_003405595.1.75581 WP_003405595.1.75598 WP_003405595.1.75635 WP_003405595.1.75645 WP_003405595.1.75665 WP_003405595.1.75671 WP_003405595.1.75741 WP_003405595.1.75749 WP_003405595.1.75772 WP_003405595.1.75774 WP_003405595.1.75811 WP_003405595.1.75833 WP_003405595.1.7585 WP_003405595.1.75864 WP_003405595.1.75868 WP_003405595.1.75927 WP_003405595.1.75946 WP_003405595.1.75968 WP_003405595.1.75974 WP_003405595.1.76007 WP_003405595.1.76016 WP_003405595.1.76032 WP_003405595.1.76037 WP_003405595.1.7604 WP_003405595.1.76045 WP_003405595.1.76052 WP_003405595.1.76058 WP_003405595.1.76064 WP_003405595.1.76110 WP_003405595.1.76126 WP_003405595.1.76133 WP_003405595.1.76138 WP_003405595.1.76157 WP_003405595.1.76172 WP_003405595.1.76177 WP_003405595.1.76183 WP_003405595.1.76209 WP_003405595.1.76239 WP_003405595.1.76272 WP_003405595.1.76277 WP_003405595.1.76280 WP_003405595.1.76281 WP_003405595.1.76291 WP_003405595.1.76297 WP_003405595.1.76360 WP_003405595.1.76379 WP_003405595.1.76403 WP_003405595.1.76413 WP_003405595.1.76414 WP_003405595.1.76427 WP_003405595.1.76436 WP_003405595.1.76442 WP_003405595.1.76443 WP_003405595.1.76456 WP_003405595.1.76521 WP_003405595.1.76533 WP_003405595.1.76616 WP_003405595.1.76625 WP_003405595.1.76629 WP_003405595.1.76635 WP_003405595.1.76638 WP_003405595.1.76639 WP_003405595.1.76640 WP_003405595.1.76644 WP_003405595.1.76677 WP_003405595.1.76678 WP_003405595.1.76679 WP_003405595.1.76734 WP_003405595.1.76744 WP_003405595.1.76750 WP_003405595.1.76754 WP_003405595.1.76757 WP_003405595.1.76781 WP_003405595.1.76818 WP_003405595.1.76824 WP_003405595.1.76835 WP_003405595.1.76873 WP_003405595.1.76881 WP_003405595.1.76888 WP_003405595.1.76900 WP_003405595.1.7691 WP_003405595.1.76947 WP_003405595.1.76954 WP_003405595.1.76955 WP_003405595.1.76963 WP_003405595.1.76976 WP_003405595.1.770 WP_003405595.1.77000 WP_003405595.1.77008 WP_003405595.1.77021 WP_003405595.1.77056 WP_003405595.1.77065 WP_003405595.1.77075 WP_003405595.1.77093 WP_003405595.1.77107 WP_003405595.1.77115 WP_003405595.1.77118 WP_003405595.1.77125 WP_003405595.1.77141 WP_003405595.1.77142 WP_003405595.1.77166 WP_003405595.1.77250 WP_003405595.1.77252 WP_003405595.1.77260 WP_003405595.1.77266 WP_003405595.1.77280 WP_003405595.1.77285 WP_003405595.1.77312 WP_003405595.1.77348 WP_003405595.1.77351 WP_003405595.1.77352 WP_003405595.1.77361 WP_003405595.1.774 WP_003405595.1.7740 WP_003405595.1.77404 WP_003405595.1.77425 WP_003405595.1.77463 WP_003405595.1.77474 WP_003405595.1.7748 WP_003405595.1.77484 WP_003405595.1.77491 WP_003405595.1.77499 WP_003405595.1.77510 WP_003405595.1.77530 WP_003405595.1.77554 WP_003405595.1.77559 WP_003405595.1.77599 WP_003405595.1.77605 WP_003405595.1.7762 WP_003405595.1.77627 WP_003405595.1.77649 WP_003405595.1.77654 WP_003405595.1.7766 WP_003405595.1.77667 WP_003405595.1.77704 WP_003405595.1.77706 WP_003405595.1.77726 WP_003405595.1.77774 WP_003405595.1.7778 WP_003405595.1.77790 WP_003405595.1.77809 WP_003405595.1.77820 WP_003405595.1.77843 WP_003405595.1.77855 WP_003405595.1.77865 WP_003405595.1.77868 WP_003405595.1.77879 WP_003405595.1.77890 WP_003405595.1.77909 WP_003405595.1.77911 WP_003405595.1.77931 WP_003405595.1.77984 WP_003405595.1.78020 WP_003405595.1.78024 WP_003405595.1.78075 WP_003405595.1.78084 WP_003405595.1.78086 WP_003405595.1.7809 WP_003405595.1.78098 WP_003405595.1.78105 WP_003405595.1.78113 WP_003405595.1.78136 WP_003405595.1.78162 WP_003405595.1.7817 WP_003405595.1.78200 WP_003405595.1.78216 WP_003405595.1.78238 WP_003405595.1.78322 WP_003405595.1.78338 WP_003405595.1.7836 WP_003405595.1.78360 WP_003405595.1.78386 WP_003405595.1.78429 WP_003405595.1.78435 WP_003405595.1.7844 WP_003405595.1.78459 WP_003405595.1.78488 WP_003405595.1.7849 WP_003405595.1.78499 WP_003405595.1.785 WP_003405595.1.78516 WP_003405595.1.78524 WP_003405595.1.78526 WP_003405595.1.78538 WP_003405595.1.78544 WP_003405595.1.78545 WP_003405595.1.78547 WP_003405595.1.78574 WP_003405595.1.78580 WP_003405595.1.7860 WP_003405595.1.78620 WP_003405595.1.78646 WP_003405595.1.78648 WP_003405595.1.78649 WP_003405595.1.78655 WP_003405595.1.78657 WP_003405595.1.78659 WP_003405595.1.7869 WP_003405595.1.78692 WP_003405595.1.78760 WP_003405595.1.78766 WP_003405595.1.78776 WP_003405595.1.78778 WP_003405595.1.78784 WP_003405595.1.78788 WP_003405595.1.78790 WP_003405595.1.78793 WP_003405595.1.78848 WP_003405595.1.78860 WP_003405595.1.7887 WP_003405595.1.78884 WP_003405595.1.78969 WP_003405595.1.78977 WP_003405595.1.78980 WP_003405595.1.79005 WP_003405595.1.79016 WP_003405595.1.79033 WP_003405595.1.79064 WP_003405595.1.79066 WP_003405595.1.79068 WP_003405595.1.79077 WP_003405595.1.79095 WP_003405595.1.79112 WP_003405595.1.79122 WP_003405595.1.79145 WP_003405595.1.79152 WP_003405595.1.79163 WP_003405595.1.79182 WP_003405595.1.79198 WP_003405595.1.79213 WP_003405595.1.79218 WP_003405595.1.79268 WP_003405595.1.79273 WP_003405595.1.79278 WP_003405595.1.79290 WP_003405595.1.79319 WP_003405595.1.79325 WP_003405595.1.79326 WP_003405595.1.7933 WP_003405595.1.79330 WP_003405595.1.79339 WP_003405595.1.79394 WP_003405595.1.79399 WP_003405595.1.79413 WP_003405595.1.79422 WP_003405595.1.79445 WP_003405595.1.79447 WP_003405595.1.79455 WP_003405595.1.79471 WP_003405595.1.79480 WP_003405595.1.79482 WP_003405595.1.79488 WP_003405595.1.79500 WP_003405595.1.79502 WP_003405595.1.79508 WP_003405595.1.79514 WP_003405595.1.79561 WP_003405595.1.79565 WP_003405595.1.79578 WP_003405595.1.79588 WP_003405595.1.79598 WP_003405595.1.79615 WP_003405595.1.79684 WP_003405595.1.79698 WP_003405595.1.797 WP_003405595.1.79744 WP_003405595.1.79784 WP_003405595.1.79802 WP_003405595.1.79806 WP_003405595.1.79819 WP_003405595.1.79826 WP_003405595.1.79828 WP_003405595.1.79851 WP_003405595.1.79853 WP_003405595.1.79863 WP_003405595.1.79881 WP_003405595.1.79885 WP_003405595.1.79898 WP_003405595.1.7990 WP_003405595.1.79900 WP_003405595.1.79913 WP_003405595.1.79918 WP_003405595.1.79947 WP_003405595.1.79948 WP_003405595.1.7995 WP_003405595.1.7997 WP_003405595.1.80004 WP_003405595.1.80015 WP_003405595.1.80022 WP_003405595.1.80030 WP_003405595.1.80054 WP_003405595.1.80084 WP_003405595.1.80099 WP_003405595.1.80129 WP_003405595.1.80177 WP_003405595.1.80234 WP_003405595.1.8026 WP_003405595.1.80275 WP_003405595.1.8029 WP_003405595.1.80299 WP_003405595.1.80300 WP_003405595.1.80304 WP_003405595.1.80326 WP_003405595.1.80351 WP_003405595.1.8037 WP_003405595.1.80370 WP_003405595.1.80399 WP_003405595.1.8044 WP_003405595.1.80451 WP_003405595.1.80458 WP_003405595.1.80461 WP_003405595.1.80490 WP_003405595.1.80503 WP_003405595.1.80507 WP_003405595.1.80552 WP_003405595.1.80576 WP_003405595.1.80588 WP_003405595.1.80599 WP_003405595.1.8060 WP_003405595.1.80624 WP_003405595.1.80636 WP_003405595.1.80669 WP_003405595.1.80673 WP_003405595.1.80711 WP_003405595.1.80714 WP_003405595.1.80743 WP_003405595.1.80784 WP_003405595.1.80815 WP_003405595.1.80853 WP_003405595.1.80918 WP_003405595.1.8093 WP_003405595.1.80967 WP_003405595.1.8097 WP_003405595.1.80988 WP_003405595.1.81007 WP_003405595.1.81013 WP_003405595.1.8105 WP_003405595.1.81059 WP_003405595.1.81063 WP_003405595.1.81066 WP_003405595.1.81075 WP_003405595.1.81091 WP_003405595.1.81119 WP_003405595.1.81125 WP_003405595.1.81136 WP_003405595.1.8114 WP_003405595.1.81189 WP_003405595.1.81192 WP_003405595.1.812 WP_003405595.1.81230 WP_003405595.1.81249 WP_003405595.1.81250 WP_003405595.1.81264 WP_003405595.1.8128 WP_003405595.1.81287 WP_003405595.1.81297 WP_003405595.1.8138 WP_003405595.1.81407 WP_003405595.1.8143 WP_003405595.1.81439 WP_003405595.1.81465 WP_003405595.1.81505 WP_003405595.1.81529 WP_003405595.1.81538 WP_003405595.1.81541 WP_003405595.1.81560 WP_003405595.1.81561 WP_003405595.1.81567 WP_003405595.1.81583 WP_003405595.1.81686 WP_003405595.1.81712 WP_003405595.1.81720 WP_003405595.1.81731 WP_003405595.1.81774 WP_003405595.1.81788 WP_003405595.1.81809 WP_003405595.1.81820 WP_003405595.1.81850 WP_003405595.1.81883 WP_003405595.1.81891 WP_003405595.1.81911 WP_003405595.1.81918 WP_003405595.1.82011 WP_003405595.1.82048 WP_003405595.1.82069 WP_003405595.1.82071 WP_003405595.1.82108 WP_003405595.1.82136 WP_003405595.1.82142 WP_003405595.1.8215 WP_003405595.1.82158 WP_003405595.1.8217 WP_003405595.1.82209 WP_003405595.1.82210 WP_003405595.1.82228 WP_003405595.1.82236 WP_003405595.1.82251 WP_003405595.1.82271 WP_003405595.1.82305 WP_003405595.1.82307 WP_003405595.1.82309 WP_003405595.1.82317 WP_003405595.1.8232 WP_003405595.1.82346 WP_003405595.1.82374 WP_003405595.1.82385 WP_003405595.1.82429 WP_003405595.1.82460 WP_003405595.1.82462 WP_003405595.1.82483 WP_003405595.1.82494 WP_003405595.1.82531 WP_003405595.1.82546 WP_003405595.1.82547 WP_003405595.1.82549 WP_003405595.1.82577 WP_003405595.1.82592 WP_003405595.1.82597 WP_003405595.1.82598 WP_003405595.1.82625 WP_003405595.1.82642 WP_003405595.1.82651 WP_003405595.1.82653 WP_003405595.1.82681 WP_003405595.1.82685 WP_003405595.1.8271 WP_003405595.1.82712 WP_003405595.1.8273 WP_003405595.1.82743 WP_003405595.1.82757 WP_003405595.1.82774 WP_003405595.1.82803 WP_003405595.1.82836 WP_003405595.1.82860 WP_003405595.1.82871 WP_003405595.1.82892 WP_003405595.1.82935 WP_003405595.1.82957 WP_003405595.1.82973 WP_003405595.1.82981 WP_003405595.1.82983 WP_003405595.1.83009 WP_003405595.1.83044 WP_003405595.1.83074 WP_003405595.1.83110 WP_003405595.1.83146 WP_003405595.1.83149 WP_003405595.1.83159 WP_003405595.1.8317 WP_003405595.1.83173 WP_003405595.1.83181 WP_003405595.1.83182 WP_003405595.1.83191 WP_003405595.1.83197 WP_003405595.1.83212 WP_003405595.1.8326 WP_003405595.1.83262 WP_003405595.1.83268 WP_003405595.1.83273 WP_003405595.1.83309 WP_003405595.1.83332 WP_003405595.1.83334 WP_003405595.1.83341 WP_003405595.1.83349 WP_003405595.1.8335 WP_003405595.1.83353 WP_003405595.1.83367 WP_003405595.1.83380 WP_003405595.1.83381 WP_003405595.1.83389 WP_003405595.1.83408 WP_003405595.1.83409 WP_003405595.1.83435 WP_003405595.1.83470 WP_003405595.1.83524 WP_003405595.1.83526 WP_003405595.1.8358 WP_003405595.1.83589 WP_003405595.1.83601 WP_003405595.1.83611 WP_003405595.1.83638 WP_003405595.1.83648 WP_003405595.1.83656 WP_003405595.1.83667 WP_003405595.1.83689 WP_003405595.1.83692 WP_003405595.1.83704 WP_003405595.1.83705 WP_003405595.1.83766 WP_003405595.1.83793 WP_003405595.1.83794 WP_003405595.1.83802 WP_003405595.1.83805 WP_003405595.1.83839 WP_003405595.1.83842 WP_003405595.1.83850 WP_003405595.1.83861 WP_003405595.1.83884 WP_003405595.1.83920 WP_003405595.1.83929 WP_003405595.1.83930 WP_003405595.1.83975 WP_003405595.1.83991 WP_003405595.1.8400 WP_003405595.1.84027 WP_003405595.1.8404 WP_003405595.1.84057 WP_003405595.1.84070 WP_003405595.1.8409 WP_003405595.1.84112 WP_003405595.1.84146 WP_003405595.1.8415 WP_003405595.1.84176 WP_003405595.1.84186 WP_003405595.1.84192 WP_003405595.1.84228 WP_003405595.1.8424 WP_003405595.1.84244 WP_003405595.1.84259 WP_003405595.1.8426 WP_003405595.1.84277 WP_003405595.1.84287 WP_003405595.1.8434 WP_003405595.1.84388 WP_003405595.1.84408 WP_003405595.1.84409 WP_003405595.1.84438 WP_003405595.1.84460 WP_003405595.1.84488 WP_003405595.1.84504 WP_003405595.1.84525 WP_003405595.1.84620 WP_003405595.1.84623 WP_003405595.1.84641 WP_003405595.1.84655 WP_003405595.1.84666 WP_003405595.1.84670 WP_003405595.1.84739 WP_003405595.1.84748 WP_003405595.1.84766 WP_003405595.1.84772 WP_003405595.1.84774 WP_003405595.1.848 WP_003405595.1.84812 WP_003405595.1.84836 WP_003405595.1.84839 WP_003405595.1.84846 WP_003405595.1.84873 WP_003405595.1.84911 WP_003405595.1.84938 WP_003405595.1.84968 WP_003405595.1.84973 WP_003405595.1.84981 WP_003405595.1.84985 WP_003405595.1.8503 WP_003405595.1.85038 WP_003405595.1.85041 WP_003405595.1.85043 WP_003405595.1.8505 WP_003405595.1.85074 WP_003405595.1.8509 WP_003405595.1.8512 WP_003405595.1.85148 WP_003405595.1.8518 WP_003405595.1.8522 WP_003405595.1.85242 WP_003405595.1.85276 WP_003405595.1.85281 WP_003405595.1.85284 WP_003405595.1.85314 WP_003405595.1.85319 WP_003405595.1.85330 WP_003405595.1.85341 WP_003405595.1.85346 WP_003405595.1.8535 WP_003405595.1.85363 WP_003405595.1.85371 WP_003405595.1.85377 WP_003405595.1.85387 WP_003405595.1.85399 WP_003405595.1.85458 WP_003405595.1.8546 WP_003405595.1.85464 WP_003405595.1.85478 WP_003405595.1.85480 WP_003405595.1.85488 WP_003405595.1.85495 WP_003405595.1.85551 WP_003405595.1.85557 WP_003405595.1.85577 WP_003405595.1.85597 WP_003405595.1.85599 WP_003405595.1.85610 WP_003405595.1.8563 WP_003405595.1.85648 WP_003405595.1.85679 WP_003405595.1.85704 WP_003405595.1.85717 WP_003405595.1.85727 WP_003405595.1.85737 WP_003405595.1.85763 WP_003405595.1.85808 WP_003405595.1.85819 WP_003405595.1.85820 WP_003405595.1.85823 WP_003405595.1.85832 WP_003405595.1.8586 WP_003405595.1.85872 WP_003405595.1.85894 WP_003405595.1.85909 WP_003405595.1.85913 WP_003405595.1.85953 WP_003405595.1.85986 WP_003405595.1.86000 WP_003405595.1.86024 WP_003405595.1.86025 WP_003405595.1.86032 WP_003405595.1.86048 WP_003405595.1.86052 WP_003405595.1.86067 WP_003405595.1.86103 WP_003405595.1.86122 WP_003405595.1.86124 WP_003405595.1.86160 WP_003405595.1.86164 WP_003405595.1.86168 WP_003405595.1.86190 WP_003405595.1.86204 WP_003405595.1.86208 WP_003405595.1.86235 WP_003405595.1.86249 WP_003405595.1.86260 WP_003405595.1.86290 WP_003405595.1.863 WP_003405595.1.86327 WP_003405595.1.86334 WP_003405595.1.86337 WP_003405595.1.86368 WP_003405595.1.86377 WP_003405595.1.86425 WP_003405595.1.86459 WP_003405595.1.8649 WP_003405595.1.86520 WP_003405595.1.86561 WP_003405595.1.86568 WP_003405595.1.86584 WP_003405595.1.86605 WP_003405595.1.86626 WP_003405595.1.86648 WP_003405595.1.8666 WP_003405595.1.86684 WP_003405595.1.86696 WP_003405595.1.86705 WP_003405595.1.86718 WP_003405595.1.86725 WP_003405595.1.86757 WP_003405595.1.86766 WP_003405595.1.86801 WP_003405595.1.86814 WP_003405595.1.86820 WP_003405595.1.86825 WP_003405595.1.86834 WP_003405595.1.8685 WP_003405595.1.86851 WP_003405595.1.86855 WP_003405595.1.86867 WP_003405595.1.86877 WP_003405595.1.86883 WP_003405595.1.8689 WP_003405595.1.86892 WP_003405595.1.86933 WP_003405595.1.86941 WP_003405595.1.86950 WP_003405595.1.86962 WP_003405595.1.86963 WP_003405595.1.86979 WP_003405595.1.8700 WP_003405595.1.87001 WP_003405595.1.87002 WP_003405595.1.87031 WP_003405595.1.87116 WP_003405595.1.87117 WP_003405595.1.8714 WP_003405595.1.87162 WP_003405595.1.87178 WP_003405595.1.87191 WP_003405595.1.87201 WP_003405595.1.87209 WP_003405595.1.87240 WP_003405595.1.87266 WP_003405595.1.87273 WP_003405595.1.87275 WP_003405595.1.8733 WP_003405595.1.87345 WP_003405595.1.87369 WP_003405595.1.8737 WP_003405595.1.87401 WP_003405595.1.87404 WP_003405595.1.87406 WP_003405595.1.87409 WP_003405595.1.87444 WP_003405595.1.87446 WP_003405595.1.87459 WP_003405595.1.87472 WP_003405595.1.87489 WP_003405595.1.87494 WP_003405595.1.87496 WP_003405595.1.87582 WP_003405595.1.87588 WP_003405595.1.87617 WP_003405595.1.87619 WP_003405595.1.87620 WP_003405595.1.87634 WP_003405595.1.87643 WP_003405595.1.8765 WP_003405595.1.87650 WP_003405595.1.87654 WP_003405595.1.87658 WP_003405595.1.87665 WP_003405595.1.87676 WP_003405595.1.87677 WP_003405595.1.87684 WP_003405595.1.87692 WP_003405595.1.87707 WP_003405595.1.87732 WP_003405595.1.87784 WP_003405595.1.87796 WP_003405595.1.87809 WP_003405595.1.87817 WP_003405595.1.87827 WP_003405595.1.87831 WP_003405595.1.87835 WP_003405595.1.87837 WP_003405595.1.87866 WP_003405595.1.8789 WP_003405595.1.87911 WP_003405595.1.87924 WP_003405595.1.87951 WP_003405595.1.87955 WP_003405595.1.87956 WP_003405595.1.87991 WP_003405595.1.88 WP_003405595.1.88002 WP_003405595.1.88037 WP_003405595.1.88039 WP_003405595.1.88072 WP_003405595.1.88077 WP_003405595.1.88121 WP_003405595.1.88180 WP_003405595.1.88191 WP_003405595.1.88205 WP_003405595.1.88217 WP_003405595.1.88219 WP_003405595.1.88245 WP_003405595.1.88253 WP_003405595.1.88294 WP_003405595.1.88315 WP_003405595.1.88316 WP_003405595.1.88320 WP_003405595.1.88338 WP_003405595.1.8840 WP_003405595.1.88437 WP_003405595.1.88453 WP_003405595.1.88469 WP_003405595.1.88489 WP_003405595.1.88507 WP_003405595.1.88521 WP_003405595.1.88530 WP_003405595.1.88537 WP_003405595.1.88541 WP_003405595.1.88592 WP_003405595.1.88616 WP_003405595.1.88618 WP_003405595.1.8862 WP_003405595.1.88625 WP_003405595.1.88632 WP_003405595.1.88634 WP_003405595.1.88649 WP_003405595.1.8870 WP_003405595.1.88737 WP_003405595.1.88756 WP_003405595.1.888 WP_003405595.1.88824 WP_003405595.1.88886 WP_003405595.1.88965 WP_003405595.1.88985 WP_003405595.1.8902 WP_003405595.1.89025 WP_003405595.1.89041 WP_003405595.1.89046 WP_003405595.1.89082 WP_003405595.1.89162 WP_003405595.1.89168 WP_003405595.1.8917 WP_003405595.1.89193 WP_003405595.1.89205 WP_003405595.1.89207 WP_003405595.1.89225 WP_003405595.1.8925 WP_003405595.1.89277 WP_003405595.1.89286 WP_003405595.1.89293 WP_003405595.1.89320 WP_003405595.1.8935 WP_003405595.1.89371 WP_003405595.1.89378 WP_003405595.1.89392 WP_003405595.1.89406 WP_003405595.1.8943 WP_003405595.1.89451 WP_003405595.1.89453 WP_003405595.1.89473 WP_003405595.1.89475 WP_003405595.1.89483 WP_003405595.1.895 WP_003405595.1.89513 WP_003405595.1.89517 WP_003405595.1.89522 WP_003405595.1.8954 WP_003405595.1.89543 WP_003405595.1.89567 WP_003405595.1.8957 WP_003405595.1.89572 WP_003405595.1.89589 WP_003405595.1.89607 WP_003405595.1.89613 WP_003405595.1.89625 WP_003405595.1.89648 WP_003405595.1.8967 WP_003405595.1.89670 WP_003405595.1.89676 WP_003405595.1.89729 WP_003405595.1.89739 WP_003405595.1.89762 WP_003405595.1.8977 WP_003405595.1.89802 WP_003405595.1.89808 WP_003405595.1.8982 WP_003405595.1.89829 WP_003405595.1.89831 WP_003405595.1.89844 WP_003405595.1.89849 WP_003405595.1.8989 WP_003405595.1.89901 WP_003405595.1.89903 WP_003405595.1.89909 WP_003405595.1.8992 WP_003405595.1.89922 WP_003405595.1.89926 WP_003405595.1.89963 WP_003405595.1.89971 WP_003405595.1.8998 WP_003405595.1.89987 WP_003405595.1.900 WP_003405595.1.90048 WP_003405595.1.9007 WP_003405595.1.90080 WP_003405595.1.90130 WP_003405595.1.90134 WP_003405595.1.90137 WP_003405595.1.90157 WP_003405595.1.90184 WP_003405595.1.90199 WP_003405595.1.90231 WP_003405595.1.90245 WP_003405595.1.90308 WP_003405595.1.90322 WP_003405595.1.90328 WP_003405595.1.90439 WP_003405595.1.90481 WP_003405595.1.90499 WP_003405595.1.9050 WP_003405595.1.90527 WP_003405595.1.90550 WP_003405595.1.90560 WP_003405595.1.90612 WP_003405595.1.90640 WP_003405595.1.90672 WP_003405595.1.90687 WP_003405595.1.90691 WP_003405595.1.90711 WP_003405595.1.90722 WP_003405595.1.90744 WP_003405595.1.9075 WP_003405595.1.90756 WP_003405595.1.90767 WP_003405595.1.90771 WP_003405595.1.90785 WP_003405595.1.90788 WP_003405595.1.90800 WP_003405595.1.90810 WP_003405595.1.90816 WP_003405595.1.90819 WP_003405595.1.9082 WP_003405595.1.90831 WP_003405595.1.90884 WP_003405595.1.90899 WP_003405595.1.90906 WP_003405595.1.90958 WP_003405595.1.90976 WP_003405595.1.90977 WP_003405595.1.90987 WP_003405595.1.9102 WP_003405595.1.91026 WP_003405595.1.91032 WP_003405595.1.91043 WP_003405595.1.91053 WP_003405595.1.91082 WP_003405595.1.91106 WP_003405595.1.91112 WP_003405595.1.91144 WP_003405595.1.91151 WP_003405595.1.91157 WP_003405595.1.91167 WP_003405595.1.91169 WP_003405595.1.91192 WP_003405595.1.91201 WP_003405595.1.91207 WP_003405595.1.91208 WP_003405595.1.91211 WP_003405595.1.91214 WP_003405595.1.91230 WP_003405595.1.91244 WP_003405595.1.91251 WP_003405595.1.91260 WP_003405595.1.91265 WP_003405595.1.9128 WP_003405595.1.91284 WP_003405595.1.91294 WP_003405595.1.91303 WP_003405595.1.91322 WP_003405595.1.91352 WP_003405595.1.91386 WP_003405595.1.9139 WP_003405595.1.91398 WP_003405595.1.91411 WP_003405595.1.91430 WP_003405595.1.91436 WP_003405595.1.91483 WP_003405595.1.91496 WP_003405595.1.91507 WP_003405595.1.91508 WP_003405595.1.91576 WP_003405595.1.91589 WP_003405595.1.91694 WP_003405595.1.91695 WP_003405595.1.91713 WP_003405595.1.91716 WP_003405595.1.91717 WP_003405595.1.91728 WP_003405595.1.91743 WP_003405595.1.91759 WP_003405595.1.91784 WP_003405595.1.91785 WP_003405595.1.91786 WP_003405595.1.91802 WP_003405595.1.91822 WP_003405595.1.91828 WP_003405595.1.9189 WP_003405595.1.91896 WP_003405595.1.9190 WP_003405595.1.91915 WP_003405595.1.91931 WP_003405595.1.91937 WP_003405595.1.91944 WP_003405595.1.91953 WP_003405595.1.91957 WP_003405595.1.91976 WP_003405595.1.91978 WP_003405595.1.92021 WP_003405595.1.92083 WP_003405595.1.92127 WP_003405595.1.92144 WP_003405595.1.92150 WP_003405595.1.92153 WP_003405595.1.92190 WP_003405595.1.92192 WP_003405595.1.92200 WP_003405595.1.92220 WP_003405595.1.92221 WP_003405595.1.92222 WP_003405595.1.92273 WP_003405595.1.92289 WP_003405595.1.9229 WP_003405595.1.92294 WP_003405595.1.92300 WP_003405595.1.92317 WP_003405595.1.92334 WP_003405595.1.92338 WP_003405595.1.92345 WP_003405595.1.92356 WP_003405595.1.92364 WP_003405595.1.92380 WP_003405595.1.92416 WP_003405595.1.92428 WP_003405595.1.92447 WP_003405595.1.92456 WP_003405595.1.92467 WP_003405595.1.92490 WP_003405595.1.92508 WP_003405595.1.9251 WP_003405595.1.92511 WP_003405595.1.92523 WP_003405595.1.92527 WP_003405595.1.92536 WP_003405595.1.92592 WP_003405595.1.92603 WP_003405595.1.92606 WP_003405595.1.92610 WP_003405595.1.92613 WP_003405595.1.9263 WP_003405595.1.9265 WP_003405595.1.92650 WP_003405595.1.92660 WP_003405595.1.92677 WP_003405595.1.92685 WP_003405595.1.92689 WP_003405595.1.92690 WP_003405595.1.92706 WP_003405595.1.92714 WP_003405595.1.92736 WP_003405595.1.9274 WP_003405595.1.92752 WP_003405595.1.92760 WP_003405595.1.92777 WP_003405595.1.92803 WP_003405595.1.92833 WP_003405595.1.92856 WP_003405595.1.92881 WP_003405595.1.92892 WP_003405595.1.92907 WP_003405595.1.92908 WP_003405595.1.9291 WP_003405595.1.92917 WP_003405595.1.92996 WP_003405595.1.93006 WP_003405595.1.93008 WP_003405595.1.93009 WP_003405595.1.93015 WP_003405595.1.93043 WP_003405595.1.9307 WP_003405595.1.93083 WP_003405595.1.93097 WP_003405595.1.93137 WP_003405595.1.93192 WP_003405595.1.93199 WP_003405595.1.93203 WP_003405595.1.93212 WP_003405595.1.93234 WP_003405595.1.93245 WP_003405595.1.93257 WP_003405595.1.93265 WP_003405595.1.93297 WP_003405595.1.93320 WP_003405595.1.93328 WP_003405595.1.93337 WP_003405595.1.93343 WP_003405595.1.93349 WP_003405595.1.93363 WP_003405595.1.93377 WP_003405595.1.9338 WP_003405595.1.93407 WP_003405595.1.93417 WP_003405595.1.93419 WP_003405595.1.93426 WP_003405595.1.9344 WP_003405595.1.93443 WP_003405595.1.93447 WP_003405595.1.93470 WP_003405595.1.93483 WP_003405595.1.93487 WP_003405595.1.93495 WP_003405595.1.93499 WP_003405595.1.93516 WP_003405595.1.93536 WP_003405595.1.93544 WP_003405595.1.93555 WP_003405595.1.93560 WP_003405595.1.93564 WP_003405595.1.9357 WP_003405595.1.93573 WP_003405595.1.93576 WP_003405595.1.93588 WP_003405595.1.9363 WP_003405595.1.93645 WP_003405595.1.93649 WP_003405595.1.93659 WP_003405595.1.93677 WP_003405595.1.9368 WP_003405595.1.93689 WP_003405595.1.93693 WP_003405595.1.93698 WP_003405595.1.93706 WP_003405595.1.9371 WP_003405595.1.93792 WP_003405595.1.93823 WP_003405595.1.93871 WP_003405595.1.9388 WP_003405595.1.93894 WP_003405595.1.93903 WP_003405595.1.93907 WP_003405595.1.93913 WP_003405595.1.93946 WP_003405595.1.93950 WP_003405595.1.93953 WP_003405595.1.93954 WP_003405595.1.93988 WP_003405595.1.9407 WP_003405595.1.94143 WP_003405595.1.94154 WP_003405595.1.94184 WP_003405595.1.94204 WP_003405595.1.94205 WP_003405595.1.94226 WP_003405595.1.94231 WP_003405595.1.94256 WP_003405595.1.94261 WP_003405595.1.94281 WP_003405595.1.94292 WP_003405595.1.94297 WP_003405595.1.9431 WP_003405595.1.94326 WP_003405595.1.94339 WP_003405595.1.94392 WP_003405595.1.94416 WP_003405595.1.94421 WP_003405595.1.94456 WP_003405595.1.94470 WP_003405595.1.94480 WP_003405595.1.94495 WP_003405595.1.94511 WP_003405595.1.94512 WP_003405595.1.94525 WP_003405595.1.94528 WP_003405595.1.94564 WP_003405595.1.946 WP_003405595.1.94602 WP_003405595.1.94623 WP_003405595.1.94629 WP_003405595.1.9465 WP_003405595.1.94673 WP_003405595.1.94714 WP_003405595.1.94730 WP_003405595.1.94736 WP_003405595.1.94776 WP_003405595.1.9478 WP_003405595.1.94834 WP_003405595.1.94852 WP_003405595.1.94872 WP_003405595.1.9488 WP_003405595.1.94902 WP_003405595.1.94916 WP_003405595.1.94979 WP_003405595.1.94994 WP_003405595.1.94996 WP_003405595.1.94998 WP_003405595.1.95007 WP_003405595.1.95010 WP_003405595.1.95015 WP_003405595.1.95034 WP_003405595.1.95068 WP_003405595.1.95081 WP_003405595.1.95082 WP_003405595.1.9509 WP_003405595.1.95096 WP_003405595.1.95112 WP_003405595.1.95138 WP_003405595.1.9514 WP_003405595.1.95179 WP_003405595.1.95188 WP_003405595.1.95190 WP_003405595.1.95234 WP_003405595.1.95241 WP_003405595.1.95245 WP_003405595.1.95257 WP_003405595.1.95279 WP_003405595.1.9531 WP_003405595.1.95335 WP_003405595.1.95344 WP_003405595.1.9535 WP_003405595.1.95370 WP_003405595.1.95392 WP_003405595.1.95416 WP_003405595.1.95417 WP_003405595.1.95454 WP_003405595.1.95455 WP_003405595.1.95491 WP_003405595.1.95497 WP_003405595.1.95508 WP_003405595.1.95509 WP_003405595.1.95529 WP_003405595.1.95556 WP_003405595.1.95557 WP_003405595.1.95565 WP_003405595.1.95578 WP_003405595.1.95580 WP_003405595.1.95585 WP_003405595.1.95643 WP_003405595.1.95679 WP_003405595.1.95685 WP_003405595.1.957 WP_003405595.1.95724 WP_003405595.1.95727 WP_003405595.1.95730 WP_003405595.1.95735 WP_003405595.1.95758 WP_003405595.1.95772 WP_003405595.1.95797 WP_003405595.1.95839 WP_003405595.1.9585 WP_003405595.1.9590 WP_003405595.1.95902 WP_003405595.1.95908 WP_003405595.1.95924 WP_003405595.1.95926 WP_003405595.1.95953 WP_003405595.1.95958 WP_003405595.1.95964 WP_003405595.1.95973 WP_003405595.1.96006 WP_003405595.1.9602 WP_003405595.1.96036 WP_003405595.1.96062 WP_003405595.1.96098 WP_003405595.1.96146 WP_003405595.1.96166 WP_003405595.1.96171 WP_003405595.1.96182 WP_003405595.1.96204 WP_003405595.1.96230 WP_003405595.1.96235 WP_003405595.1.96242 WP_003405595.1.96245 WP_003405595.1.96254 WP_003405595.1.96259 WP_003405595.1.96286 WP_003405595.1.96313 WP_003405595.1.96318 WP_003405595.1.96345 WP_003405595.1.96360 WP_003405595.1.96373 WP_003405595.1.96456 WP_003405595.1.96486 WP_003405595.1.96569 WP_003405595.1.96573 WP_003405595.1.96575 WP_003405595.1.96576 WP_003405595.1.96611 WP_003405595.1.96621 WP_003405595.1.9667 WP_003405595.1.96681 WP_003405595.1.96726 WP_003405595.1.96733 WP_003405595.1.96742 WP_003405595.1.96754 WP_003405595.1.9678 WP_003405595.1.96832 WP_003405595.1.9685 WP_003405595.1.97008 WP_003405595.1.97009 WP_003405595.1.97056 WP_003405595.1.97084 WP_003405595.1.97087 WP_003405595.1.97094 WP_003405595.1.97096 WP_003405595.1.97099 WP_003405595.1.97108 WP_003405595.1.97113 WP_003405595.1.97122 WP_003405595.1.97127 WP_003405595.1.97129 WP_003405595.1.97136 WP_003405595.1.9716 WP_003405595.1.97176 WP_003405595.1.97222 WP_003405595.1.97223 WP_003405595.1.97237 WP_003405595.1.97242 WP_003405595.1.97270 WP_003405595.1.97283 WP_003405595.1.97296 WP_003405595.1.97321 WP_003405595.1.97325 WP_003405595.1.97330 WP_003405595.1.97366 WP_003405595.1.97376 WP_003405595.1.97380 WP_003405595.1.9739 WP_003405595.1.97462 WP_003405595.1.97517 WP_003405595.1.97519 WP_003405595.1.97535 WP_003405595.1.97540 WP_003405595.1.97545 WP_003405595.1.97546 WP_003405595.1.97550 WP_003405595.1.97568 WP_003405595.1.97577 WP_003405595.1.97584 WP_003405595.1.9759 WP_003405595.1.97591 WP_003405595.1.97596 WP_003405595.1.97609 WP_003405595.1.97618 WP_003405595.1.9763 WP_003405595.1.97669 WP_003405595.1.97673 WP_003405595.1.97700 WP_003405595.1.97701 WP_003405595.1.9773 WP_003405595.1.97730 WP_003405595.1.97740 WP_003405595.1.97751 WP_003405595.1.97754 WP_003405595.1.97797 WP_003405595.1.9782 WP_003405595.1.9784 WP_003405595.1.97888 WP_003405595.1.9790 WP_003405595.1.9795 WP_003405595.1.97951 WP_003405595.1.97958 WP_003405595.1.97966 WP_003405595.1.97977 WP_003405595.1.97979 WP_003405595.1.97995 WP_003405595.1.98018 WP_003405595.1.98034 WP_003405595.1.98052 WP_003405595.1.98071 WP_003405595.1.98072 WP_003405595.1.98113 WP_003405595.1.98114 WP_003405595.1.98128 WP_003405595.1.98181 WP_003405595.1.98188 WP_003405595.1.98189 WP_003405595.1.98213 WP_003405595.1.98225 WP_003405595.1.98291 WP_003405595.1.98335 WP_003405595.1.98350 WP_003405595.1.98395 WP_003405595.1.98412 WP_003405595.1.98441 WP_003405595.1.98443 WP_003405595.1.98462 WP_003405595.1.9848 WP_003405595.1.98482 WP_003405595.1.98486 WP_003405595.1.98488 WP_003405595.1.98503 WP_003405595.1.98516 WP_003405595.1.98524 WP_003405595.1.98536 WP_003405595.1.98541 WP_003405595.1.98566 WP_003405595.1.98576 WP_003405595.1.98590 WP_003405595.1.98594 WP_003405595.1.98599 WP_003405595.1.98629 WP_003405595.1.98645 WP_003405595.1.98646 WP_003405595.1.98649 WP_003405595.1.98656 WP_003405595.1.9867 WP_003405595.1.98674 WP_003405595.1.98697 WP_003405595.1.98701 WP_003405595.1.98739 WP_003405595.1.98749 WP_003405595.1.98765 WP_003405595.1.98770 WP_003405595.1.98777 WP_003405595.1.98778 WP_003405595.1.98838 WP_003405595.1.98850 WP_003405595.1.98906 WP_003405595.1.98935 WP_003405595.1.98948 WP_003405595.1.98953 WP_003405595.1.98984 WP_003405595.1.99000 WP_003405595.1.99023 WP_003405595.1.99030 WP_003405595.1.99037 WP_003405595.1.99055 WP_003405595.1.99062 WP_003405595.1.99086 WP_003405595.1.99115 WP_003405595.1.99117 WP_003405595.1.99161 WP_003405595.1.99176 WP_003405595.1.99205 WP_003405595.1.99211 WP_003405595.1.99216 WP_003405595.1.99222 WP_003405595.1.99251 WP_003405595.1.99269 WP_003405595.1.99294 WP_003405595.1.99312 WP_003405595.1.99315 WP_003405595.1.99316 WP_003405595.1.99322 WP_003405595.1.99328 WP_003405595.1.99365 WP_003405595.1.99368 WP_003405595.1.99379 WP_003405595.1.99396 WP_003405595.1.99402 WP_003405595.1.99404 WP_003405595.1.99419 WP_003405595.1.99438 WP_003405595.1.99460 WP_003405595.1.99468 WP_003405595.1.99473 WP_003405595.1.99513 WP_003405595.1.99529 WP_003405595.1.99548 WP_003405595.1.99572 WP_003405595.1.99575 WP_003405595.1.99578 WP_003405595.1.99605 WP_003405595.1.99609 WP_003405595.1.99617 WP_003405595.1.99635 WP_003405595.1.99650 WP_003405595.1.99672 WP_003405595.1.99701 WP_003405595.1.99711 WP_003405595.1.99716 WP_003405595.1.99740 WP_003405595.1.99745 WP_003405595.1.99749 WP_003405595.1.9976 WP_003405595.1.99798 WP_003405595.1.99817 WP_003405595.1.99832 WP_003405595.1.99847 WP_003405595.1.99852 WP_003405595.1.99886 WP_003405595.1.99897 WP_003405595.1.99899 WP_003405595.1.99915 WP_003405595.1.9993 WP_003405595.1.99982 WP_003405595.1.99991 gi|224989450|ref|YP_002644137.1| gi|121636978|ref|YP_977201.1| gi|392385754|ref|YP_005307383.1| gi|31792240|ref|NP_854733.1| gi|525673813|ref|YP_008225156.1| gi|148822258|ref|YP_001287012.1| gi|506925496|ref|YP_008005946.1| gi|386004051|ref|YP_005922330.1| gi|378770812|ref|YP_005170545.1| gi|392433362|ref|YP_006474406.1| gi|15608189|ref|NP_215565.1| gi|494699450|ref|YP_007964932.1| 233413.Mb1078 336982.TBFG_11067 410289.BCG_1107 419947.MRA_1058 478434.TBMG_02939 561275.JTY_1079 83331.MT1079 83332.Rv1049 gi|385997830|ref|YP_005916128.1| gi|479313942|ref|YP_007853994.1| rv1049 gi|339631112|ref|YP_004722754.1| gi|197739780|ref|YP_002161094.1| gi|385990496|ref|YP_005908794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]