SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197739874|ref|YP_002161188.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197739874|ref|YP_002161188.1|
Domain Number 1 Region: 11-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.38e-19
Family GntR-like transcriptional regulators 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197739874|ref|YP_002161188.1|
Sequence length 121
Comment transcriptional regulator [Mycobacterium tuberculosis str. Haarlem]
Sequence
MELRDWLRVDVKAGKPLFDQLRTQVIDGVRAGALPPGTRLPTVRDLAGQLGVAANTVARA
YRELESAAIVETRGRFGTFISRFDPTDAAMAAAAKEYVGVARALGLTKSDAMRYLTHVPD
D
Download sequence
Identical sequences A0A045I0R0 A0A089QRA3 A0A0H3LBU5 A0A0H3M5C7 A0A0K2HU80 A0A109SVF7 A0A120IW86 A0A197IZG8 A0A1A9E5B2 A0A1R3XYG5 A0A1S1BBY7 A5U1K0 F8M5U7 L7N5Y9 M8CPW2 O06550 R4M4R5
gi|525673896|ref|YP_008225256.1| gi|506925614|ref|YP_008006064.1| gi|31792345|ref|NP_854838.1| gi|253799805|ref|YP_003032806.1| gi|494699559|ref|YP_007965041.1| gi|392433254|ref|YP_006474298.1| gi|15608292|ref|NP_215668.1| gi|378770917|ref|YP_005170650.1| gi|15840592|ref|NP_335629.1| gi|385997936|ref|YP_005916234.1| gi|375297045|ref|YP_005101312.1| gi|224989556|ref|YP_002644243.1| gi|479314051|ref|YP_007854103.1| gi|15608292|ref|NP_215668.1| gi|197739874|ref|YP_002161188.1| gi|479055113|ref|YP_007350919.1| 233413.Mb1183 336982.TBFG_11176 410289.BCG_1213 419947.MRA_1162 478434.TBMG_02830 561275.JTY_1186 83331.MT1186 83332.Rv1152 gi|506925614|ref|YP_008006064.1| gi|383307033|ref|YP_005359844.1| gi|494695562|ref|YP_007961065.1| Rv1152 gi|121637083|ref|YP_977306.1| gi|148822367|ref|YP_001287121.1| gi|148660939|ref|YP_001282462.1| gi|449063216|ref|YP_007430299.1| gi|339631217|ref|YP_004722859.1| gi|471337059|ref|YP_007609772.1| NP_215668.1.84033 WP_003406047.1.100000 WP_003406047.1.100021 WP_003406047.1.100069 WP_003406047.1.100087 WP_003406047.1.10015 WP_003406047.1.100208 WP_003406047.1.100216 WP_003406047.1.10022 WP_003406047.1.100255 WP_003406047.1.100260 WP_003406047.1.100270 WP_003406047.1.100279 WP_003406047.1.100286 WP_003406047.1.100308 WP_003406047.1.100309 WP_003406047.1.100318 WP_003406047.1.100337 WP_003406047.1.100338 WP_003406047.1.10037 WP_003406047.1.100383 WP_003406047.1.100395 WP_003406047.1.100396 WP_003406047.1.1004 WP_003406047.1.100401 WP_003406047.1.100459 WP_003406047.1.100460 WP_003406047.1.100552 WP_003406047.1.100581 WP_003406047.1.100600 WP_003406047.1.100625 WP_003406047.1.10064 WP_003406047.1.100666 WP_003406047.1.100671 WP_003406047.1.100677 WP_003406047.1.100682 WP_003406047.1.100697 WP_003406047.1.100703 WP_003406047.1.100716 WP_003406047.1.100722 WP_003406047.1.100754 WP_003406047.1.100757 WP_003406047.1.100772 WP_003406047.1.1008 WP_003406047.1.100812 WP_003406047.1.100845 WP_003406047.1.100866 WP_003406047.1.10088 WP_003406047.1.100889 WP_003406047.1.10090 WP_003406047.1.100910 WP_003406047.1.100915 WP_003406047.1.100918 WP_003406047.1.100935 WP_003406047.1.100984 WP_003406047.1.100992 WP_003406047.1.100998 WP_003406047.1.101 WP_003406047.1.101025 WP_003406047.1.101028 WP_003406047.1.10104 WP_003406047.1.101048 WP_003406047.1.101054 WP_003406047.1.101075 WP_003406047.1.101143 WP_003406047.1.101146 WP_003406047.1.10116 WP_003406047.1.10117 WP_003406047.1.101209 WP_003406047.1.10125 WP_003406047.1.101290 WP_003406047.1.101323 WP_003406047.1.101324 WP_003406047.1.101367 WP_003406047.1.101398 WP_003406047.1.101403 WP_003406047.1.101421 WP_003406047.1.10144 WP_003406047.1.10145 WP_003406047.1.101452 WP_003406047.1.101456 WP_003406047.1.101481 WP_003406047.1.101493 WP_003406047.1.101496 WP_003406047.1.101525 WP_003406047.1.101533 WP_003406047.1.101535 WP_003406047.1.101553 WP_003406047.1.101558 WP_003406047.1.10156 WP_003406047.1.101573 WP_003406047.1.101576 WP_003406047.1.10159 WP_003406047.1.101592 WP_003406047.1.101604 WP_003406047.1.101607 WP_003406047.1.101622 WP_003406047.1.101644 WP_003406047.1.101659 WP_003406047.1.101671 WP_003406047.1.101687 WP_003406047.1.101698 WP_003406047.1.10170 WP_003406047.1.101713 WP_003406047.1.101722 WP_003406047.1.101733 WP_003406047.1.101743 WP_003406047.1.101753 WP_003406047.1.101754 WP_003406047.1.101764 WP_003406047.1.101773 WP_003406047.1.101795 WP_003406047.1.101797 WP_003406047.1.101798 WP_003406047.1.101802 WP_003406047.1.101836 WP_003406047.1.101858 WP_003406047.1.101859 WP_003406047.1.101862 WP_003406047.1.101888 WP_003406047.1.101894 WP_003406047.1.101899 WP_003406047.1.1019 WP_003406047.1.101923 WP_003406047.1.101925 WP_003406047.1.10193 WP_003406047.1.101996 WP_003406047.1.102 WP_003406047.1.102008 WP_003406047.1.102017 WP_003406047.1.102053 WP_003406047.1.102055 WP_003406047.1.102063 WP_003406047.1.102099 WP_003406047.1.1021 WP_003406047.1.10211 WP_003406047.1.102119 WP_003406047.1.102121 WP_003406047.1.102143 WP_003406047.1.10216 WP_003406047.1.10224 WP_003406047.1.10253 WP_003406047.1.10262 WP_003406047.1.10272 WP_003406047.1.10277 WP_003406047.1.1033 WP_003406047.1.10350 WP_003406047.1.10362 WP_003406047.1.10366 WP_003406047.1.10376 WP_003406047.1.10396 WP_003406047.1.10410 WP_003406047.1.10414 WP_003406047.1.10430 WP_003406047.1.1044 WP_003406047.1.10440 WP_003406047.1.10445 WP_003406047.1.10471 WP_003406047.1.10472 WP_003406047.1.10489 WP_003406047.1.105 WP_003406047.1.10518 WP_003406047.1.10523 WP_003406047.1.10545 WP_003406047.1.1057 WP_003406047.1.10594 WP_003406047.1.10603 WP_003406047.1.10606 WP_003406047.1.10615 WP_003406047.1.10623 WP_003406047.1.10635 WP_003406047.1.10643 WP_003406047.1.10648 WP_003406047.1.10662 WP_003406047.1.10709 WP_003406047.1.10735 WP_003406047.1.10740 WP_003406047.1.10756 WP_003406047.1.1078 WP_003406047.1.10791 WP_003406047.1.10799 WP_003406047.1.10825 WP_003406047.1.10848 WP_003406047.1.10863 WP_003406047.1.10879 WP_003406047.1.10912 WP_003406047.1.10916 WP_003406047.1.10923 WP_003406047.1.10927 WP_003406047.1.1095 WP_003406047.1.10956 WP_003406047.1.10958 WP_003406047.1.10962 WP_003406047.1.10980 WP_003406047.1.10981 WP_003406047.1.10993 WP_003406047.1.1100 WP_003406047.1.11040 WP_003406047.1.11061 WP_003406047.1.11070 WP_003406047.1.11141 WP_003406047.1.11171 WP_003406047.1.11176 WP_003406047.1.11222 WP_003406047.1.11236 WP_003406047.1.11329 WP_003406047.1.1133 WP_003406047.1.11342 WP_003406047.1.11373 WP_003406047.1.11376 WP_003406047.1.11402 WP_003406047.1.11481 WP_003406047.1.11487 WP_003406047.1.11489 WP_003406047.1.11491 WP_003406047.1.11514 WP_003406047.1.11587 WP_003406047.1.11589 WP_003406047.1.11596 WP_003406047.1.11604 WP_003406047.1.11610 WP_003406047.1.11697 WP_003406047.1.11707 WP_003406047.1.11752 WP_003406047.1.11758 WP_003406047.1.11761 WP_003406047.1.11775 WP_003406047.1.11804 WP_003406047.1.11822 WP_003406047.1.11826 WP_003406047.1.11856 WP_003406047.1.11898 WP_003406047.1.11906 WP_003406047.1.11939 WP_003406047.1.11960 WP_003406047.1.11961 WP_003406047.1.11972 WP_003406047.1.11984 WP_003406047.1.120 WP_003406047.1.12001 WP_003406047.1.12049 WP_003406047.1.12052 WP_003406047.1.12100 WP_003406047.1.12116 WP_003406047.1.12130 WP_003406047.1.12133 WP_003406047.1.12161 WP_003406047.1.12165 WP_003406047.1.12184 WP_003406047.1.12187 WP_003406047.1.12216 WP_003406047.1.12265 WP_003406047.1.12275 WP_003406047.1.12293 WP_003406047.1.12294 WP_003406047.1.123 WP_003406047.1.1231 WP_003406047.1.12314 WP_003406047.1.12327 WP_003406047.1.12338 WP_003406047.1.1236 WP_003406047.1.12371 WP_003406047.1.12372 WP_003406047.1.12389 WP_003406047.1.12406 WP_003406047.1.1241 WP_003406047.1.12421 WP_003406047.1.12424 WP_003406047.1.12446 WP_003406047.1.12464 WP_003406047.1.12479 WP_003406047.1.12519 WP_003406047.1.12523 WP_003406047.1.12526 WP_003406047.1.1255 WP_003406047.1.12550 WP_003406047.1.12551 WP_003406047.1.12563 WP_003406047.1.12611 WP_003406047.1.12669 WP_003406047.1.1267 WP_003406047.1.12672 WP_003406047.1.1271 WP_003406047.1.12710 WP_003406047.1.12768 WP_003406047.1.1279 WP_003406047.1.12794 WP_003406047.1.12801 WP_003406047.1.12804 WP_003406047.1.12821 WP_003406047.1.12841 WP_003406047.1.12854 WP_003406047.1.12871 WP_003406047.1.12901 WP_003406047.1.12941 WP_003406047.1.12947 WP_003406047.1.12972 WP_003406047.1.13028 WP_003406047.1.13043 WP_003406047.1.13086 WP_003406047.1.13087 WP_003406047.1.13090 WP_003406047.1.13096 WP_003406047.1.13163 WP_003406047.1.13175 WP_003406047.1.13183 WP_003406047.1.132 WP_003406047.1.13249 WP_003406047.1.13282 WP_003406047.1.13284 WP_003406047.1.13296 WP_003406047.1.13298 WP_003406047.1.13302 WP_003406047.1.13306 WP_003406047.1.13312 WP_003406047.1.13313 WP_003406047.1.13321 WP_003406047.1.13345 WP_003406047.1.13358 WP_003406047.1.13370 WP_003406047.1.13375 WP_003406047.1.1338 WP_003406047.1.13420 WP_003406047.1.13433 WP_003406047.1.13435 WP_003406047.1.13438 WP_003406047.1.13461 WP_003406047.1.13466 WP_003406047.1.13489 WP_003406047.1.13526 WP_003406047.1.13551 WP_003406047.1.13561 WP_003406047.1.13564 WP_003406047.1.13579 WP_003406047.1.13647 WP_003406047.1.13687 WP_003406047.1.13697 WP_003406047.1.13719 WP_003406047.1.13763 WP_003406047.1.1377 WP_003406047.1.13774 WP_003406047.1.13786 WP_003406047.1.13793 WP_003406047.1.13794 WP_003406047.1.13817 WP_003406047.1.13834 WP_003406047.1.13880 WP_003406047.1.13899 WP_003406047.1.13910 WP_003406047.1.13919 WP_003406047.1.13920 WP_003406047.1.13952 WP_003406047.1.13953 WP_003406047.1.13962 WP_003406047.1.1398 WP_003406047.1.13988 WP_003406047.1.14027 WP_003406047.1.14046 WP_003406047.1.14115 WP_003406047.1.1415 WP_003406047.1.14152 WP_003406047.1.14158 WP_003406047.1.14162 WP_003406047.1.14175 WP_003406047.1.14178 WP_003406047.1.14194 WP_003406047.1.14195 WP_003406047.1.14208 WP_003406047.1.14238 WP_003406047.1.14266 WP_003406047.1.14273 WP_003406047.1.14306 WP_003406047.1.14307 WP_003406047.1.14310 WP_003406047.1.14341 WP_003406047.1.14382 WP_003406047.1.14416 WP_003406047.1.14428 WP_003406047.1.14441 WP_003406047.1.14469 WP_003406047.1.14477 WP_003406047.1.14504 WP_003406047.1.14514 WP_003406047.1.1452 WP_003406047.1.14527 WP_003406047.1.1454 WP_003406047.1.14544 WP_003406047.1.14548 WP_003406047.1.14551 WP_003406047.1.14561 WP_003406047.1.14573 WP_003406047.1.1462 WP_003406047.1.14658 WP_003406047.1.14667 WP_003406047.1.14668 WP_003406047.1.14675 WP_003406047.1.14694 WP_003406047.1.14695 WP_003406047.1.14709 WP_003406047.1.14766 WP_003406047.1.14783 WP_003406047.1.14865 WP_003406047.1.14872 WP_003406047.1.14905 WP_003406047.1.14926 WP_003406047.1.14951 WP_003406047.1.14955 WP_003406047.1.15003 WP_003406047.1.15009 WP_003406047.1.15040 WP_003406047.1.15052 WP_003406047.1.15065 WP_003406047.1.15072 WP_003406047.1.15089 WP_003406047.1.1509 WP_003406047.1.15126 WP_003406047.1.15131 WP_003406047.1.15168 WP_003406047.1.15172 WP_003406047.1.15174 WP_003406047.1.15187 WP_003406047.1.15196 WP_003406047.1.15210 WP_003406047.1.15217 WP_003406047.1.1523 WP_003406047.1.15232 WP_003406047.1.15238 WP_003406047.1.15240 WP_003406047.1.15253 WP_003406047.1.15267 WP_003406047.1.1527 WP_003406047.1.15292 WP_003406047.1.15299 WP_003406047.1.15302 WP_003406047.1.15322 WP_003406047.1.1534 WP_003406047.1.15345 WP_003406047.1.15365 WP_003406047.1.15372 WP_003406047.1.15386 WP_003406047.1.15387 WP_003406047.1.15442 WP_003406047.1.15447 WP_003406047.1.15449 WP_003406047.1.15477 WP_003406047.1.15481 WP_003406047.1.15492 WP_003406047.1.15511 WP_003406047.1.15512 WP_003406047.1.15558 WP_003406047.1.15559 WP_003406047.1.15566 WP_003406047.1.15599 WP_003406047.1.1560 WP_003406047.1.15611 WP_003406047.1.1563 WP_003406047.1.15633 WP_003406047.1.15643 WP_003406047.1.15688 WP_003406047.1.15755 WP_003406047.1.15763 WP_003406047.1.15774 WP_003406047.1.1578 WP_003406047.1.15780 WP_003406047.1.15827 WP_003406047.1.15834 WP_003406047.1.15842 WP_003406047.1.15848 WP_003406047.1.15853 WP_003406047.1.15870 WP_003406047.1.15877 WP_003406047.1.15893 WP_003406047.1.15896 WP_003406047.1.15926 WP_003406047.1.15933 WP_003406047.1.15946 WP_003406047.1.15958 WP_003406047.1.15973 WP_003406047.1.15987 WP_003406047.1.15993 WP_003406047.1.16009 WP_003406047.1.16025 WP_003406047.1.16043 WP_003406047.1.16055 WP_003406047.1.16066 WP_003406047.1.16069 WP_003406047.1.16077 WP_003406047.1.16106 WP_003406047.1.16108 WP_003406047.1.16130 WP_003406047.1.16136 WP_003406047.1.16139 WP_003406047.1.16141 WP_003406047.1.16143 WP_003406047.1.1630 WP_003406047.1.16318 WP_003406047.1.1632 WP_003406047.1.16327 WP_003406047.1.16334 WP_003406047.1.16341 WP_003406047.1.16345 WP_003406047.1.16374 WP_003406047.1.16384 WP_003406047.1.16386 WP_003406047.1.164 WP_003406047.1.1642 WP_003406047.1.16421 WP_003406047.1.16424 WP_003406047.1.16426 WP_003406047.1.16431 WP_003406047.1.16438 WP_003406047.1.1644 WP_003406047.1.16442 WP_003406047.1.16448 WP_003406047.1.16451 WP_003406047.1.16476 WP_003406047.1.16480 WP_003406047.1.16494 WP_003406047.1.1652 WP_003406047.1.16549 WP_003406047.1.16560 WP_003406047.1.16598 WP_003406047.1.16609 WP_003406047.1.16619 WP_003406047.1.16620 WP_003406047.1.16622 WP_003406047.1.16637 WP_003406047.1.1669 WP_003406047.1.16707 WP_003406047.1.16724 WP_003406047.1.16731 WP_003406047.1.16743 WP_003406047.1.1683 WP_003406047.1.16837 WP_003406047.1.16852 WP_003406047.1.16937 WP_003406047.1.16940 WP_003406047.1.16950 WP_003406047.1.16959 WP_003406047.1.16968 WP_003406047.1.1697 WP_003406047.1.16973 WP_003406047.1.16977 WP_003406047.1.16987 WP_003406047.1.17005 WP_003406047.1.17006 WP_003406047.1.17010 WP_003406047.1.17015 WP_003406047.1.17019 WP_003406047.1.17039 WP_003406047.1.17041 WP_003406047.1.17052 WP_003406047.1.17057 WP_003406047.1.17062 WP_003406047.1.1707 WP_003406047.1.17094 WP_003406047.1.17130 WP_003406047.1.17138 WP_003406047.1.17147 WP_003406047.1.17167 WP_003406047.1.17224 WP_003406047.1.17251 WP_003406047.1.17288 WP_003406047.1.17304 WP_003406047.1.17314 WP_003406047.1.17381 WP_003406047.1.17391 WP_003406047.1.17412 WP_003406047.1.1743 WP_003406047.1.17440 WP_003406047.1.17466 WP_003406047.1.17477 WP_003406047.1.17483 WP_003406047.1.17505 WP_003406047.1.17527 WP_003406047.1.17535 WP_003406047.1.17540 WP_003406047.1.17553 WP_003406047.1.17558 WP_003406047.1.17599 WP_003406047.1.17635 WP_003406047.1.17655 WP_003406047.1.17679 WP_003406047.1.1768 WP_003406047.1.17687 WP_003406047.1.17713 WP_003406047.1.17722 WP_003406047.1.17746 WP_003406047.1.17788 WP_003406047.1.17798 WP_003406047.1.17803 WP_003406047.1.17816 WP_003406047.1.17821 WP_003406047.1.17830 WP_003406047.1.17868 WP_003406047.1.17878 WP_003406047.1.17923 WP_003406047.1.1795 WP_003406047.1.17955 WP_003406047.1.17973 WP_003406047.1.18009 WP_003406047.1.18013 WP_003406047.1.18033 WP_003406047.1.18057 WP_003406047.1.18065 WP_003406047.1.18070 WP_003406047.1.18116 WP_003406047.1.18120 WP_003406047.1.18126 WP_003406047.1.1817 WP_003406047.1.18170 WP_003406047.1.18216 WP_003406047.1.18240 WP_003406047.1.18257 WP_003406047.1.18297 WP_003406047.1.18306 WP_003406047.1.18364 WP_003406047.1.18399 WP_003406047.1.18411 WP_003406047.1.18444 WP_003406047.1.18448 WP_003406047.1.18467 WP_003406047.1.18522 WP_003406047.1.18582 WP_003406047.1.18587 WP_003406047.1.186 WP_003406047.1.18601 WP_003406047.1.18639 WP_003406047.1.18646 WP_003406047.1.18647 WP_003406047.1.1868 WP_003406047.1.18694 WP_003406047.1.18710 WP_003406047.1.18751 WP_003406047.1.18781 WP_003406047.1.18793 WP_003406047.1.18804 WP_003406047.1.18827 WP_003406047.1.18838 WP_003406047.1.18849 WP_003406047.1.18856 WP_003406047.1.18945 WP_003406047.1.1898 WP_003406047.1.19005 WP_003406047.1.19056 WP_003406047.1.19063 WP_003406047.1.19066 WP_003406047.1.19071 WP_003406047.1.19085 WP_003406047.1.19094 WP_003406047.1.19144 WP_003406047.1.19159 WP_003406047.1.19193 WP_003406047.1.19231 WP_003406047.1.19243 WP_003406047.1.19264 WP_003406047.1.19295 WP_003406047.1.19307 WP_003406047.1.19326 WP_003406047.1.1933 WP_003406047.1.19364 WP_003406047.1.19382 WP_003406047.1.19400 WP_003406047.1.19426 WP_003406047.1.19429 WP_003406047.1.19464 WP_003406047.1.19480 WP_003406047.1.19512 WP_003406047.1.19553 WP_003406047.1.19562 WP_003406047.1.19564 WP_003406047.1.19568 WP_003406047.1.19572 WP_003406047.1.19595 WP_003406047.1.19596 WP_003406047.1.19600 WP_003406047.1.19630 WP_003406047.1.1967 WP_003406047.1.19694 WP_003406047.1.1970 WP_003406047.1.19707 WP_003406047.1.19742 WP_003406047.1.19785 WP_003406047.1.19820 WP_003406047.1.19868 WP_003406047.1.19874 WP_003406047.1.19890 WP_003406047.1.19900 WP_003406047.1.19922 WP_003406047.1.19936 WP_003406047.1.19949 WP_003406047.1.19960 WP_003406047.1.19964 WP_003406047.1.20007 WP_003406047.1.20016 WP_003406047.1.20028 WP_003406047.1.2003 WP_003406047.1.20037 WP_003406047.1.20039 WP_003406047.1.20082 WP_003406047.1.20085 WP_003406047.1.20097 WP_003406047.1.20116 WP_003406047.1.20130 WP_003406047.1.20140 WP_003406047.1.20141 WP_003406047.1.20158 WP_003406047.1.20239 WP_003406047.1.20243 WP_003406047.1.20259 WP_003406047.1.20262 WP_003406047.1.20268 WP_003406047.1.20272 WP_003406047.1.20280 WP_003406047.1.20294 WP_003406047.1.20300 WP_003406047.1.20309 WP_003406047.1.20322 WP_003406047.1.2037 WP_003406047.1.20372 WP_003406047.1.20381 WP_003406047.1.204 WP_003406047.1.20427 WP_003406047.1.20432 WP_003406047.1.20457 WP_003406047.1.20459 WP_003406047.1.20460 WP_003406047.1.20542 WP_003406047.1.20578 WP_003406047.1.20608 WP_003406047.1.20624 WP_003406047.1.20628 WP_003406047.1.2066 WP_003406047.1.20707 WP_003406047.1.20722 WP_003406047.1.20729 WP_003406047.1.20742 WP_003406047.1.20776 WP_003406047.1.20843 WP_003406047.1.20850 WP_003406047.1.2086 WP_003406047.1.20868 WP_003406047.1.20897 WP_003406047.1.20898 WP_003406047.1.2090 WP_003406047.1.20911 WP_003406047.1.20916 WP_003406047.1.20921 WP_003406047.1.20926 WP_003406047.1.20927 WP_003406047.1.20951 WP_003406047.1.20970 WP_003406047.1.2104 WP_003406047.1.21070 WP_003406047.1.21127 WP_003406047.1.21135 WP_003406047.1.21173 WP_003406047.1.21187 WP_003406047.1.212 WP_003406047.1.2120 WP_003406047.1.21218 WP_003406047.1.21219 WP_003406047.1.2123 WP_003406047.1.21231 WP_003406047.1.21234 WP_003406047.1.2126 WP_003406047.1.21292 WP_003406047.1.21307 WP_003406047.1.2131 WP_003406047.1.21311 WP_003406047.1.21321 WP_003406047.1.21365 WP_003406047.1.21392 WP_003406047.1.21397 WP_003406047.1.21403 WP_003406047.1.21415 WP_003406047.1.21418 WP_003406047.1.21430 WP_003406047.1.21434 WP_003406047.1.21444 WP_003406047.1.21468 WP_003406047.1.21498 WP_003406047.1.21509 WP_003406047.1.21513 WP_003406047.1.21560 WP_003406047.1.21565 WP_003406047.1.21586 WP_003406047.1.21591 WP_003406047.1.21594 WP_003406047.1.21602 WP_003406047.1.21615 WP_003406047.1.21638 WP_003406047.1.21639 WP_003406047.1.21655 WP_003406047.1.21658 WP_003406047.1.2168 WP_003406047.1.2174 WP_003406047.1.21741 WP_003406047.1.21742 WP_003406047.1.21777 WP_003406047.1.21786 WP_003406047.1.21795 WP_003406047.1.218 WP_003406047.1.21826 WP_003406047.1.21829 WP_003406047.1.21840 WP_003406047.1.21843 WP_003406047.1.21872 WP_003406047.1.21873 WP_003406047.1.2188 WP_003406047.1.21882 WP_003406047.1.21906 WP_003406047.1.21912 WP_003406047.1.2194 WP_003406047.1.21941 WP_003406047.1.21956 WP_003406047.1.21958 WP_003406047.1.21960 WP_003406047.1.21971 WP_003406047.1.21973 WP_003406047.1.21983 WP_003406047.1.22003 WP_003406047.1.22013 WP_003406047.1.22025 WP_003406047.1.22036 WP_003406047.1.22075 WP_003406047.1.22092 WP_003406047.1.2212 WP_003406047.1.22127 WP_003406047.1.22140 WP_003406047.1.22233 WP_003406047.1.22255 WP_003406047.1.22277 WP_003406047.1.22305 WP_003406047.1.22348 WP_003406047.1.22356 WP_003406047.1.2238 WP_003406047.1.22380 WP_003406047.1.22437 WP_003406047.1.22438 WP_003406047.1.22445 WP_003406047.1.22490 WP_003406047.1.22511 WP_003406047.1.22524 WP_003406047.1.2253 WP_003406047.1.22585 WP_003406047.1.22589 WP_003406047.1.22606 WP_003406047.1.22608 WP_003406047.1.22609 WP_003406047.1.22618 WP_003406047.1.2262 WP_003406047.1.22624 WP_003406047.1.22629 WP_003406047.1.22647 WP_003406047.1.22664 WP_003406047.1.22665 WP_003406047.1.22670 WP_003406047.1.22674 WP_003406047.1.22680 WP_003406047.1.22725 WP_003406047.1.22728 WP_003406047.1.22733 WP_003406047.1.22737 WP_003406047.1.2275 WP_003406047.1.22754 WP_003406047.1.22797 WP_003406047.1.22800 WP_003406047.1.22804 WP_003406047.1.22829 WP_003406047.1.22840 WP_003406047.1.22844 WP_003406047.1.22963 WP_003406047.1.22970 WP_003406047.1.22996 WP_003406047.1.22997 WP_003406047.1.22999 WP_003406047.1.23015 WP_003406047.1.23032 WP_003406047.1.231 WP_003406047.1.23101 WP_003406047.1.2312 WP_003406047.1.23140 WP_003406047.1.23153 WP_003406047.1.23171 WP_003406047.1.23199 WP_003406047.1.2320 WP_003406047.1.23204 WP_003406047.1.23216 WP_003406047.1.23229 WP_003406047.1.23233 WP_003406047.1.2326 WP_003406047.1.23261 WP_003406047.1.23272 WP_003406047.1.23289 WP_003406047.1.2329 WP_003406047.1.23308 WP_003406047.1.23316 WP_003406047.1.23321 WP_003406047.1.23325 WP_003406047.1.2339 WP_003406047.1.23406 WP_003406047.1.23438 WP_003406047.1.23445 WP_003406047.1.23447 WP_003406047.1.23452 WP_003406047.1.23461 WP_003406047.1.2349 WP_003406047.1.23496 WP_003406047.1.23497 WP_003406047.1.23506 WP_003406047.1.23530 WP_003406047.1.23539 WP_003406047.1.23546 WP_003406047.1.23551 WP_003406047.1.23573 WP_003406047.1.23583 WP_003406047.1.23588 WP_003406047.1.23628 WP_003406047.1.23677 WP_003406047.1.23683 WP_003406047.1.23692 WP_003406047.1.23694 WP_003406047.1.23699 WP_003406047.1.2371 WP_003406047.1.23803 WP_003406047.1.23807 WP_003406047.1.23825 WP_003406047.1.23832 WP_003406047.1.2384 WP_003406047.1.23843 WP_003406047.1.23863 WP_003406047.1.2387 WP_003406047.1.23894 WP_003406047.1.23993 WP_003406047.1.2400 WP_003406047.1.24007 WP_003406047.1.24008 WP_003406047.1.24046 WP_003406047.1.24057 WP_003406047.1.24062 WP_003406047.1.24113 WP_003406047.1.24119 WP_003406047.1.24140 WP_003406047.1.24176 WP_003406047.1.24190 WP_003406047.1.24202 WP_003406047.1.24244 WP_003406047.1.24261 WP_003406047.1.24284 WP_003406047.1.24294 WP_003406047.1.24357 WP_003406047.1.24396 WP_003406047.1.24414 WP_003406047.1.24423 WP_003406047.1.2443 WP_003406047.1.24446 WP_003406047.1.24461 WP_003406047.1.24500 WP_003406047.1.24507 WP_003406047.1.24509 WP_003406047.1.24529 WP_003406047.1.24553 WP_003406047.1.24599 WP_003406047.1.24638 WP_003406047.1.24648 WP_003406047.1.2466 WP_003406047.1.24767 WP_003406047.1.24824 WP_003406047.1.24831 WP_003406047.1.24840 WP_003406047.1.24848 WP_003406047.1.24857 WP_003406047.1.2487 WP_003406047.1.24893 WP_003406047.1.24907 WP_003406047.1.24933 WP_003406047.1.24956 WP_003406047.1.24958 WP_003406047.1.24985 WP_003406047.1.2499 WP_003406047.1.25004 WP_003406047.1.2505 WP_003406047.1.25051 WP_003406047.1.2507 WP_003406047.1.25096 WP_003406047.1.25103 WP_003406047.1.25129 WP_003406047.1.25171 WP_003406047.1.25184 WP_003406047.1.25247 WP_003406047.1.25252 WP_003406047.1.25278 WP_003406047.1.25283 WP_003406047.1.25309 WP_003406047.1.25313 WP_003406047.1.25338 WP_003406047.1.25342 WP_003406047.1.25343 WP_003406047.1.25367 WP_003406047.1.25393 WP_003406047.1.25406 WP_003406047.1.25435 WP_003406047.1.25437 WP_003406047.1.25445 WP_003406047.1.25473 WP_003406047.1.25504 WP_003406047.1.25513 WP_003406047.1.25542 WP_003406047.1.25579 WP_003406047.1.25594 WP_003406047.1.25606 WP_003406047.1.25645 WP_003406047.1.2566 WP_003406047.1.25673 WP_003406047.1.25674 WP_003406047.1.25693 WP_003406047.1.25699 WP_003406047.1.25727 WP_003406047.1.25736 WP_003406047.1.25738 WP_003406047.1.25756 WP_003406047.1.25759 WP_003406047.1.2580 WP_003406047.1.25813 WP_003406047.1.25854 WP_003406047.1.25874 WP_003406047.1.25885 WP_003406047.1.25892 WP_003406047.1.25906 WP_003406047.1.25914 WP_003406047.1.25916 WP_003406047.1.2594 WP_003406047.1.25954 WP_003406047.1.25965 WP_003406047.1.25972 WP_003406047.1.26017 WP_003406047.1.26032 WP_003406047.1.26072 WP_003406047.1.26089 WP_003406047.1.26097 WP_003406047.1.26098 WP_003406047.1.26108 WP_003406047.1.26109 WP_003406047.1.26118 WP_003406047.1.26126 WP_003406047.1.2614 WP_003406047.1.26168 WP_003406047.1.26182 WP_003406047.1.26190 WP_003406047.1.2620 WP_003406047.1.26234 WP_003406047.1.26243 WP_003406047.1.26265 WP_003406047.1.26267 WP_003406047.1.26292 WP_003406047.1.26310 WP_003406047.1.26328 WP_003406047.1.26349 WP_003406047.1.26366 WP_003406047.1.26374 WP_003406047.1.26407 WP_003406047.1.26412 WP_003406047.1.26454 WP_003406047.1.26464 WP_003406047.1.2653 WP_003406047.1.26560 WP_003406047.1.26571 WP_003406047.1.2659 WP_003406047.1.26597 WP_003406047.1.26603 WP_003406047.1.26629 WP_003406047.1.26651 WP_003406047.1.26702 WP_003406047.1.26707 WP_003406047.1.26710 WP_003406047.1.26719 WP_003406047.1.26737 WP_003406047.1.26738 WP_003406047.1.26745 WP_003406047.1.26756 WP_003406047.1.2676 WP_003406047.1.2677 WP_003406047.1.26779 WP_003406047.1.26780 WP_003406047.1.26854 WP_003406047.1.26868 WP_003406047.1.26876 WP_003406047.1.26888 WP_003406047.1.26914 WP_003406047.1.26945 WP_003406047.1.26959 WP_003406047.1.26969 WP_003406047.1.26984 WP_003406047.1.26992 WP_003406047.1.27017 WP_003406047.1.27045 WP_003406047.1.27074 WP_003406047.1.27075 WP_003406047.1.27128 WP_003406047.1.27130 WP_003406047.1.27139 WP_003406047.1.27152 WP_003406047.1.27162 WP_003406047.1.27164 WP_003406047.1.27193 WP_003406047.1.27235 WP_003406047.1.27254 WP_003406047.1.27278 WP_003406047.1.27343 WP_003406047.1.27352 WP_003406047.1.27369 WP_003406047.1.27391 WP_003406047.1.27398 WP_003406047.1.27402 WP_003406047.1.27410 WP_003406047.1.27411 WP_003406047.1.27449 WP_003406047.1.27460 WP_003406047.1.27463 WP_003406047.1.2749 WP_003406047.1.27492 WP_003406047.1.27528 WP_003406047.1.27541 WP_003406047.1.27576 WP_003406047.1.27582 WP_003406047.1.27596 WP_003406047.1.27607 WP_003406047.1.2766 WP_003406047.1.27724 WP_003406047.1.27730 WP_003406047.1.27736 WP_003406047.1.27743 WP_003406047.1.27750 WP_003406047.1.27771 WP_003406047.1.27779 WP_003406047.1.27795 WP_003406047.1.27803 WP_003406047.1.27819 WP_003406047.1.27835 WP_003406047.1.27915 WP_003406047.1.27935 WP_003406047.1.27962 WP_003406047.1.28053 WP_003406047.1.28106 WP_003406047.1.28131 WP_003406047.1.28142 WP_003406047.1.28159 WP_003406047.1.2816 WP_003406047.1.28161 WP_003406047.1.28192 WP_003406047.1.28202 WP_003406047.1.28241 WP_003406047.1.28242 WP_003406047.1.28251 WP_003406047.1.28255 WP_003406047.1.28269 WP_003406047.1.28276 WP_003406047.1.28293 WP_003406047.1.28331 WP_003406047.1.28367 WP_003406047.1.28378 WP_003406047.1.28391 WP_003406047.1.2842 WP_003406047.1.28448 WP_003406047.1.2847 WP_003406047.1.28471 WP_003406047.1.28473 WP_003406047.1.28497 WP_003406047.1.28530 WP_003406047.1.28545 WP_003406047.1.28561 WP_003406047.1.28567 WP_003406047.1.28585 WP_003406047.1.286 WP_003406047.1.28610 WP_003406047.1.28617 WP_003406047.1.28634 WP_003406047.1.28642 WP_003406047.1.28671 WP_003406047.1.28682 WP_003406047.1.28698 WP_003406047.1.28703 WP_003406047.1.28739 WP_003406047.1.28781 WP_003406047.1.28787 WP_003406047.1.28827 WP_003406047.1.28850 WP_003406047.1.28851 WP_003406047.1.28865 WP_003406047.1.28897 WP_003406047.1.28914 WP_003406047.1.28935 WP_003406047.1.28936 WP_003406047.1.28939 WP_003406047.1.28943 WP_003406047.1.28952 WP_003406047.1.28975 WP_003406047.1.2899 WP_003406047.1.28993 WP_003406047.1.29000 WP_003406047.1.2901 WP_003406047.1.29028 WP_003406047.1.29033 WP_003406047.1.29058 WP_003406047.1.29115 WP_003406047.1.2916 WP_003406047.1.29217 WP_003406047.1.29223 WP_003406047.1.29234 WP_003406047.1.29264 WP_003406047.1.29275 WP_003406047.1.29306 WP_003406047.1.29339 WP_003406047.1.29348 WP_003406047.1.29364 WP_003406047.1.29367 WP_003406047.1.2938 WP_003406047.1.29399 WP_003406047.1.29426 WP_003406047.1.2944 WP_003406047.1.29449 WP_003406047.1.29450 WP_003406047.1.29452 WP_003406047.1.2949 WP_003406047.1.29510 WP_003406047.1.29515 WP_003406047.1.29525 WP_003406047.1.2953 WP_003406047.1.29559 WP_003406047.1.29587 WP_003406047.1.2959 WP_003406047.1.29592 WP_003406047.1.29599 WP_003406047.1.29611 WP_003406047.1.29632 WP_003406047.1.29649 WP_003406047.1.2965 WP_003406047.1.29659 WP_003406047.1.2969 WP_003406047.1.29696 WP_003406047.1.29698 WP_003406047.1.29718 WP_003406047.1.29745 WP_003406047.1.29747 WP_003406047.1.29769 WP_003406047.1.29825 WP_003406047.1.29847 WP_003406047.1.29869 WP_003406047.1.29883 WP_003406047.1.29890 WP_003406047.1.299 WP_003406047.1.29931 WP_003406047.1.29960 WP_003406047.1.30014 WP_003406047.1.3004 WP_003406047.1.30040 WP_003406047.1.30043 WP_003406047.1.30074 WP_003406047.1.30097 WP_003406047.1.30101 WP_003406047.1.30106 WP_003406047.1.30114 WP_003406047.1.30126 WP_003406047.1.30131 WP_003406047.1.30138 WP_003406047.1.30139 WP_003406047.1.30145 WP_003406047.1.30211 WP_003406047.1.30224 WP_003406047.1.30235 WP_003406047.1.30237 WP_003406047.1.3027 WP_003406047.1.30279 WP_003406047.1.30282 WP_003406047.1.30283 WP_003406047.1.30288 WP_003406047.1.30291 WP_003406047.1.30363 WP_003406047.1.30374 WP_003406047.1.30404 WP_003406047.1.3043 WP_003406047.1.30433 WP_003406047.1.30438 WP_003406047.1.30462 WP_003406047.1.30464 WP_003406047.1.30468 WP_003406047.1.30500 WP_003406047.1.3057 WP_003406047.1.30574 WP_003406047.1.30628 WP_003406047.1.30641 WP_003406047.1.30642 WP_003406047.1.30661 WP_003406047.1.30669 WP_003406047.1.30683 WP_003406047.1.30699 WP_003406047.1.30709 WP_003406047.1.30713 WP_003406047.1.30716 WP_003406047.1.30719 WP_003406047.1.30730 WP_003406047.1.30732 WP_003406047.1.30736 WP_003406047.1.30760 WP_003406047.1.30791 WP_003406047.1.308 WP_003406047.1.30818 WP_003406047.1.30824 WP_003406047.1.30848 WP_003406047.1.30877 WP_003406047.1.30888 WP_003406047.1.30901 WP_003406047.1.30903 WP_003406047.1.30912 WP_003406047.1.30913 WP_003406047.1.30914 WP_003406047.1.30919 WP_003406047.1.30977 WP_003406047.1.3100 WP_003406047.1.31002 WP_003406047.1.3101 WP_003406047.1.31034 WP_003406047.1.31047 WP_003406047.1.31070 WP_003406047.1.31102 WP_003406047.1.31127 WP_003406047.1.31184 WP_003406047.1.31199 WP_003406047.1.31226 WP_003406047.1.31230 WP_003406047.1.31233 WP_003406047.1.31263 WP_003406047.1.31264 WP_003406047.1.31270 WP_003406047.1.31287 WP_003406047.1.31290 WP_003406047.1.31304 WP_003406047.1.31346 WP_003406047.1.31348 WP_003406047.1.31354 WP_003406047.1.31390 WP_003406047.1.31414 WP_003406047.1.31428 WP_003406047.1.3143 WP_003406047.1.31458 WP_003406047.1.31483 WP_003406047.1.3149 WP_003406047.1.31498 WP_003406047.1.31507 WP_003406047.1.31537 WP_003406047.1.31548 WP_003406047.1.31569 WP_003406047.1.31573 WP_003406047.1.316 WP_003406047.1.31629 WP_003406047.1.31666 WP_003406047.1.31693 WP_003406047.1.31703 WP_003406047.1.31744 WP_003406047.1.31745 WP_003406047.1.31770 WP_003406047.1.31776 WP_003406047.1.31783 WP_003406047.1.318 WP_003406047.1.3184 WP_003406047.1.31840 WP_003406047.1.31880 WP_003406047.1.31911 WP_003406047.1.31930 WP_003406047.1.31932 WP_003406047.1.31955 WP_003406047.1.31985 WP_003406047.1.31991 WP_003406047.1.31995 WP_003406047.1.32004 WP_003406047.1.32039 WP_003406047.1.3204 WP_003406047.1.32045 WP_003406047.1.32071 WP_003406047.1.32098 WP_003406047.1.32132 WP_003406047.1.32157 WP_003406047.1.32164 WP_003406047.1.32179 WP_003406047.1.32198 WP_003406047.1.32297 WP_003406047.1.32317 WP_003406047.1.32383 WP_003406047.1.32400 WP_003406047.1.32403 WP_003406047.1.32416 WP_003406047.1.32421 WP_003406047.1.32433 WP_003406047.1.32461 WP_003406047.1.32482 WP_003406047.1.32503 WP_003406047.1.32556 WP_003406047.1.32562 WP_003406047.1.32569 WP_003406047.1.32592 WP_003406047.1.32620 WP_003406047.1.32647 WP_003406047.1.32653 WP_003406047.1.32654 WP_003406047.1.3268 WP_003406047.1.32695 WP_003406047.1.32706 WP_003406047.1.32716 WP_003406047.1.32738 WP_003406047.1.32752 WP_003406047.1.32780 WP_003406047.1.32781 WP_003406047.1.32793 WP_003406047.1.32799 WP_003406047.1.32822 WP_003406047.1.32833 WP_003406047.1.32862 WP_003406047.1.32880 WP_003406047.1.32909 WP_003406047.1.32935 WP_003406047.1.32974 WP_003406047.1.33007 WP_003406047.1.3302 WP_003406047.1.33028 WP_003406047.1.33035 WP_003406047.1.33044 WP_003406047.1.33054 WP_003406047.1.33082 WP_003406047.1.33141 WP_003406047.1.33148 WP_003406047.1.33155 WP_003406047.1.33168 WP_003406047.1.3321 WP_003406047.1.33215 WP_003406047.1.3325 WP_003406047.1.3327 WP_003406047.1.33278 WP_003406047.1.33288 WP_003406047.1.33305 WP_003406047.1.3331 WP_003406047.1.33319 WP_003406047.1.3333 WP_003406047.1.33393 WP_003406047.1.33403 WP_003406047.1.33452 WP_003406047.1.33467 WP_003406047.1.33477 WP_003406047.1.3349 WP_003406047.1.33519 WP_003406047.1.33542 WP_003406047.1.33601 WP_003406047.1.33602 WP_003406047.1.33633 WP_003406047.1.33646 WP_003406047.1.33673 WP_003406047.1.3369 WP_003406047.1.33705 WP_003406047.1.33762 WP_003406047.1.33783 WP_003406047.1.33789 WP_003406047.1.3383 WP_003406047.1.33832 WP_003406047.1.33839 WP_003406047.1.33848 WP_003406047.1.3387 WP_003406047.1.33886 WP_003406047.1.33895 WP_003406047.1.33906 WP_003406047.1.33912 WP_003406047.1.33954 WP_003406047.1.3399 WP_003406047.1.34042 WP_003406047.1.3405 WP_003406047.1.34055 WP_003406047.1.34056 WP_003406047.1.34065 WP_003406047.1.3408 WP_003406047.1.34090 WP_003406047.1.34109 WP_003406047.1.34111 WP_003406047.1.34131 WP_003406047.1.34152 WP_003406047.1.34153 WP_003406047.1.34163 WP_003406047.1.34181 WP_003406047.1.34197 WP_003406047.1.34198 WP_003406047.1.34215 WP_003406047.1.34219 WP_003406047.1.34255 WP_003406047.1.34260 WP_003406047.1.34275 WP_003406047.1.343 WP_003406047.1.34347 WP_003406047.1.34358 WP_003406047.1.34392 WP_003406047.1.344 WP_003406047.1.34428 WP_003406047.1.3443 WP_003406047.1.34435 WP_003406047.1.34446 WP_003406047.1.34499 WP_003406047.1.34505 WP_003406047.1.34516 WP_003406047.1.34529 WP_003406047.1.34551 WP_003406047.1.34563 WP_003406047.1.34576 WP_003406047.1.34588 WP_003406047.1.34596 WP_003406047.1.34599 WP_003406047.1.34639 WP_003406047.1.34673 WP_003406047.1.34724 WP_003406047.1.34740 WP_003406047.1.34755 WP_003406047.1.34777 WP_003406047.1.34783 WP_003406047.1.34841 WP_003406047.1.34908 WP_003406047.1.3492 WP_003406047.1.34933 WP_003406047.1.34945 WP_003406047.1.34946 WP_003406047.1.34954 WP_003406047.1.34960 WP_003406047.1.34961 WP_003406047.1.34963 WP_003406047.1.34965 WP_003406047.1.34968 WP_003406047.1.35023 WP_003406047.1.35069 WP_003406047.1.35072 WP_003406047.1.35078 WP_003406047.1.35100 WP_003406047.1.35146 WP_003406047.1.35156 WP_003406047.1.35160 WP_003406047.1.35162 WP_003406047.1.35173 WP_003406047.1.35176 WP_003406047.1.3520 WP_003406047.1.35213 WP_003406047.1.35221 WP_003406047.1.35246 WP_003406047.1.35278 WP_003406047.1.35301 WP_003406047.1.35311 WP_003406047.1.35312 WP_003406047.1.35317 WP_003406047.1.35319 WP_003406047.1.35347 WP_003406047.1.35363 WP_003406047.1.35382 WP_003406047.1.35385 WP_003406047.1.35396 WP_003406047.1.35397 WP_003406047.1.35426 WP_003406047.1.35439 WP_003406047.1.35455 WP_003406047.1.3548 WP_003406047.1.35484 WP_003406047.1.35492 WP_003406047.1.3553 WP_003406047.1.35553 WP_003406047.1.35555 WP_003406047.1.35561 WP_003406047.1.35602 WP_003406047.1.35610 WP_003406047.1.35635 WP_003406047.1.35657 WP_003406047.1.35680 WP_003406047.1.35687 WP_003406047.1.35689 WP_003406047.1.35707 WP_003406047.1.35732 WP_003406047.1.35754 WP_003406047.1.35767 WP_003406047.1.35770 WP_003406047.1.35771 WP_003406047.1.35780 WP_003406047.1.35805 WP_003406047.1.35811 WP_003406047.1.35821 WP_003406047.1.3584 WP_003406047.1.35848 WP_003406047.1.35864 WP_003406047.1.35874 WP_003406047.1.35876 WP_003406047.1.35897 WP_003406047.1.35899 WP_003406047.1.3593 WP_003406047.1.35954 WP_003406047.1.36005 WP_003406047.1.36014 WP_003406047.1.36023 WP_003406047.1.36051 WP_003406047.1.36053 WP_003406047.1.36075 WP_003406047.1.36089 WP_003406047.1.36097 WP_003406047.1.36116 WP_003406047.1.36145 WP_003406047.1.36156 WP_003406047.1.36205 WP_003406047.1.36228 WP_003406047.1.36246 WP_003406047.1.36252 WP_003406047.1.36260 WP_003406047.1.36270 WP_003406047.1.36271 WP_003406047.1.36303 WP_003406047.1.36309 WP_003406047.1.36315 WP_003406047.1.36319 WP_003406047.1.36321 WP_003406047.1.36326 WP_003406047.1.3634 WP_003406047.1.36356 WP_003406047.1.36357 WP_003406047.1.3636 WP_003406047.1.36385 WP_003406047.1.36399 WP_003406047.1.36436 WP_003406047.1.36465 WP_003406047.1.36469 WP_003406047.1.36473 WP_003406047.1.36485 WP_003406047.1.36508 WP_003406047.1.36540 WP_003406047.1.36561 WP_003406047.1.36571 WP_003406047.1.36573 WP_003406047.1.36578 WP_003406047.1.36597 WP_003406047.1.36614 WP_003406047.1.36657 WP_003406047.1.36674 WP_003406047.1.36720 WP_003406047.1.36727 WP_003406047.1.36733 WP_003406047.1.36785 WP_003406047.1.36810 WP_003406047.1.36844 WP_003406047.1.36862 WP_003406047.1.36893 WP_003406047.1.36901 WP_003406047.1.36921 WP_003406047.1.36935 WP_003406047.1.36941 WP_003406047.1.3695 WP_003406047.1.36951 WP_003406047.1.36968 WP_003406047.1.3700 WP_003406047.1.37004 WP_003406047.1.37012 WP_003406047.1.37071 WP_003406047.1.37088 WP_003406047.1.37131 WP_003406047.1.37157 WP_003406047.1.37175 WP_003406047.1.37188 WP_003406047.1.37213 WP_003406047.1.37229 WP_003406047.1.3724 WP_003406047.1.37277 WP_003406047.1.37305 WP_003406047.1.37330 WP_003406047.1.37389 WP_003406047.1.37440 WP_003406047.1.37459 WP_003406047.1.37468 WP_003406047.1.37475 WP_003406047.1.37484 WP_003406047.1.37601 WP_003406047.1.37612 WP_003406047.1.37632 WP_003406047.1.37643 WP_003406047.1.37655 WP_003406047.1.37660 WP_003406047.1.37674 WP_003406047.1.37700 WP_003406047.1.37701 WP_003406047.1.37709 WP_003406047.1.37711 WP_003406047.1.37721 WP_003406047.1.37722 WP_003406047.1.37747 WP_003406047.1.37765 WP_003406047.1.37804 WP_003406047.1.37809 WP_003406047.1.37859 WP_003406047.1.37877 WP_003406047.1.37912 WP_003406047.1.37913 WP_003406047.1.37943 WP_003406047.1.37950 WP_003406047.1.37973 WP_003406047.1.37975 WP_003406047.1.37983 WP_003406047.1.38 WP_003406047.1.38002 WP_003406047.1.3802 WP_003406047.1.38039 WP_003406047.1.38040 WP_003406047.1.38067 WP_003406047.1.38068 WP_003406047.1.38135 WP_003406047.1.38138 WP_003406047.1.38144 WP_003406047.1.38158 WP_003406047.1.38159 WP_003406047.1.38210 WP_003406047.1.38233 WP_003406047.1.38240 WP_003406047.1.38299 WP_003406047.1.38332 WP_003406047.1.38347 WP_003406047.1.38354 WP_003406047.1.38380 WP_003406047.1.38384 WP_003406047.1.38389 WP_003406047.1.38398 WP_003406047.1.38402 WP_003406047.1.38418 WP_003406047.1.38421 WP_003406047.1.38466 WP_003406047.1.38477 WP_003406047.1.38483 WP_003406047.1.3849 WP_003406047.1.385 WP_003406047.1.38535 WP_003406047.1.38594 WP_003406047.1.38601 WP_003406047.1.38611 WP_003406047.1.38638 WP_003406047.1.38639 WP_003406047.1.38646 WP_003406047.1.38648 WP_003406047.1.38654 WP_003406047.1.38659 WP_003406047.1.38660 WP_003406047.1.38666 WP_003406047.1.38671 WP_003406047.1.38672 WP_003406047.1.38677 WP_003406047.1.38750 WP_003406047.1.38812 WP_003406047.1.38821 WP_003406047.1.38844 WP_003406047.1.38863 WP_003406047.1.38873 WP_003406047.1.3889 WP_003406047.1.38894 WP_003406047.1.38909 WP_003406047.1.38939 WP_003406047.1.38974 WP_003406047.1.38975 WP_003406047.1.38991 WP_003406047.1.39025 WP_003406047.1.39070 WP_003406047.1.39072 WP_003406047.1.39095 WP_003406047.1.39106 WP_003406047.1.39165 WP_003406047.1.39174 WP_003406047.1.39176 WP_003406047.1.39178 WP_003406047.1.39190 WP_003406047.1.39201 WP_003406047.1.39207 WP_003406047.1.39211 WP_003406047.1.39239 WP_003406047.1.39252 WP_003406047.1.39288 WP_003406047.1.39295 WP_003406047.1.39306 WP_003406047.1.39359 WP_003406047.1.39364 WP_003406047.1.39400 WP_003406047.1.39447 WP_003406047.1.3945 WP_003406047.1.39450 WP_003406047.1.39455 WP_003406047.1.3949 WP_003406047.1.39521 WP_003406047.1.39560 WP_003406047.1.39592 WP_003406047.1.39593 WP_003406047.1.396 WP_003406047.1.3960 WP_003406047.1.39616 WP_003406047.1.39654 WP_003406047.1.39657 WP_003406047.1.39661 WP_003406047.1.39674 WP_003406047.1.39678 WP_003406047.1.3968 WP_003406047.1.39694 WP_003406047.1.3971 WP_003406047.1.39718 WP_003406047.1.39728 WP_003406047.1.39739 WP_003406047.1.39748 WP_003406047.1.39751 WP_003406047.1.39759 WP_003406047.1.39801 WP_003406047.1.39804 WP_003406047.1.39848 WP_003406047.1.39877 WP_003406047.1.39925 WP_003406047.1.3994 WP_003406047.1.39959 WP_003406047.1.3996 WP_003406047.1.39980 WP_003406047.1.40000 WP_003406047.1.40028 WP_003406047.1.40029 WP_003406047.1.4003 WP_003406047.1.40094 WP_003406047.1.40096 WP_003406047.1.40150 WP_003406047.1.40156 WP_003406047.1.40174 WP_003406047.1.40186 WP_003406047.1.40276 WP_003406047.1.40277 WP_003406047.1.40323 WP_003406047.1.40336 WP_003406047.1.40353 WP_003406047.1.4036 WP_003406047.1.40372 WP_003406047.1.40402 WP_003406047.1.40413 WP_003406047.1.40440 WP_003406047.1.40446 WP_003406047.1.40451 WP_003406047.1.40455 WP_003406047.1.40523 WP_003406047.1.40543 WP_003406047.1.40641 WP_003406047.1.40646 WP_003406047.1.40651 WP_003406047.1.40653 WP_003406047.1.4067 WP_003406047.1.40705 WP_003406047.1.40723 WP_003406047.1.40731 WP_003406047.1.40735 WP_003406047.1.40795 WP_003406047.1.40799 WP_003406047.1.40876 WP_003406047.1.40881 WP_003406047.1.40922 WP_003406047.1.40948 WP_003406047.1.4095 WP_003406047.1.40956 WP_003406047.1.40957 WP_003406047.1.40964 WP_003406047.1.4097 WP_003406047.1.410 WP_003406047.1.41000 WP_003406047.1.41055 WP_003406047.1.41108 WP_003406047.1.41123 WP_003406047.1.41177 WP_003406047.1.41202 WP_003406047.1.41219 WP_003406047.1.41231 WP_003406047.1.41249 WP_003406047.1.4127 WP_003406047.1.41296 WP_003406047.1.41355 WP_003406047.1.41376 WP_003406047.1.41430 WP_003406047.1.41447 WP_003406047.1.41469 WP_003406047.1.41504 WP_003406047.1.41553 WP_003406047.1.41564 WP_003406047.1.41583 WP_003406047.1.41616 WP_003406047.1.41632 WP_003406047.1.41635 WP_003406047.1.41636 WP_003406047.1.41648 WP_003406047.1.41660 WP_003406047.1.41685 WP_003406047.1.41695 WP_003406047.1.41704 WP_003406047.1.4171 WP_003406047.1.41719 WP_003406047.1.41733 WP_003406047.1.41744 WP_003406047.1.41774 WP_003406047.1.41803 WP_003406047.1.41820 WP_003406047.1.41828 WP_003406047.1.41829 WP_003406047.1.41860 WP_003406047.1.41912 WP_003406047.1.41921 WP_003406047.1.41933 WP_003406047.1.41944 WP_003406047.1.42043 WP_003406047.1.42075 WP_003406047.1.42078 WP_003406047.1.42094 WP_003406047.1.42112 WP_003406047.1.4212 WP_003406047.1.42122 WP_003406047.1.42134 WP_003406047.1.42183 WP_003406047.1.42188 WP_003406047.1.42201 WP_003406047.1.42202 WP_003406047.1.42208 WP_003406047.1.42247 WP_003406047.1.42255 WP_003406047.1.42273 WP_003406047.1.42278 WP_003406047.1.42304 WP_003406047.1.42309 WP_003406047.1.42370 WP_003406047.1.42385 WP_003406047.1.42400 WP_003406047.1.42409 WP_003406047.1.42414 WP_003406047.1.42417 WP_003406047.1.42430 WP_003406047.1.42461 WP_003406047.1.42465 WP_003406047.1.42473 WP_003406047.1.42474 WP_003406047.1.4248 WP_003406047.1.42494 WP_003406047.1.42519 WP_003406047.1.42534 WP_003406047.1.4255 WP_003406047.1.42562 WP_003406047.1.42568 WP_003406047.1.42570 WP_003406047.1.42618 WP_003406047.1.42660 WP_003406047.1.42695 WP_003406047.1.42704 WP_003406047.1.42705 WP_003406047.1.42722 WP_003406047.1.42777 WP_003406047.1.42782 WP_003406047.1.42835 WP_003406047.1.42839 WP_003406047.1.42842 WP_003406047.1.42905 WP_003406047.1.42916 WP_003406047.1.42930 WP_003406047.1.42971 WP_003406047.1.43005 WP_003406047.1.43009 WP_003406047.1.43053 WP_003406047.1.43082 WP_003406047.1.43087 WP_003406047.1.43098 WP_003406047.1.43208 WP_003406047.1.43236 WP_003406047.1.43246 WP_003406047.1.43255 WP_003406047.1.43266 WP_003406047.1.43269 WP_003406047.1.43273 WP_003406047.1.43296 WP_003406047.1.43306 WP_003406047.1.4335 WP_003406047.1.43368 WP_003406047.1.43395 WP_003406047.1.43462 WP_003406047.1.43475 WP_003406047.1.43478 WP_003406047.1.43484 WP_003406047.1.43557 WP_003406047.1.43578 WP_003406047.1.43588 WP_003406047.1.43643 WP_003406047.1.43664 WP_003406047.1.43684 WP_003406047.1.43686 WP_003406047.1.43706 WP_003406047.1.43716 WP_003406047.1.4377 WP_003406047.1.43781 WP_003406047.1.43794 WP_003406047.1.43815 WP_003406047.1.43846 WP_003406047.1.43861 WP_003406047.1.43863 WP_003406047.1.43866 WP_003406047.1.43872 WP_003406047.1.43885 WP_003406047.1.4390 WP_003406047.1.43902 WP_003406047.1.43921 WP_003406047.1.43936 WP_003406047.1.43937 WP_003406047.1.43960 WP_003406047.1.43965 WP_003406047.1.4399 WP_003406047.1.43993 WP_003406047.1.43996 WP_003406047.1.44 WP_003406047.1.44001 WP_003406047.1.44008 WP_003406047.1.44016 WP_003406047.1.44033 WP_003406047.1.44037 WP_003406047.1.44041 WP_003406047.1.44070 WP_003406047.1.44071 WP_003406047.1.44076 WP_003406047.1.44104 WP_003406047.1.44111 WP_003406047.1.44124 WP_003406047.1.44169 WP_003406047.1.44219 WP_003406047.1.44237 WP_003406047.1.44277 WP_003406047.1.44279 WP_003406047.1.44336 WP_003406047.1.44355 WP_003406047.1.44358 WP_003406047.1.4438 WP_003406047.1.44392 WP_003406047.1.4441 WP_003406047.1.44415 WP_003406047.1.44464 WP_003406047.1.44466 WP_003406047.1.44489 WP_003406047.1.44492 WP_003406047.1.44494 WP_003406047.1.44500 WP_003406047.1.44519 WP_003406047.1.44526 WP_003406047.1.44534 WP_003406047.1.44562 WP_003406047.1.44589 WP_003406047.1.44597 WP_003406047.1.44600 WP_003406047.1.44602 WP_003406047.1.44615 WP_003406047.1.4464 WP_003406047.1.44651 WP_003406047.1.44659 WP_003406047.1.44665 WP_003406047.1.44694 WP_003406047.1.44700 WP_003406047.1.44713 WP_003406047.1.44735 WP_003406047.1.44740 WP_003406047.1.44757 WP_003406047.1.4476 WP_003406047.1.44761 WP_003406047.1.44767 WP_003406047.1.44776 WP_003406047.1.44779 WP_003406047.1.44786 WP_003406047.1.44808 WP_003406047.1.44864 WP_003406047.1.44901 WP_003406047.1.44908 WP_003406047.1.44913 WP_003406047.1.4492 WP_003406047.1.44939 WP_003406047.1.44979 WP_003406047.1.44981 WP_003406047.1.45011 WP_003406047.1.4504 WP_003406047.1.45066 WP_003406047.1.45081 WP_003406047.1.45113 WP_003406047.1.45129 WP_003406047.1.45135 WP_003406047.1.45147 WP_003406047.1.45168 WP_003406047.1.4517 WP_003406047.1.45181 WP_003406047.1.45185 WP_003406047.1.45192 WP_003406047.1.45200 WP_003406047.1.45205 WP_003406047.1.45211 WP_003406047.1.45249 WP_003406047.1.4526 WP_003406047.1.45286 WP_003406047.1.45326 WP_003406047.1.45347 WP_003406047.1.45374 WP_003406047.1.45390 WP_003406047.1.454 WP_003406047.1.45407 WP_003406047.1.45451 WP_003406047.1.45453 WP_003406047.1.45460 WP_003406047.1.45463 WP_003406047.1.45470 WP_003406047.1.45474 WP_003406047.1.45491 WP_003406047.1.45510 WP_003406047.1.45563 WP_003406047.1.45584 WP_003406047.1.45590 WP_003406047.1.45619 WP_003406047.1.45626 WP_003406047.1.45631 WP_003406047.1.45666 WP_003406047.1.45697 WP_003406047.1.4571 WP_003406047.1.45731 WP_003406047.1.45743 WP_003406047.1.45765 WP_003406047.1.45776 WP_003406047.1.45783 WP_003406047.1.45815 WP_003406047.1.45849 WP_003406047.1.45867 WP_003406047.1.45884 WP_003406047.1.4590 WP_003406047.1.45923 WP_003406047.1.45926 WP_003406047.1.45963 WP_003406047.1.45989 WP_003406047.1.45992 WP_003406047.1.46025 WP_003406047.1.46083 WP_003406047.1.46090 WP_003406047.1.46092 WP_003406047.1.46100 WP_003406047.1.46101 WP_003406047.1.46103 WP_003406047.1.46107 WP_003406047.1.46127 WP_003406047.1.46128 WP_003406047.1.46129 WP_003406047.1.46141 WP_003406047.1.46150 WP_003406047.1.46201 WP_003406047.1.46226 WP_003406047.1.4624 WP_003406047.1.46253 WP_003406047.1.46268 WP_003406047.1.46285 WP_003406047.1.46300 WP_003406047.1.46313 WP_003406047.1.46336 WP_003406047.1.46365 WP_003406047.1.46370 WP_003406047.1.46381 WP_003406047.1.46402 WP_003406047.1.46411 WP_003406047.1.4644 WP_003406047.1.46442 WP_003406047.1.46453 WP_003406047.1.46478 WP_003406047.1.46492 WP_003406047.1.46521 WP_003406047.1.4653 WP_003406047.1.46532 WP_003406047.1.46539 WP_003406047.1.46568 WP_003406047.1.46585 WP_003406047.1.46609 WP_003406047.1.46613 WP_003406047.1.46625 WP_003406047.1.46724 WP_003406047.1.46758 WP_003406047.1.46773 WP_003406047.1.46777 WP_003406047.1.46786 WP_003406047.1.46792 WP_003406047.1.46847 WP_003406047.1.46851 WP_003406047.1.4687 WP_003406047.1.46897 WP_003406047.1.46936 WP_003406047.1.46980 WP_003406047.1.47011 WP_003406047.1.47012 WP_003406047.1.47066 WP_003406047.1.47077 WP_003406047.1.47083 WP_003406047.1.47106 WP_003406047.1.47142 WP_003406047.1.47147 WP_003406047.1.47166 WP_003406047.1.47178 WP_003406047.1.47179 WP_003406047.1.47194 WP_003406047.1.47207 WP_003406047.1.47210 WP_003406047.1.47261 WP_003406047.1.47262 WP_003406047.1.47402 WP_003406047.1.47423 WP_003406047.1.47467 WP_003406047.1.47502 WP_003406047.1.4751 WP_003406047.1.47511 WP_003406047.1.47537 WP_003406047.1.47540 WP_003406047.1.47568 WP_003406047.1.47572 WP_003406047.1.47588 WP_003406047.1.47636 WP_003406047.1.4764 WP_003406047.1.47653 WP_003406047.1.47679 WP_003406047.1.47681 WP_003406047.1.47690 WP_003406047.1.4771 WP_003406047.1.47717 WP_003406047.1.47743 WP_003406047.1.47754 WP_003406047.1.47773 WP_003406047.1.47776 WP_003406047.1.47780 WP_003406047.1.47805 WP_003406047.1.47832 WP_003406047.1.47847 WP_003406047.1.47858 WP_003406047.1.47861 WP_003406047.1.47868 WP_003406047.1.47893 WP_003406047.1.479 WP_003406047.1.47913 WP_003406047.1.47926 WP_003406047.1.4794 WP_003406047.1.47943 WP_003406047.1.47944 WP_003406047.1.47959 WP_003406047.1.47974 WP_003406047.1.47993 WP_003406047.1.48004 WP_003406047.1.48039 WP_003406047.1.48050 WP_003406047.1.48084 WP_003406047.1.48097 WP_003406047.1.48101 WP_003406047.1.48109 WP_003406047.1.4813 WP_003406047.1.48130 WP_003406047.1.48135 WP_003406047.1.48143 WP_003406047.1.48152 WP_003406047.1.48155 WP_003406047.1.48173 WP_003406047.1.48177 WP_003406047.1.48185 WP_003406047.1.48204 WP_003406047.1.48219 WP_003406047.1.4823 WP_003406047.1.48240 WP_003406047.1.48256 WP_003406047.1.48264 WP_003406047.1.48287 WP_003406047.1.48330 WP_003406047.1.48333 WP_003406047.1.48348 WP_003406047.1.48354 WP_003406047.1.48372 WP_003406047.1.48383 WP_003406047.1.48388 WP_003406047.1.48419 WP_003406047.1.48423 WP_003406047.1.48443 WP_003406047.1.48450 WP_003406047.1.48462 WP_003406047.1.48543 WP_003406047.1.48550 WP_003406047.1.48605 WP_003406047.1.48618 WP_003406047.1.4863 WP_003406047.1.48648 WP_003406047.1.48658 WP_003406047.1.48666 WP_003406047.1.48687 WP_003406047.1.48779 WP_003406047.1.4878 WP_003406047.1.48798 WP_003406047.1.48802 WP_003406047.1.48826 WP_003406047.1.48831 WP_003406047.1.48843 WP_003406047.1.48857 WP_003406047.1.4890 WP_003406047.1.48946 WP_003406047.1.48979 WP_003406047.1.49017 WP_003406047.1.49048 WP_003406047.1.49059 WP_003406047.1.4906 WP_003406047.1.4907 WP_003406047.1.49103 WP_003406047.1.49110 WP_003406047.1.49111 WP_003406047.1.49112 WP_003406047.1.4919 WP_003406047.1.49251 WP_003406047.1.49254 WP_003406047.1.49263 WP_003406047.1.49291 WP_003406047.1.49296 WP_003406047.1.49337 WP_003406047.1.49419 WP_003406047.1.49426 WP_003406047.1.49437 WP_003406047.1.49439 WP_003406047.1.49474 WP_003406047.1.49506 WP_003406047.1.49523 WP_003406047.1.49526 WP_003406047.1.49532 WP_003406047.1.49588 WP_003406047.1.4959 WP_003406047.1.49678 WP_003406047.1.49687 WP_003406047.1.49699 WP_003406047.1.49709 WP_003406047.1.4971 WP_003406047.1.4972 WP_003406047.1.49736 WP_003406047.1.49746 WP_003406047.1.49764 WP_003406047.1.49773 WP_003406047.1.49796 WP_003406047.1.49814 WP_003406047.1.49815 WP_003406047.1.49816 WP_003406047.1.49839 WP_003406047.1.49857 WP_003406047.1.49878 WP_003406047.1.49880 WP_003406047.1.49944 WP_003406047.1.4999 WP_003406047.1.49990 WP_003406047.1.50068 WP_003406047.1.50077 WP_003406047.1.50081 WP_003406047.1.50122 WP_003406047.1.50126 WP_003406047.1.50149 WP_003406047.1.50162 WP_003406047.1.5018 WP_003406047.1.50194 WP_003406047.1.50218 WP_003406047.1.50235 WP_003406047.1.50249 WP_003406047.1.50265 WP_003406047.1.50271 WP_003406047.1.50324 WP_003406047.1.50347 WP_003406047.1.50372 WP_003406047.1.50398 WP_003406047.1.50407 WP_003406047.1.50444 WP_003406047.1.50466 WP_003406047.1.50472 WP_003406047.1.5048 WP_003406047.1.50498 WP_003406047.1.5050 WP_003406047.1.50540 WP_003406047.1.50554 WP_003406047.1.50557 WP_003406047.1.50601 WP_003406047.1.50610 WP_003406047.1.50633 WP_003406047.1.50655 WP_003406047.1.50659 WP_003406047.1.50683 WP_003406047.1.50689 WP_003406047.1.50692 WP_003406047.1.50714 WP_003406047.1.50729 WP_003406047.1.50756 WP_003406047.1.50794 WP_003406047.1.50841 WP_003406047.1.50860 WP_003406047.1.50868 WP_003406047.1.50877 WP_003406047.1.5096 WP_003406047.1.50981 WP_003406047.1.50987 WP_003406047.1.51003 WP_003406047.1.51009 WP_003406047.1.51037 WP_003406047.1.51074 WP_003406047.1.51082 WP_003406047.1.51101 WP_003406047.1.51116 WP_003406047.1.51149 WP_003406047.1.51156 WP_003406047.1.51157 WP_003406047.1.51213 WP_003406047.1.51232 WP_003406047.1.51239 WP_003406047.1.51247 WP_003406047.1.51266 WP_003406047.1.51279 WP_003406047.1.51291 WP_003406047.1.51294 WP_003406047.1.51301 WP_003406047.1.51329 WP_003406047.1.51391 WP_003406047.1.51422 WP_003406047.1.51445 WP_003406047.1.51455 WP_003406047.1.51468 WP_003406047.1.51478 WP_003406047.1.51497 WP_003406047.1.51520 WP_003406047.1.51593 WP_003406047.1.51628 WP_003406047.1.5164 WP_003406047.1.51647 WP_003406047.1.51660 WP_003406047.1.51696 WP_003406047.1.51721 WP_003406047.1.51788 WP_003406047.1.51795 WP_003406047.1.51801 WP_003406047.1.51817 WP_003406047.1.51819 WP_003406047.1.51854 WP_003406047.1.51923 WP_003406047.1.51942 WP_003406047.1.51948 WP_003406047.1.51963 WP_003406047.1.51969 WP_003406047.1.52000 WP_003406047.1.52001 WP_003406047.1.52003 WP_003406047.1.52006 WP_003406047.1.52036 WP_003406047.1.52038 WP_003406047.1.52046 WP_003406047.1.52059 WP_003406047.1.52069 WP_003406047.1.52082 WP_003406047.1.52102 WP_003406047.1.52106 WP_003406047.1.52166 WP_003406047.1.52168 WP_003406047.1.52173 WP_003406047.1.52178 WP_003406047.1.52206 WP_003406047.1.52216 WP_003406047.1.52238 WP_003406047.1.52241 WP_003406047.1.52280 WP_003406047.1.52314 WP_003406047.1.52385 WP_003406047.1.52390 WP_003406047.1.52460 WP_003406047.1.52485 WP_003406047.1.52486 WP_003406047.1.52495 WP_003406047.1.52504 WP_003406047.1.52522 WP_003406047.1.52531 WP_003406047.1.52533 WP_003406047.1.52545 WP_003406047.1.52553 WP_003406047.1.52563 WP_003406047.1.52564 WP_003406047.1.52574 WP_003406047.1.52673 WP_003406047.1.52674 WP_003406047.1.52708 WP_003406047.1.52713 WP_003406047.1.52761 WP_003406047.1.52778 WP_003406047.1.52791 WP_003406047.1.52797 WP_003406047.1.52818 WP_003406047.1.52872 WP_003406047.1.52873 WP_003406047.1.52891 WP_003406047.1.52892 WP_003406047.1.52909 WP_003406047.1.52970 WP_003406047.1.52998 WP_003406047.1.53053 WP_003406047.1.53056 WP_003406047.1.5306 WP_003406047.1.53088 WP_003406047.1.5309 WP_003406047.1.531 WP_003406047.1.53117 WP_003406047.1.53118 WP_003406047.1.53142 WP_003406047.1.53143 WP_003406047.1.53157 WP_003406047.1.53167 WP_003406047.1.53200 WP_003406047.1.53204 WP_003406047.1.53213 WP_003406047.1.53217 WP_003406047.1.53226 WP_003406047.1.53229 WP_003406047.1.53230 WP_003406047.1.53237 WP_003406047.1.53254 WP_003406047.1.53257 WP_003406047.1.5327 WP_003406047.1.53276 WP_003406047.1.53278 WP_003406047.1.533 WP_003406047.1.53302 WP_003406047.1.53306 WP_003406047.1.5334 WP_003406047.1.5335 WP_003406047.1.53353 WP_003406047.1.53381 WP_003406047.1.53413 WP_003406047.1.53458 WP_003406047.1.53460 WP_003406047.1.53480 WP_003406047.1.53522 WP_003406047.1.53525 WP_003406047.1.53526 WP_003406047.1.53553 WP_003406047.1.53606 WP_003406047.1.53609 WP_003406047.1.53628 WP_003406047.1.53643 WP_003406047.1.53667 WP_003406047.1.53679 WP_003406047.1.53715 WP_003406047.1.53730 WP_003406047.1.53742 WP_003406047.1.53743 WP_003406047.1.53754 WP_003406047.1.53775 WP_003406047.1.53787 WP_003406047.1.53803 WP_003406047.1.53818 WP_003406047.1.53853 WP_003406047.1.53865 WP_003406047.1.53888 WP_003406047.1.53900 WP_003406047.1.53912 WP_003406047.1.53914 WP_003406047.1.53952 WP_003406047.1.5398 WP_003406047.1.5408 WP_003406047.1.54089 WP_003406047.1.54093 WP_003406047.1.54099 WP_003406047.1.54112 WP_003406047.1.54125 WP_003406047.1.54141 WP_003406047.1.54162 WP_003406047.1.54179 WP_003406047.1.54206 WP_003406047.1.54218 WP_003406047.1.54225 WP_003406047.1.54227 WP_003406047.1.54232 WP_003406047.1.54241 WP_003406047.1.54245 WP_003406047.1.54247 WP_003406047.1.54260 WP_003406047.1.54275 WP_003406047.1.54280 WP_003406047.1.5429 WP_003406047.1.54294 WP_003406047.1.54314 WP_003406047.1.54347 WP_003406047.1.54351 WP_003406047.1.54370 WP_003406047.1.54428 WP_003406047.1.54449 WP_003406047.1.54494 WP_003406047.1.54502 WP_003406047.1.54514 WP_003406047.1.54519 WP_003406047.1.5452 WP_003406047.1.54531 WP_003406047.1.54537 WP_003406047.1.54553 WP_003406047.1.54555 WP_003406047.1.54575 WP_003406047.1.54633 WP_003406047.1.54686 WP_003406047.1.54687 WP_003406047.1.54705 WP_003406047.1.54730 WP_003406047.1.54732 WP_003406047.1.5475 WP_003406047.1.54797 WP_003406047.1.54807 WP_003406047.1.54836 WP_003406047.1.54838 WP_003406047.1.54860 WP_003406047.1.54897 WP_003406047.1.54905 WP_003406047.1.54909 WP_003406047.1.54937 WP_003406047.1.54939 WP_003406047.1.54944 WP_003406047.1.54945 WP_003406047.1.54953 WP_003406047.1.54964 WP_003406047.1.55015 WP_003406047.1.55022 WP_003406047.1.55023 WP_003406047.1.55051 WP_003406047.1.55072 WP_003406047.1.55088 WP_003406047.1.55106 WP_003406047.1.55126 WP_003406047.1.55128 WP_003406047.1.55140 WP_003406047.1.55150 WP_003406047.1.55210 WP_003406047.1.55227 WP_003406047.1.55248 WP_003406047.1.55257 WP_003406047.1.55258 WP_003406047.1.55267 WP_003406047.1.55279 WP_003406047.1.55307 WP_003406047.1.55326 WP_003406047.1.5533 WP_003406047.1.55345 WP_003406047.1.55396 WP_003406047.1.55398 WP_003406047.1.55441 WP_003406047.1.55459 WP_003406047.1.55501 WP_003406047.1.55504 WP_003406047.1.55578 WP_003406047.1.55641 WP_003406047.1.5569 WP_003406047.1.55723 WP_003406047.1.55735 WP_003406047.1.5574 WP_003406047.1.55772 WP_003406047.1.55802 WP_003406047.1.55819 WP_003406047.1.55821 WP_003406047.1.5583 WP_003406047.1.55849 WP_003406047.1.55856 WP_003406047.1.55860 WP_003406047.1.55882 WP_003406047.1.55883 WP_003406047.1.55894 WP_003406047.1.55902 WP_003406047.1.55908 WP_003406047.1.55909 WP_003406047.1.5591 WP_003406047.1.55961 WP_003406047.1.55977 WP_003406047.1.55983 WP_003406047.1.56028 WP_003406047.1.56057 WP_003406047.1.56060 WP_003406047.1.56107 WP_003406047.1.56132 WP_003406047.1.56163 WP_003406047.1.56167 WP_003406047.1.56178 WP_003406047.1.56287 WP_003406047.1.56292 WP_003406047.1.56327 WP_003406047.1.56341 WP_003406047.1.56359 WP_003406047.1.56365 WP_003406047.1.56394 WP_003406047.1.56443 WP_003406047.1.56473 WP_003406047.1.56478 WP_003406047.1.56500 WP_003406047.1.56517 WP_003406047.1.56534 WP_003406047.1.5656 WP_003406047.1.56577 WP_003406047.1.56593 WP_003406047.1.56625 WP_003406047.1.56637 WP_003406047.1.56670 WP_003406047.1.56697 WP_003406047.1.56701 WP_003406047.1.56709 WP_003406047.1.56729 WP_003406047.1.56743 WP_003406047.1.56755 WP_003406047.1.56764 WP_003406047.1.56769 WP_003406047.1.56770 WP_003406047.1.56795 WP_003406047.1.5681 WP_003406047.1.56827 WP_003406047.1.56839 WP_003406047.1.56863 WP_003406047.1.56868 WP_003406047.1.56869 WP_003406047.1.56915 WP_003406047.1.56926 WP_003406047.1.56961 WP_003406047.1.56971 WP_003406047.1.56972 WP_003406047.1.57023 WP_003406047.1.57035 WP_003406047.1.57077 WP_003406047.1.57087 WP_003406047.1.57094 WP_003406047.1.57151 WP_003406047.1.57169 WP_003406047.1.57208 WP_003406047.1.57212 WP_003406047.1.57230 WP_003406047.1.5724 WP_003406047.1.5725 WP_003406047.1.5727 WP_003406047.1.57273 WP_003406047.1.573 WP_003406047.1.57314 WP_003406047.1.57326 WP_003406047.1.57328 WP_003406047.1.57331 WP_003406047.1.57340 WP_003406047.1.57351 WP_003406047.1.57352 WP_003406047.1.57380 WP_003406047.1.57430 WP_003406047.1.5744 WP_003406047.1.57440 WP_003406047.1.5745 WP_003406047.1.57461 WP_003406047.1.57469 WP_003406047.1.57489 WP_003406047.1.575 WP_003406047.1.57509 WP_003406047.1.57519 WP_003406047.1.57525 WP_003406047.1.57551 WP_003406047.1.57596 WP_003406047.1.57604 WP_003406047.1.57616 WP_003406047.1.57617 WP_003406047.1.57619 WP_003406047.1.57627 WP_003406047.1.57642 WP_003406047.1.57658 WP_003406047.1.57667 WP_003406047.1.57675 WP_003406047.1.57689 WP_003406047.1.57708 WP_003406047.1.57794 WP_003406047.1.57821 WP_003406047.1.57825 WP_003406047.1.57843 WP_003406047.1.57906 WP_003406047.1.57924 WP_003406047.1.57926 WP_003406047.1.57930 WP_003406047.1.57957 WP_003406047.1.57960 WP_003406047.1.57964 WP_003406047.1.57991 WP_003406047.1.58000 WP_003406047.1.58086 WP_003406047.1.58101 WP_003406047.1.58108 WP_003406047.1.5811 WP_003406047.1.58121 WP_003406047.1.58145 WP_003406047.1.58164 WP_003406047.1.58174 WP_003406047.1.582 WP_003406047.1.58202 WP_003406047.1.58209 WP_003406047.1.58215 WP_003406047.1.5824 WP_003406047.1.58250 WP_003406047.1.58259 WP_003406047.1.58283 WP_003406047.1.58288 WP_003406047.1.5830 WP_003406047.1.58303 WP_003406047.1.58311 WP_003406047.1.58330 WP_003406047.1.58359 WP_003406047.1.58386 WP_003406047.1.58393 WP_003406047.1.58431 WP_003406047.1.5844 WP_003406047.1.58457 WP_003406047.1.58488 WP_003406047.1.58518 WP_003406047.1.58534 WP_003406047.1.58567 WP_003406047.1.58573 WP_003406047.1.58602 WP_003406047.1.58612 WP_003406047.1.58619 WP_003406047.1.5865 WP_003406047.1.58671 WP_003406047.1.58690 WP_003406047.1.58702 WP_003406047.1.58743 WP_003406047.1.58754 WP_003406047.1.5879 WP_003406047.1.5881 WP_003406047.1.58848 WP_003406047.1.58857 WP_003406047.1.58891 WP_003406047.1.58892 WP_003406047.1.5890 WP_003406047.1.58904 WP_003406047.1.58921 WP_003406047.1.58930 WP_003406047.1.58939 WP_003406047.1.58941 WP_003406047.1.58953 WP_003406047.1.58961 WP_003406047.1.5898 WP_003406047.1.59025 WP_003406047.1.59029 WP_003406047.1.59037 WP_003406047.1.59044 WP_003406047.1.59085 WP_003406047.1.59088 WP_003406047.1.59112 WP_003406047.1.59130 WP_003406047.1.5914 WP_003406047.1.59147 WP_003406047.1.59166 WP_003406047.1.59205 WP_003406047.1.59209 WP_003406047.1.59237 WP_003406047.1.59240 WP_003406047.1.59253 WP_003406047.1.59254 WP_003406047.1.59262 WP_003406047.1.59270 WP_003406047.1.5928 WP_003406047.1.59304 WP_003406047.1.59305 WP_003406047.1.59309 WP_003406047.1.59316 WP_003406047.1.59326 WP_003406047.1.59328 WP_003406047.1.59333 WP_003406047.1.59338 WP_003406047.1.59388 WP_003406047.1.59428 WP_003406047.1.59487 WP_003406047.1.59537 WP_003406047.1.59561 WP_003406047.1.59677 WP_003406047.1.59722 WP_003406047.1.59727 WP_003406047.1.59738 WP_003406047.1.59750 WP_003406047.1.59757 WP_003406047.1.59761 WP_003406047.1.59808 WP_003406047.1.59850 WP_003406047.1.59856 WP_003406047.1.59860 WP_003406047.1.59861 WP_003406047.1.5987 WP_003406047.1.59878 WP_003406047.1.59888 WP_003406047.1.59952 WP_003406047.1.5996 WP_003406047.1.59961 WP_003406047.1.59974 WP_003406047.1.6000 WP_003406047.1.60007 WP_003406047.1.60016 WP_003406047.1.6003 WP_003406047.1.60047 WP_003406047.1.6007 WP_003406047.1.60121 WP_003406047.1.60125 WP_003406047.1.60135 WP_003406047.1.60139 WP_003406047.1.60152 WP_003406047.1.60171 WP_003406047.1.60197 WP_003406047.1.6020 WP_003406047.1.60205 WP_003406047.1.60215 WP_003406047.1.60217 WP_003406047.1.60267 WP_003406047.1.60288 WP_003406047.1.60291 WP_003406047.1.60301 WP_003406047.1.60305 WP_003406047.1.60312 WP_003406047.1.60313 WP_003406047.1.60314 WP_003406047.1.60367 WP_003406047.1.60376 WP_003406047.1.60403 WP_003406047.1.60413 WP_003406047.1.60421 WP_003406047.1.60451 WP_003406047.1.60460 WP_003406047.1.60479 WP_003406047.1.60487 WP_003406047.1.60512 WP_003406047.1.60573 WP_003406047.1.60583 WP_003406047.1.60632 WP_003406047.1.60657 WP_003406047.1.60687 WP_003406047.1.60689 WP_003406047.1.60727 WP_003406047.1.60738 WP_003406047.1.60763 WP_003406047.1.6077 WP_003406047.1.60791 WP_003406047.1.60834 WP_003406047.1.60870 WP_003406047.1.60878 WP_003406047.1.60879 WP_003406047.1.60913 WP_003406047.1.60978 WP_003406047.1.61000 WP_003406047.1.61001 WP_003406047.1.61012 WP_003406047.1.61014 WP_003406047.1.61015 WP_003406047.1.61037 WP_003406047.1.61052 WP_003406047.1.61065 WP_003406047.1.61100 WP_003406047.1.61101 WP_003406047.1.61138 WP_003406047.1.61142 WP_003406047.1.61198 WP_003406047.1.612 WP_003406047.1.61234 WP_003406047.1.61256 WP_003406047.1.61281 WP_003406047.1.61314 WP_003406047.1.61321 WP_003406047.1.61326 WP_003406047.1.61328 WP_003406047.1.61368 WP_003406047.1.61391 WP_003406047.1.61406 WP_003406047.1.61409 WP_003406047.1.61420 WP_003406047.1.61422 WP_003406047.1.61425 WP_003406047.1.61428 WP_003406047.1.61469 WP_003406047.1.61494 WP_003406047.1.61522 WP_003406047.1.61552 WP_003406047.1.61557 WP_003406047.1.61567 WP_003406047.1.61571 WP_003406047.1.61573 WP_003406047.1.61584 WP_003406047.1.61586 WP_003406047.1.6159 WP_003406047.1.61592 WP_003406047.1.6160 WP_003406047.1.61614 WP_003406047.1.6163 WP_003406047.1.61655 WP_003406047.1.61665 WP_003406047.1.61669 WP_003406047.1.61682 WP_003406047.1.61692 WP_003406047.1.61719 WP_003406047.1.61728 WP_003406047.1.61750 WP_003406047.1.61754 WP_003406047.1.61755 WP_003406047.1.61757 WP_003406047.1.61778 WP_003406047.1.6179 WP_003406047.1.61793 WP_003406047.1.61816 WP_003406047.1.61842 WP_003406047.1.61850 WP_003406047.1.61862 WP_003406047.1.61865 WP_003406047.1.61868 WP_003406047.1.61911 WP_003406047.1.61925 WP_003406047.1.61941 WP_003406047.1.61953 WP_003406047.1.61979 WP_003406047.1.61986 WP_003406047.1.61987 WP_003406047.1.61998 WP_003406047.1.62021 WP_003406047.1.62087 WP_003406047.1.62089 WP_003406047.1.62101 WP_003406047.1.62104 WP_003406047.1.6211 WP_003406047.1.62162 WP_003406047.1.62225 WP_003406047.1.62230 WP_003406047.1.62238 WP_003406047.1.62249 WP_003406047.1.62270 WP_003406047.1.62281 WP_003406047.1.62307 WP_003406047.1.6231 WP_003406047.1.62359 WP_003406047.1.62360 WP_003406047.1.62371 WP_003406047.1.62379 WP_003406047.1.62395 WP_003406047.1.62408 WP_003406047.1.62449 WP_003406047.1.62468 WP_003406047.1.6248 WP_003406047.1.62508 WP_003406047.1.62565 WP_003406047.1.62594 WP_003406047.1.62606 WP_003406047.1.62616 WP_003406047.1.62666 WP_003406047.1.62687 WP_003406047.1.62715 WP_003406047.1.62730 WP_003406047.1.62738 WP_003406047.1.62761 WP_003406047.1.62766 WP_003406047.1.62786 WP_003406047.1.62813 WP_003406047.1.62839 WP_003406047.1.62841 WP_003406047.1.62909 WP_003406047.1.62936 WP_003406047.1.6294 WP_003406047.1.6295 WP_003406047.1.62962 WP_003406047.1.63007 WP_003406047.1.63019 WP_003406047.1.63032 WP_003406047.1.63037 WP_003406047.1.63064 WP_003406047.1.63066 WP_003406047.1.63072 WP_003406047.1.6308 WP_003406047.1.63081 WP_003406047.1.63096 WP_003406047.1.63106 WP_003406047.1.6314 WP_003406047.1.63144 WP_003406047.1.63154 WP_003406047.1.63160 WP_003406047.1.63161 WP_003406047.1.63166 WP_003406047.1.63175 WP_003406047.1.63194 WP_003406047.1.6322 WP_003406047.1.63222 WP_003406047.1.6328 WP_003406047.1.63291 WP_003406047.1.63312 WP_003406047.1.63317 WP_003406047.1.63331 WP_003406047.1.63373 WP_003406047.1.63384 WP_003406047.1.63403 WP_003406047.1.63424 WP_003406047.1.63428 WP_003406047.1.6345 WP_003406047.1.63464 WP_003406047.1.63502 WP_003406047.1.63504 WP_003406047.1.63522 WP_003406047.1.63530 WP_003406047.1.63538 WP_003406047.1.63564 WP_003406047.1.63567 WP_003406047.1.63596 WP_003406047.1.63600 WP_003406047.1.63627 WP_003406047.1.63654 WP_003406047.1.63662 WP_003406047.1.63711 WP_003406047.1.63734 WP_003406047.1.63807 WP_003406047.1.63819 WP_003406047.1.63844 WP_003406047.1.63888 WP_003406047.1.63913 WP_003406047.1.63915 WP_003406047.1.63918 WP_003406047.1.63961 WP_003406047.1.63970 WP_003406047.1.64000 WP_003406047.1.64027 WP_003406047.1.64058 WP_003406047.1.64065 WP_003406047.1.6407 WP_003406047.1.64082 WP_003406047.1.64091 WP_003406047.1.64102 WP_003406047.1.64104 WP_003406047.1.64119 WP_003406047.1.64169 WP_003406047.1.64219 WP_003406047.1.6422 WP_003406047.1.64222 WP_003406047.1.64228 WP_003406047.1.64235 WP_003406047.1.6427 WP_003406047.1.64278 WP_003406047.1.64287 WP_003406047.1.64414 WP_003406047.1.64419 WP_003406047.1.6443 WP_003406047.1.64463 WP_003406047.1.64480 WP_003406047.1.64497 WP_003406047.1.64506 WP_003406047.1.64511 WP_003406047.1.64513 WP_003406047.1.64514 WP_003406047.1.64515 WP_003406047.1.64522 WP_003406047.1.64526 WP_003406047.1.64543 WP_003406047.1.6456 WP_003406047.1.64567 WP_003406047.1.64588 WP_003406047.1.64589 WP_003406047.1.64594 WP_003406047.1.64595 WP_003406047.1.64608 WP_003406047.1.64619 WP_003406047.1.64629 WP_003406047.1.6464 WP_003406047.1.64664 WP_003406047.1.64669 WP_003406047.1.64672 WP_003406047.1.64680 WP_003406047.1.64682 WP_003406047.1.64727 WP_003406047.1.64729 WP_003406047.1.64774 WP_003406047.1.64802 WP_003406047.1.64832 WP_003406047.1.6486 WP_003406047.1.64870 WP_003406047.1.64898 WP_003406047.1.64922 WP_003406047.1.64924 WP_003406047.1.6493 WP_003406047.1.64937 WP_003406047.1.64941 WP_003406047.1.64966 WP_003406047.1.64973 WP_003406047.1.65001 WP_003406047.1.65026 WP_003406047.1.65053 WP_003406047.1.65070 WP_003406047.1.65079 WP_003406047.1.65102 WP_003406047.1.65157 WP_003406047.1.65181 WP_003406047.1.65212 WP_003406047.1.65229 WP_003406047.1.6523 WP_003406047.1.65253 WP_003406047.1.65289 WP_003406047.1.65329 WP_003406047.1.65359 WP_003406047.1.6536 WP_003406047.1.65374 WP_003406047.1.65386 WP_003406047.1.65414 WP_003406047.1.65416 WP_003406047.1.65433 WP_003406047.1.65455 WP_003406047.1.65467 WP_003406047.1.65488 WP_003406047.1.65529 WP_003406047.1.65539 WP_003406047.1.65583 WP_003406047.1.65612 WP_003406047.1.65623 WP_003406047.1.65635 WP_003406047.1.65637 WP_003406047.1.65648 WP_003406047.1.65683 WP_003406047.1.65686 WP_003406047.1.65688 WP_003406047.1.65707 WP_003406047.1.65733 WP_003406047.1.65747 WP_003406047.1.65759 WP_003406047.1.65816 WP_003406047.1.65830 WP_003406047.1.65858 WP_003406047.1.65862 WP_003406047.1.65893 WP_003406047.1.65929 WP_003406047.1.65932 WP_003406047.1.65958 WP_003406047.1.65974 WP_003406047.1.66004 WP_003406047.1.66013 WP_003406047.1.6606 WP_003406047.1.66089 WP_003406047.1.66149 WP_003406047.1.66151 WP_003406047.1.66229 WP_003406047.1.66276 WP_003406047.1.66293 WP_003406047.1.66297 WP_003406047.1.66323 WP_003406047.1.66325 WP_003406047.1.6633 WP_003406047.1.66334 WP_003406047.1.66355 WP_003406047.1.66367 WP_003406047.1.66394 WP_003406047.1.66396 WP_003406047.1.66451 WP_003406047.1.66455 WP_003406047.1.66457 WP_003406047.1.66460 WP_003406047.1.66464 WP_003406047.1.66466 WP_003406047.1.66487 WP_003406047.1.66504 WP_003406047.1.66544 WP_003406047.1.66558 WP_003406047.1.66580 WP_003406047.1.66582 WP_003406047.1.66612 WP_003406047.1.66615 WP_003406047.1.66617 WP_003406047.1.66635 WP_003406047.1.66656 WP_003406047.1.66663 WP_003406047.1.66675 WP_003406047.1.66715 WP_003406047.1.66718 WP_003406047.1.66762 WP_003406047.1.66776 WP_003406047.1.66808 WP_003406047.1.66817 WP_003406047.1.66819 WP_003406047.1.66826 WP_003406047.1.66830 WP_003406047.1.66842 WP_003406047.1.66868 WP_003406047.1.66878 WP_003406047.1.66880 WP_003406047.1.66893 WP_003406047.1.66961 WP_003406047.1.67005 WP_003406047.1.6704 WP_003406047.1.67044 WP_003406047.1.67061 WP_003406047.1.67089 WP_003406047.1.67098 WP_003406047.1.67146 WP_003406047.1.67170 WP_003406047.1.67197 WP_003406047.1.67198 WP_003406047.1.6720 WP_003406047.1.67207 WP_003406047.1.67218 WP_003406047.1.67220 WP_003406047.1.67225 WP_003406047.1.67231 WP_003406047.1.6724 WP_003406047.1.67257 WP_003406047.1.67298 WP_003406047.1.67307 WP_003406047.1.67324 WP_003406047.1.67332 WP_003406047.1.67346 WP_003406047.1.67354 WP_003406047.1.67360 WP_003406047.1.67381 WP_003406047.1.67396 WP_003406047.1.67417 WP_003406047.1.67422 WP_003406047.1.67453 WP_003406047.1.67459 WP_003406047.1.6746 WP_003406047.1.67473 WP_003406047.1.67481 WP_003406047.1.67482 WP_003406047.1.67496 WP_003406047.1.67499 WP_003406047.1.67516 WP_003406047.1.67523 WP_003406047.1.67536 WP_003406047.1.67575 WP_003406047.1.67587 WP_003406047.1.67598 WP_003406047.1.67600 WP_003406047.1.67602 WP_003406047.1.67630 WP_003406047.1.67679 WP_003406047.1.67692 WP_003406047.1.67744 WP_003406047.1.6775 WP_003406047.1.67750 WP_003406047.1.6777 WP_003406047.1.67809 WP_003406047.1.67816 WP_003406047.1.67844 WP_003406047.1.67848 WP_003406047.1.67870 WP_003406047.1.67888 WP_003406047.1.67915 WP_003406047.1.67945 WP_003406047.1.67949 WP_003406047.1.67980 WP_003406047.1.67982 WP_003406047.1.68022 WP_003406047.1.68029 WP_003406047.1.68038 WP_003406047.1.68045 WP_003406047.1.68057 WP_003406047.1.68083 WP_003406047.1.68088 WP_003406047.1.68106 WP_003406047.1.68110 WP_003406047.1.68153 WP_003406047.1.68169 WP_003406047.1.68193 WP_003406047.1.68212 WP_003406047.1.68227 WP_003406047.1.68243 WP_003406047.1.6825 WP_003406047.1.68297 WP_003406047.1.68309 WP_003406047.1.68325 WP_003406047.1.68329 WP_003406047.1.68340 WP_003406047.1.68384 WP_003406047.1.68388 WP_003406047.1.68429 WP_003406047.1.6843 WP_003406047.1.68433 WP_003406047.1.68444 WP_003406047.1.68465 WP_003406047.1.68484 WP_003406047.1.68518 WP_003406047.1.68569 WP_003406047.1.68576 WP_003406047.1.68580 WP_003406047.1.68586 WP_003406047.1.68623 WP_003406047.1.68637 WP_003406047.1.68646 WP_003406047.1.68667 WP_003406047.1.68669 WP_003406047.1.68672 WP_003406047.1.68684 WP_003406047.1.68704 WP_003406047.1.68708 WP_003406047.1.6872 WP_003406047.1.68730 WP_003406047.1.68734 WP_003406047.1.68748 WP_003406047.1.68754 WP_003406047.1.6876 WP_003406047.1.68761 WP_003406047.1.68763 WP_003406047.1.68766 WP_003406047.1.68774 WP_003406047.1.68796 WP_003406047.1.68824 WP_003406047.1.68832 WP_003406047.1.68833 WP_003406047.1.68841 WP_003406047.1.68859 WP_003406047.1.68876 WP_003406047.1.68906 WP_003406047.1.68916 WP_003406047.1.68923 WP_003406047.1.68945 WP_003406047.1.6896 WP_003406047.1.68981 WP_003406047.1.68984 WP_003406047.1.69008 WP_003406047.1.69076 WP_003406047.1.69079 WP_003406047.1.6908 WP_003406047.1.69082 WP_003406047.1.69178 WP_003406047.1.69181 WP_003406047.1.69208 WP_003406047.1.69231 WP_003406047.1.69256 WP_003406047.1.69311 WP_003406047.1.69315 WP_003406047.1.69322 WP_003406047.1.69342 WP_003406047.1.6935 WP_003406047.1.6936 WP_003406047.1.69369 WP_003406047.1.69374 WP_003406047.1.69398 WP_003406047.1.69401 WP_003406047.1.69426 WP_003406047.1.69427 WP_003406047.1.69429 WP_003406047.1.6949 WP_003406047.1.6951 WP_003406047.1.69511 WP_003406047.1.69526 WP_003406047.1.69528 WP_003406047.1.69547 WP_003406047.1.69573 WP_003406047.1.69581 WP_003406047.1.6960 WP_003406047.1.69617 WP_003406047.1.69634 WP_003406047.1.69647 WP_003406047.1.69659 WP_003406047.1.69673 WP_003406047.1.69682 WP_003406047.1.69684 WP_003406047.1.69686 WP_003406047.1.69707 WP_003406047.1.69709 WP_003406047.1.69736 WP_003406047.1.69778 WP_003406047.1.69800 WP_003406047.1.69802 WP_003406047.1.69845 WP_003406047.1.69870 WP_003406047.1.69873 WP_003406047.1.69898 WP_003406047.1.69913 WP_003406047.1.69925 WP_003406047.1.69931 WP_003406047.1.69938 WP_003406047.1.69955 WP_003406047.1.69957 WP_003406047.1.69981 WP_003406047.1.69990 WP_003406047.1.70 WP_003406047.1.70000 WP_003406047.1.70017 WP_003406047.1.70032 WP_003406047.1.70062 WP_003406047.1.70072 WP_003406047.1.70131 WP_003406047.1.70132 WP_003406047.1.7022 WP_003406047.1.70227 WP_003406047.1.70271 WP_003406047.1.70274 WP_003406047.1.7029 WP_003406047.1.70325 WP_003406047.1.70328 WP_003406047.1.70356 WP_003406047.1.70364 WP_003406047.1.70368 WP_003406047.1.70369 WP_003406047.1.70418 WP_003406047.1.70422 WP_003406047.1.70435 WP_003406047.1.70444 WP_003406047.1.70463 WP_003406047.1.70480 WP_003406047.1.70494 WP_003406047.1.70498 WP_003406047.1.70505 WP_003406047.1.70525 WP_003406047.1.70573 WP_003406047.1.70577 WP_003406047.1.70610 WP_003406047.1.70615 WP_003406047.1.70618 WP_003406047.1.70622 WP_003406047.1.70626 WP_003406047.1.70668 WP_003406047.1.70699 WP_003406047.1.70704 WP_003406047.1.70729 WP_003406047.1.70757 WP_003406047.1.70782 WP_003406047.1.70796 WP_003406047.1.70830 WP_003406047.1.70834 WP_003406047.1.7084 WP_003406047.1.70840 WP_003406047.1.70864 WP_003406047.1.70871 WP_003406047.1.70915 WP_003406047.1.70958 WP_003406047.1.70964 WP_003406047.1.70976 WP_003406047.1.71015 WP_003406047.1.71026 WP_003406047.1.71063 WP_003406047.1.71076 WP_003406047.1.71083 WP_003406047.1.7111 WP_003406047.1.71118 WP_003406047.1.71128 WP_003406047.1.7113 WP_003406047.1.71187 WP_003406047.1.71191 WP_003406047.1.71255 WP_003406047.1.71258 WP_003406047.1.71259 WP_003406047.1.71289 WP_003406047.1.71326 WP_003406047.1.71329 WP_003406047.1.71331 WP_003406047.1.71344 WP_003406047.1.71390 WP_003406047.1.71414 WP_003406047.1.71440 WP_003406047.1.71457 WP_003406047.1.7146 WP_003406047.1.71464 WP_003406047.1.71490 WP_003406047.1.71492 WP_003406047.1.71509 WP_003406047.1.71516 WP_003406047.1.71517 WP_003406047.1.71527 WP_003406047.1.71532 WP_003406047.1.71545 WP_003406047.1.71546 WP_003406047.1.71569 WP_003406047.1.71604 WP_003406047.1.71621 WP_003406047.1.71630 WP_003406047.1.71638 WP_003406047.1.71654 WP_003406047.1.71664 WP_003406047.1.71683 WP_003406047.1.71701 WP_003406047.1.71718 WP_003406047.1.71731 WP_003406047.1.71778 WP_003406047.1.71781 WP_003406047.1.71803 WP_003406047.1.71820 WP_003406047.1.71847 WP_003406047.1.7185 WP_003406047.1.71851 WP_003406047.1.71871 WP_003406047.1.71909 WP_003406047.1.71957 WP_003406047.1.71970 WP_003406047.1.72047 WP_003406047.1.72061 WP_003406047.1.72062 WP_003406047.1.72072 WP_003406047.1.72111 WP_003406047.1.72122 WP_003406047.1.72128 WP_003406047.1.72143 WP_003406047.1.7216 WP_003406047.1.72179 WP_003406047.1.72209 WP_003406047.1.72218 WP_003406047.1.72219 WP_003406047.1.72227 WP_003406047.1.7224 WP_003406047.1.72268 WP_003406047.1.72332 WP_003406047.1.72380 WP_003406047.1.72405 WP_003406047.1.72420 WP_003406047.1.72441 WP_003406047.1.72451 WP_003406047.1.72452 WP_003406047.1.72457 WP_003406047.1.72459 WP_003406047.1.72460 WP_003406047.1.72466 WP_003406047.1.72487 WP_003406047.1.72488 WP_003406047.1.72492 WP_003406047.1.72506 WP_003406047.1.72543 WP_003406047.1.7256 WP_003406047.1.72576 WP_003406047.1.72578 WP_003406047.1.72585 WP_003406047.1.72591 WP_003406047.1.72592 WP_003406047.1.72640 WP_003406047.1.7266 WP_003406047.1.72661 WP_003406047.1.72684 WP_003406047.1.72739 WP_003406047.1.72744 WP_003406047.1.72755 WP_003406047.1.72759 WP_003406047.1.72784 WP_003406047.1.72792 WP_003406047.1.72826 WP_003406047.1.72831 WP_003406047.1.72852 WP_003406047.1.72853 WP_003406047.1.72879 WP_003406047.1.72880 WP_003406047.1.72938 WP_003406047.1.72954 WP_003406047.1.72957 WP_003406047.1.72959 WP_003406047.1.7298 WP_003406047.1.72982 WP_003406047.1.72988 WP_003406047.1.72993 WP_003406047.1.73006 WP_003406047.1.73013 WP_003406047.1.73028 WP_003406047.1.73042 WP_003406047.1.73045 WP_003406047.1.73092 WP_003406047.1.73118 WP_003406047.1.7312 WP_003406047.1.73127 WP_003406047.1.73134 WP_003406047.1.73150 WP_003406047.1.73154 WP_003406047.1.73163 WP_003406047.1.73182 WP_003406047.1.73205 WP_003406047.1.7321 WP_003406047.1.73310 WP_003406047.1.73365 WP_003406047.1.73391 WP_003406047.1.73404 WP_003406047.1.73424 WP_003406047.1.73436 WP_003406047.1.73445 WP_003406047.1.73453 WP_003406047.1.73465 WP_003406047.1.73466 WP_003406047.1.73470 WP_003406047.1.73471 WP_003406047.1.73478 WP_003406047.1.73482 WP_003406047.1.73507 WP_003406047.1.73532 WP_003406047.1.73550 WP_003406047.1.73564 WP_003406047.1.73623 WP_003406047.1.73629 WP_003406047.1.73644 WP_003406047.1.7366 WP_003406047.1.73661 WP_003406047.1.7368 WP_003406047.1.73688 WP_003406047.1.73723 WP_003406047.1.73744 WP_003406047.1.73750 WP_003406047.1.73760 WP_003406047.1.73774 WP_003406047.1.7379 WP_003406047.1.73813 WP_003406047.1.73840 WP_003406047.1.73876 WP_003406047.1.7389 WP_003406047.1.73986 WP_003406047.1.74016 WP_003406047.1.74039 WP_003406047.1.74083 WP_003406047.1.74101 WP_003406047.1.74107 WP_003406047.1.74120 WP_003406047.1.74129 WP_003406047.1.74144 WP_003406047.1.7417 WP_003406047.1.74190 WP_003406047.1.74210 WP_003406047.1.7423 WP_003406047.1.74259 WP_003406047.1.74262 WP_003406047.1.74269 WP_003406047.1.74282 WP_003406047.1.74291 WP_003406047.1.74296 WP_003406047.1.74304 WP_003406047.1.7432 WP_003406047.1.74347 WP_003406047.1.7436 WP_003406047.1.74378 WP_003406047.1.74382 WP_003406047.1.74395 WP_003406047.1.74400 WP_003406047.1.74401 WP_003406047.1.74432 WP_003406047.1.74477 WP_003406047.1.74487 WP_003406047.1.74499 WP_003406047.1.74504 WP_003406047.1.74523 WP_003406047.1.74525 WP_003406047.1.74551 WP_003406047.1.74555 WP_003406047.1.74628 WP_003406047.1.74641 WP_003406047.1.74653 WP_003406047.1.74660 WP_003406047.1.74683 WP_003406047.1.7469 WP_003406047.1.74760 WP_003406047.1.74786 WP_003406047.1.74809 WP_003406047.1.74820 WP_003406047.1.74870 WP_003406047.1.74881 WP_003406047.1.74888 WP_003406047.1.74952 WP_003406047.1.7496 WP_003406047.1.74988 WP_003406047.1.75043 WP_003406047.1.75045 WP_003406047.1.75055 WP_003406047.1.75078 WP_003406047.1.75081 WP_003406047.1.75120 WP_003406047.1.75163 WP_003406047.1.75188 WP_003406047.1.75200 WP_003406047.1.75202 WP_003406047.1.75234 WP_003406047.1.75239 WP_003406047.1.75250 WP_003406047.1.75263 WP_003406047.1.75281 WP_003406047.1.75342 WP_003406047.1.7535 WP_003406047.1.75376 WP_003406047.1.75391 WP_003406047.1.75395 WP_003406047.1.75441 WP_003406047.1.75510 WP_003406047.1.75581 WP_003406047.1.75598 WP_003406047.1.75635 WP_003406047.1.75665 WP_003406047.1.75671 WP_003406047.1.75741 WP_003406047.1.75749 WP_003406047.1.75772 WP_003406047.1.75774 WP_003406047.1.75811 WP_003406047.1.75833 WP_003406047.1.7585 WP_003406047.1.75864 WP_003406047.1.75868 WP_003406047.1.75878 WP_003406047.1.75927 WP_003406047.1.75968 WP_003406047.1.75974 WP_003406047.1.76016 WP_003406047.1.76032 WP_003406047.1.76037 WP_003406047.1.7604 WP_003406047.1.76045 WP_003406047.1.76052 WP_003406047.1.76058 WP_003406047.1.76064 WP_003406047.1.76110 WP_003406047.1.76126 WP_003406047.1.76133 WP_003406047.1.76138 WP_003406047.1.76157 WP_003406047.1.76172 WP_003406047.1.76177 WP_003406047.1.76183 WP_003406047.1.76209 WP_003406047.1.76239 WP_003406047.1.76272 WP_003406047.1.76277 WP_003406047.1.76281 WP_003406047.1.76291 WP_003406047.1.76297 WP_003406047.1.76360 WP_003406047.1.76379 WP_003406047.1.76403 WP_003406047.1.76413 WP_003406047.1.76414 WP_003406047.1.76427 WP_003406047.1.76436 WP_003406047.1.76442 WP_003406047.1.76443 WP_003406047.1.76456 WP_003406047.1.76533 WP_003406047.1.76625 WP_003406047.1.76629 WP_003406047.1.76635 WP_003406047.1.76638 WP_003406047.1.76640 WP_003406047.1.76644 WP_003406047.1.76677 WP_003406047.1.76678 WP_003406047.1.76679 WP_003406047.1.76734 WP_003406047.1.76744 WP_003406047.1.76750 WP_003406047.1.76754 WP_003406047.1.76781 WP_003406047.1.76818 WP_003406047.1.76824 WP_003406047.1.76835 WP_003406047.1.76873 WP_003406047.1.76881 WP_003406047.1.76888 WP_003406047.1.76900 WP_003406047.1.7691 WP_003406047.1.76947 WP_003406047.1.76954 WP_003406047.1.76955 WP_003406047.1.76963 WP_003406047.1.76976 WP_003406047.1.770 WP_003406047.1.77000 WP_003406047.1.77008 WP_003406047.1.77021 WP_003406047.1.77056 WP_003406047.1.77065 WP_003406047.1.77075 WP_003406047.1.77093 WP_003406047.1.77107 WP_003406047.1.77115 WP_003406047.1.77118 WP_003406047.1.77125 WP_003406047.1.77141 WP_003406047.1.77142 WP_003406047.1.77166 WP_003406047.1.77250 WP_003406047.1.77252 WP_003406047.1.77260 WP_003406047.1.77266 WP_003406047.1.77280 WP_003406047.1.77285 WP_003406047.1.77312 WP_003406047.1.77348 WP_003406047.1.77351 WP_003406047.1.77352 WP_003406047.1.77361 WP_003406047.1.774 WP_003406047.1.7740 WP_003406047.1.77404 WP_003406047.1.77425 WP_003406047.1.77463 WP_003406047.1.77474 WP_003406047.1.7748 WP_003406047.1.77484 WP_003406047.1.77491 WP_003406047.1.77499 WP_003406047.1.77510 WP_003406047.1.77530 WP_003406047.1.77554 WP_003406047.1.77559 WP_003406047.1.77599 WP_003406047.1.77605 WP_003406047.1.7762 WP_003406047.1.77627 WP_003406047.1.77649 WP_003406047.1.77654 WP_003406047.1.7766 WP_003406047.1.77667 WP_003406047.1.77704 WP_003406047.1.77706 WP_003406047.1.77774 WP_003406047.1.7778 WP_003406047.1.77790 WP_003406047.1.77809 WP_003406047.1.77843 WP_003406047.1.77855 WP_003406047.1.77865 WP_003406047.1.77868 WP_003406047.1.77879 WP_003406047.1.77890 WP_003406047.1.77909 WP_003406047.1.77911 WP_003406047.1.77931 WP_003406047.1.77984 WP_003406047.1.78020 WP_003406047.1.78024 WP_003406047.1.78075 WP_003406047.1.78086 WP_003406047.1.7809 WP_003406047.1.78098 WP_003406047.1.78105 WP_003406047.1.78113 WP_003406047.1.78136 WP_003406047.1.78162 WP_003406047.1.7817 WP_003406047.1.78200 WP_003406047.1.78216 WP_003406047.1.78236 WP_003406047.1.78238 WP_003406047.1.78322 WP_003406047.1.78338 WP_003406047.1.7836 WP_003406047.1.78360 WP_003406047.1.78386 WP_003406047.1.78429 WP_003406047.1.78435 WP_003406047.1.7844 WP_003406047.1.78459 WP_003406047.1.78488 WP_003406047.1.7849 WP_003406047.1.78499 WP_003406047.1.785 WP_003406047.1.78516 WP_003406047.1.78524 WP_003406047.1.78526 WP_003406047.1.78538 WP_003406047.1.78544 WP_003406047.1.78545 WP_003406047.1.78547 WP_003406047.1.78574 WP_003406047.1.78580 WP_003406047.1.7860 WP_003406047.1.78620 WP_003406047.1.78646 WP_003406047.1.78648 WP_003406047.1.78649 WP_003406047.1.78655 WP_003406047.1.78657 WP_003406047.1.78659 WP_003406047.1.7869 WP_003406047.1.78692 WP_003406047.1.78760 WP_003406047.1.78776 WP_003406047.1.78778 WP_003406047.1.78784 WP_003406047.1.78788 WP_003406047.1.78790 WP_003406047.1.78793 WP_003406047.1.78848 WP_003406047.1.78860 WP_003406047.1.7887 WP_003406047.1.78884 WP_003406047.1.78932 WP_003406047.1.78969 WP_003406047.1.78977 WP_003406047.1.78980 WP_003406047.1.79005 WP_003406047.1.79016 WP_003406047.1.79033 WP_003406047.1.79064 WP_003406047.1.79066 WP_003406047.1.79068 WP_003406047.1.79077 WP_003406047.1.79095 WP_003406047.1.79112 WP_003406047.1.79122 WP_003406047.1.79145 WP_003406047.1.79152 WP_003406047.1.79163 WP_003406047.1.79182 WP_003406047.1.79198 WP_003406047.1.79213 WP_003406047.1.79218 WP_003406047.1.79268 WP_003406047.1.79273 WP_003406047.1.79278 WP_003406047.1.79290 WP_003406047.1.79319 WP_003406047.1.79325 WP_003406047.1.79326 WP_003406047.1.7933 WP_003406047.1.79330 WP_003406047.1.79339 WP_003406047.1.79394 WP_003406047.1.79399 WP_003406047.1.79413 WP_003406047.1.79422 WP_003406047.1.79445 WP_003406047.1.79447 WP_003406047.1.79455 WP_003406047.1.79471 WP_003406047.1.79480 WP_003406047.1.79482 WP_003406047.1.79488 WP_003406047.1.79500 WP_003406047.1.79502 WP_003406047.1.79508 WP_003406047.1.79514 WP_003406047.1.79561 WP_003406047.1.79565 WP_003406047.1.79578 WP_003406047.1.79588 WP_003406047.1.79598 WP_003406047.1.79615 WP_003406047.1.79684 WP_003406047.1.79698 WP_003406047.1.797 WP_003406047.1.79744 WP_003406047.1.79784 WP_003406047.1.79802 WP_003406047.1.79806 WP_003406047.1.79819 WP_003406047.1.79826 WP_003406047.1.79828 WP_003406047.1.79851 WP_003406047.1.79853 WP_003406047.1.79863 WP_003406047.1.79881 WP_003406047.1.79885 WP_003406047.1.79898 WP_003406047.1.7990 WP_003406047.1.79900 WP_003406047.1.79913 WP_003406047.1.79918 WP_003406047.1.79947 WP_003406047.1.79948 WP_003406047.1.7995 WP_003406047.1.7997 WP_003406047.1.80004 WP_003406047.1.80015 WP_003406047.1.80022 WP_003406047.1.80030 WP_003406047.1.80054 WP_003406047.1.80084 WP_003406047.1.80099 WP_003406047.1.80129 WP_003406047.1.80234 WP_003406047.1.8026 WP_003406047.1.80275 WP_003406047.1.8029 WP_003406047.1.80299 WP_003406047.1.80300 WP_003406047.1.80304 WP_003406047.1.80326 WP_003406047.1.80351 WP_003406047.1.8037 WP_003406047.1.80370 WP_003406047.1.80387 WP_003406047.1.80399 WP_003406047.1.8044 WP_003406047.1.80451 WP_003406047.1.80458 WP_003406047.1.80461 WP_003406047.1.80490 WP_003406047.1.80503 WP_003406047.1.80507 WP_003406047.1.80552 WP_003406047.1.80576 WP_003406047.1.80588 WP_003406047.1.80599 WP_003406047.1.8060 WP_003406047.1.80624 WP_003406047.1.80636 WP_003406047.1.80673 WP_003406047.1.80711 WP_003406047.1.80714 WP_003406047.1.80743 WP_003406047.1.80784 WP_003406047.1.80815 WP_003406047.1.80853 WP_003406047.1.80918 WP_003406047.1.8093 WP_003406047.1.80967 WP_003406047.1.8097 WP_003406047.1.80988 WP_003406047.1.81007 WP_003406047.1.81013 WP_003406047.1.8105 WP_003406047.1.81059 WP_003406047.1.81063 WP_003406047.1.81066 WP_003406047.1.81075 WP_003406047.1.81091 WP_003406047.1.81119 WP_003406047.1.81125 WP_003406047.1.81136 WP_003406047.1.8114 WP_003406047.1.81189 WP_003406047.1.81192 WP_003406047.1.812 WP_003406047.1.81230 WP_003406047.1.81249 WP_003406047.1.81250 WP_003406047.1.81264 WP_003406047.1.8128 WP_003406047.1.81287 WP_003406047.1.81297 WP_003406047.1.8138 WP_003406047.1.81407 WP_003406047.1.8143 WP_003406047.1.81439 WP_003406047.1.81465 WP_003406047.1.81505 WP_003406047.1.81529 WP_003406047.1.81538 WP_003406047.1.81541 WP_003406047.1.81560 WP_003406047.1.81561 WP_003406047.1.81567 WP_003406047.1.81583 WP_003406047.1.81686 WP_003406047.1.81712 WP_003406047.1.81720 WP_003406047.1.81731 WP_003406047.1.81774 WP_003406047.1.81788 WP_003406047.1.81809 WP_003406047.1.81820 WP_003406047.1.81850 WP_003406047.1.81883 WP_003406047.1.81891 WP_003406047.1.81911 WP_003406047.1.81918 WP_003406047.1.82011 WP_003406047.1.82048 WP_003406047.1.82069 WP_003406047.1.82071 WP_003406047.1.82108 WP_003406047.1.82136 WP_003406047.1.82142 WP_003406047.1.8215 WP_003406047.1.82158 WP_003406047.1.8217 WP_003406047.1.82209 WP_003406047.1.82210 WP_003406047.1.82228 WP_003406047.1.82251 WP_003406047.1.82271 WP_003406047.1.82305 WP_003406047.1.82307 WP_003406047.1.82309 WP_003406047.1.8232 WP_003406047.1.82346 WP_003406047.1.82374 WP_003406047.1.82385 WP_003406047.1.82429 WP_003406047.1.82462 WP_003406047.1.82483 WP_003406047.1.82494 WP_003406047.1.82531 WP_003406047.1.82546 WP_003406047.1.82547 WP_003406047.1.82549 WP_003406047.1.82577 WP_003406047.1.82592 WP_003406047.1.82597 WP_003406047.1.82598 WP_003406047.1.82625 WP_003406047.1.82642 WP_003406047.1.82651 WP_003406047.1.82653 WP_003406047.1.82681 WP_003406047.1.82685 WP_003406047.1.8271 WP_003406047.1.82712 WP_003406047.1.8273 WP_003406047.1.82743 WP_003406047.1.82757 WP_003406047.1.82774 WP_003406047.1.82803 WP_003406047.1.82836 WP_003406047.1.82860 WP_003406047.1.82871 WP_003406047.1.82892 WP_003406047.1.82935 WP_003406047.1.82957 WP_003406047.1.82981 WP_003406047.1.82983 WP_003406047.1.83004 WP_003406047.1.83009 WP_003406047.1.83044 WP_003406047.1.83065 WP_003406047.1.83074 WP_003406047.1.83146 WP_003406047.1.83149 WP_003406047.1.83159 WP_003406047.1.8317 WP_003406047.1.83173 WP_003406047.1.83181 WP_003406047.1.83182 WP_003406047.1.83191 WP_003406047.1.83197 WP_003406047.1.83212 WP_003406047.1.8326 WP_003406047.1.83262 WP_003406047.1.83268 WP_003406047.1.83273 WP_003406047.1.83332 WP_003406047.1.83334 WP_003406047.1.83341 WP_003406047.1.83349 WP_003406047.1.8335 WP_003406047.1.83353 WP_003406047.1.83367 WP_003406047.1.83380 WP_003406047.1.83381 WP_003406047.1.83389 WP_003406047.1.83408 WP_003406047.1.83409 WP_003406047.1.83435 WP_003406047.1.83470 WP_003406047.1.83524 WP_003406047.1.83526 WP_003406047.1.8358 WP_003406047.1.83589 WP_003406047.1.83601 WP_003406047.1.83611 WP_003406047.1.83648 WP_003406047.1.83656 WP_003406047.1.83667 WP_003406047.1.83689 WP_003406047.1.83692 WP_003406047.1.83704 WP_003406047.1.83766 WP_003406047.1.83793 WP_003406047.1.83794 WP_003406047.1.83802 WP_003406047.1.83805 WP_003406047.1.83839 WP_003406047.1.83842 WP_003406047.1.83850 WP_003406047.1.83861 WP_003406047.1.83884 WP_003406047.1.83929 WP_003406047.1.83930 WP_003406047.1.83975 WP_003406047.1.83991 WP_003406047.1.8400 WP_003406047.1.84027 WP_003406047.1.8404 WP_003406047.1.84057 WP_003406047.1.84070 WP_003406047.1.8409 WP_003406047.1.84112 WP_003406047.1.8415 WP_003406047.1.84176 WP_003406047.1.84186 WP_003406047.1.84192 WP_003406047.1.84228 WP_003406047.1.8424 WP_003406047.1.84244 WP_003406047.1.84259 WP_003406047.1.8426 WP_003406047.1.84277 WP_003406047.1.84287 WP_003406047.1.8434 WP_003406047.1.84388 WP_003406047.1.84408 WP_003406047.1.84409 WP_003406047.1.84460 WP_003406047.1.84488 WP_003406047.1.84504 WP_003406047.1.84525 WP_003406047.1.84620 WP_003406047.1.84623 WP_003406047.1.84641 WP_003406047.1.84655 WP_003406047.1.84666 WP_003406047.1.84670 WP_003406047.1.84739 WP_003406047.1.84748 WP_003406047.1.84766 WP_003406047.1.84772 WP_003406047.1.84774 WP_003406047.1.848 WP_003406047.1.84812 WP_003406047.1.84836 WP_003406047.1.84839 WP_003406047.1.84846 WP_003406047.1.84873 WP_003406047.1.84911 WP_003406047.1.84938 WP_003406047.1.84968 WP_003406047.1.84973 WP_003406047.1.84981 WP_003406047.1.84985 WP_003406047.1.8503 WP_003406047.1.85038 WP_003406047.1.85041 WP_003406047.1.85043 WP_003406047.1.8505 WP_003406047.1.85074 WP_003406047.1.8509 WP_003406047.1.8512 WP_003406047.1.85148 WP_003406047.1.8518 WP_003406047.1.8522 WP_003406047.1.85242 WP_003406047.1.85276 WP_003406047.1.85281 WP_003406047.1.85284 WP_003406047.1.85314 WP_003406047.1.85319 WP_003406047.1.85330 WP_003406047.1.85341 WP_003406047.1.85346 WP_003406047.1.8535 WP_003406047.1.85363 WP_003406047.1.85371 WP_003406047.1.85377 WP_003406047.1.85387 WP_003406047.1.85399 WP_003406047.1.85458 WP_003406047.1.8546 WP_003406047.1.85464 WP_003406047.1.85478 WP_003406047.1.85480 WP_003406047.1.85488 WP_003406047.1.85495 WP_003406047.1.85557 WP_003406047.1.85577 WP_003406047.1.85597 WP_003406047.1.85599 WP_003406047.1.85610 WP_003406047.1.8563 WP_003406047.1.85679 WP_003406047.1.85704 WP_003406047.1.85717 WP_003406047.1.85727 WP_003406047.1.85737 WP_003406047.1.85763 WP_003406047.1.85808 WP_003406047.1.85819 WP_003406047.1.85820 WP_003406047.1.85823 WP_003406047.1.85832 WP_003406047.1.8586 WP_003406047.1.85872 WP_003406047.1.85894 WP_003406047.1.85909 WP_003406047.1.85913 WP_003406047.1.85953 WP_003406047.1.86000 WP_003406047.1.86024 WP_003406047.1.86025 WP_003406047.1.86032 WP_003406047.1.86048 WP_003406047.1.86052 WP_003406047.1.86067 WP_003406047.1.86103 WP_003406047.1.86122 WP_003406047.1.86124 WP_003406047.1.86160 WP_003406047.1.86164 WP_003406047.1.86168 WP_003406047.1.86190 WP_003406047.1.86204 WP_003406047.1.86208 WP_003406047.1.86235 WP_003406047.1.86249 WP_003406047.1.86260 WP_003406047.1.86290 WP_003406047.1.863 WP_003406047.1.86327 WP_003406047.1.86334 WP_003406047.1.86337 WP_003406047.1.86377 WP_003406047.1.86425 WP_003406047.1.86459 WP_003406047.1.8649 WP_003406047.1.86520 WP_003406047.1.86561 WP_003406047.1.86568 WP_003406047.1.86575 WP_003406047.1.86584 WP_003406047.1.86605 WP_003406047.1.86626 WP_003406047.1.86648 WP_003406047.1.8666 WP_003406047.1.86684 WP_003406047.1.86696 WP_003406047.1.86705 WP_003406047.1.86718 WP_003406047.1.86725 WP_003406047.1.86757 WP_003406047.1.86766 WP_003406047.1.86801 WP_003406047.1.86814 WP_003406047.1.86820 WP_003406047.1.86825 WP_003406047.1.86834 WP_003406047.1.8685 WP_003406047.1.86851 WP_003406047.1.86855 WP_003406047.1.86867 WP_003406047.1.86877 WP_003406047.1.86883 WP_003406047.1.8689 WP_003406047.1.86892 WP_003406047.1.86933 WP_003406047.1.86941 WP_003406047.1.86950 WP_003406047.1.86962 WP_003406047.1.86963 WP_003406047.1.86979 WP_003406047.1.8700 WP_003406047.1.87002 WP_003406047.1.87031 WP_003406047.1.87116 WP_003406047.1.87117 WP_003406047.1.8714 WP_003406047.1.87162 WP_003406047.1.87178 WP_003406047.1.87191 WP_003406047.1.87201 WP_003406047.1.87209 WP_003406047.1.87240 WP_003406047.1.87266 WP_003406047.1.87273 WP_003406047.1.87317 WP_003406047.1.8733 WP_003406047.1.87345 WP_003406047.1.87369 WP_003406047.1.8737 WP_003406047.1.87401 WP_003406047.1.87404 WP_003406047.1.87406 WP_003406047.1.87409 WP_003406047.1.87444 WP_003406047.1.87446 WP_003406047.1.87459 WP_003406047.1.87472 WP_003406047.1.87489 WP_003406047.1.87494 WP_003406047.1.87496 WP_003406047.1.87582 WP_003406047.1.87588 WP_003406047.1.87617 WP_003406047.1.87619 WP_003406047.1.87620 WP_003406047.1.87634 WP_003406047.1.87643 WP_003406047.1.8765 WP_003406047.1.87650 WP_003406047.1.87654 WP_003406047.1.87658 WP_003406047.1.87665 WP_003406047.1.87676 WP_003406047.1.87677 WP_003406047.1.87684 WP_003406047.1.87692 WP_003406047.1.87707 WP_003406047.1.87732 WP_003406047.1.87784 WP_003406047.1.87796 WP_003406047.1.87809 WP_003406047.1.87817 WP_003406047.1.87827 WP_003406047.1.87831 WP_003406047.1.87835 WP_003406047.1.87837 WP_003406047.1.87866 WP_003406047.1.8789 WP_003406047.1.87911 WP_003406047.1.87924 WP_003406047.1.87951 WP_003406047.1.87955 WP_003406047.1.87956 WP_003406047.1.87991 WP_003406047.1.88 WP_003406047.1.88002 WP_003406047.1.88037 WP_003406047.1.88072 WP_003406047.1.88077 WP_003406047.1.88121 WP_003406047.1.88180 WP_003406047.1.88191 WP_003406047.1.88205 WP_003406047.1.88217 WP_003406047.1.88245 WP_003406047.1.88253 WP_003406047.1.88294 WP_003406047.1.88315 WP_003406047.1.88316 WP_003406047.1.88320 WP_003406047.1.88338 WP_003406047.1.8840 WP_003406047.1.88437 WP_003406047.1.88453 WP_003406047.1.88469 WP_003406047.1.88489 WP_003406047.1.88507 WP_003406047.1.88521 WP_003406047.1.88530 WP_003406047.1.88541 WP_003406047.1.88592 WP_003406047.1.88616 WP_003406047.1.88618 WP_003406047.1.8862 WP_003406047.1.88625 WP_003406047.1.88632 WP_003406047.1.88634 WP_003406047.1.88649 WP_003406047.1.8870 WP_003406047.1.88737 WP_003406047.1.88756 WP_003406047.1.888 WP_003406047.1.88824 WP_003406047.1.88886 WP_003406047.1.88965 WP_003406047.1.88985 WP_003406047.1.8902 WP_003406047.1.89025 WP_003406047.1.89041 WP_003406047.1.89046 WP_003406047.1.89082 WP_003406047.1.89162 WP_003406047.1.89168 WP_003406047.1.89193 WP_003406047.1.89205 WP_003406047.1.89207 WP_003406047.1.89225 WP_003406047.1.8925 WP_003406047.1.89277 WP_003406047.1.89286 WP_003406047.1.89293 WP_003406047.1.89320 WP_003406047.1.8935 WP_003406047.1.89371 WP_003406047.1.89378 WP_003406047.1.89392 WP_003406047.1.89406 WP_003406047.1.8943 WP_003406047.1.89451 WP_003406047.1.89453 WP_003406047.1.89473 WP_003406047.1.89475 WP_003406047.1.89483 WP_003406047.1.895 WP_003406047.1.89513 WP_003406047.1.89517 WP_003406047.1.89522 WP_003406047.1.8954 WP_003406047.1.89543 WP_003406047.1.8957 WP_003406047.1.89572 WP_003406047.1.89589 WP_003406047.1.89607 WP_003406047.1.89613 WP_003406047.1.89625 WP_003406047.1.89648 WP_003406047.1.8967 WP_003406047.1.89670 WP_003406047.1.89676 WP_003406047.1.89729 WP_003406047.1.89739 WP_003406047.1.89762 WP_003406047.1.8977 WP_003406047.1.89802 WP_003406047.1.89808 WP_003406047.1.8982 WP_003406047.1.89829 WP_003406047.1.89831 WP_003406047.1.89844 WP_003406047.1.89849 WP_003406047.1.8989 WP_003406047.1.89901 WP_003406047.1.89903 WP_003406047.1.89909 WP_003406047.1.89922 WP_003406047.1.89926 WP_003406047.1.89963 WP_003406047.1.89971 WP_003406047.1.8998 WP_003406047.1.89987 WP_003406047.1.900 WP_003406047.1.9007 WP_003406047.1.90080 WP_003406047.1.90130 WP_003406047.1.90134 WP_003406047.1.90137 WP_003406047.1.90157 WP_003406047.1.90184 WP_003406047.1.90199 WP_003406047.1.90231 WP_003406047.1.90245 WP_003406047.1.90308 WP_003406047.1.90322 WP_003406047.1.90328 WP_003406047.1.90372 WP_003406047.1.90439 WP_003406047.1.90481 WP_003406047.1.90499 WP_003406047.1.9050 WP_003406047.1.90527 WP_003406047.1.90550 WP_003406047.1.90560 WP_003406047.1.90612 WP_003406047.1.90640 WP_003406047.1.90672 WP_003406047.1.90687 WP_003406047.1.90691 WP_003406047.1.90711 WP_003406047.1.90722 WP_003406047.1.90744 WP_003406047.1.9075 WP_003406047.1.90756 WP_003406047.1.90767 WP_003406047.1.90771 WP_003406047.1.90785 WP_003406047.1.90788 WP_003406047.1.90800 WP_003406047.1.90810 WP_003406047.1.90816 WP_003406047.1.90819 WP_003406047.1.90831 WP_003406047.1.90884 WP_003406047.1.90899 WP_003406047.1.90906 WP_003406047.1.90958 WP_003406047.1.90976 WP_003406047.1.90977 WP_003406047.1.90987 WP_003406047.1.9102 WP_003406047.1.91026 WP_003406047.1.91032 WP_003406047.1.91043 WP_003406047.1.91053 WP_003406047.1.91082 WP_003406047.1.91106 WP_003406047.1.91112 WP_003406047.1.91144 WP_003406047.1.91151 WP_003406047.1.91157 WP_003406047.1.91167 WP_003406047.1.91169 WP_003406047.1.91192 WP_003406047.1.91201 WP_003406047.1.91208 WP_003406047.1.91211 WP_003406047.1.91214 WP_003406047.1.91230 WP_003406047.1.91244 WP_003406047.1.91251 WP_003406047.1.91260 WP_003406047.1.91265 WP_003406047.1.9128 WP_003406047.1.91284 WP_003406047.1.91294 WP_003406047.1.91303 WP_003406047.1.91322 WP_003406047.1.91352 WP_003406047.1.91386 WP_003406047.1.9139 WP_003406047.1.91398 WP_003406047.1.91411 WP_003406047.1.91430 WP_003406047.1.91436 WP_003406047.1.91483 WP_003406047.1.91496 WP_003406047.1.91507 WP_003406047.1.91508 WP_003406047.1.91576 WP_003406047.1.91589 WP_003406047.1.91694 WP_003406047.1.91695 WP_003406047.1.91713 WP_003406047.1.91716 WP_003406047.1.91717 WP_003406047.1.91728 WP_003406047.1.91743 WP_003406047.1.91759 WP_003406047.1.91784 WP_003406047.1.91785 WP_003406047.1.91786 WP_003406047.1.91802 WP_003406047.1.91822 WP_003406047.1.91828 WP_003406047.1.9189 WP_003406047.1.91896 WP_003406047.1.9190 WP_003406047.1.91915 WP_003406047.1.91931 WP_003406047.1.91937 WP_003406047.1.91944 WP_003406047.1.91953 WP_003406047.1.91957 WP_003406047.1.91976 WP_003406047.1.91978 WP_003406047.1.92083 WP_003406047.1.92127 WP_003406047.1.92144 WP_003406047.1.92150 WP_003406047.1.92153 WP_003406047.1.92190 WP_003406047.1.92192 WP_003406047.1.92200 WP_003406047.1.92220 WP_003406047.1.92221 WP_003406047.1.92222 WP_003406047.1.92273 WP_003406047.1.92289 WP_003406047.1.9229 WP_003406047.1.92294 WP_003406047.1.92300 WP_003406047.1.92317 WP_003406047.1.92334 WP_003406047.1.92338 WP_003406047.1.92345 WP_003406047.1.92356 WP_003406047.1.92364 WP_003406047.1.92380 WP_003406047.1.92416 WP_003406047.1.92447 WP_003406047.1.92456 WP_003406047.1.92467 WP_003406047.1.92471 WP_003406047.1.92490 WP_003406047.1.92508 WP_003406047.1.9251 WP_003406047.1.92511 WP_003406047.1.92523 WP_003406047.1.92527 WP_003406047.1.92536 WP_003406047.1.92592 WP_003406047.1.92597 WP_003406047.1.92603 WP_003406047.1.92606 WP_003406047.1.92610 WP_003406047.1.92613 WP_003406047.1.9263 WP_003406047.1.9265 WP_003406047.1.92650 WP_003406047.1.92660 WP_003406047.1.92677 WP_003406047.1.92685 WP_003406047.1.92689 WP_003406047.1.92690 WP_003406047.1.92706 WP_003406047.1.92714 WP_003406047.1.92736 WP_003406047.1.9274 WP_003406047.1.92752 WP_003406047.1.92760 WP_003406047.1.92777 WP_003406047.1.92803 WP_003406047.1.92833 WP_003406047.1.92856 WP_003406047.1.92881 WP_003406047.1.92892 WP_003406047.1.92907 WP_003406047.1.92908 WP_003406047.1.9291 WP_003406047.1.92917 WP_003406047.1.92996 WP_003406047.1.93006 WP_003406047.1.93008 WP_003406047.1.93009 WP_003406047.1.93015 WP_003406047.1.93043 WP_003406047.1.9307 WP_003406047.1.93083 WP_003406047.1.93097 WP_003406047.1.93137 WP_003406047.1.93192 WP_003406047.1.93199 WP_003406047.1.93203 WP_003406047.1.93212 WP_003406047.1.93234 WP_003406047.1.93245 WP_003406047.1.93257 WP_003406047.1.93265 WP_003406047.1.93297 WP_003406047.1.93320 WP_003406047.1.93328 WP_003406047.1.93337 WP_003406047.1.93343 WP_003406047.1.93349 WP_003406047.1.93363 WP_003406047.1.9338 WP_003406047.1.93407 WP_003406047.1.93417 WP_003406047.1.93419 WP_003406047.1.93426 WP_003406047.1.9344 WP_003406047.1.93443 WP_003406047.1.93447 WP_003406047.1.93470 WP_003406047.1.93483 WP_003406047.1.93487 WP_003406047.1.93495 WP_003406047.1.93499 WP_003406047.1.93516 WP_003406047.1.93536 WP_003406047.1.93544 WP_003406047.1.93555 WP_003406047.1.93560 WP_003406047.1.93564 WP_003406047.1.9357 WP_003406047.1.93573 WP_003406047.1.93576 WP_003406047.1.93588 WP_003406047.1.93645 WP_003406047.1.93649 WP_003406047.1.93659 WP_003406047.1.93677 WP_003406047.1.9368 WP_003406047.1.93689 WP_003406047.1.93693 WP_003406047.1.93698 WP_003406047.1.93706 WP_003406047.1.9371 WP_003406047.1.93792 WP_003406047.1.93823 WP_003406047.1.93871 WP_003406047.1.9388 WP_003406047.1.93894 WP_003406047.1.93903 WP_003406047.1.93907 WP_003406047.1.93913 WP_003406047.1.93946 WP_003406047.1.93950 WP_003406047.1.93953 WP_003406047.1.93954 WP_003406047.1.93988 WP_003406047.1.9407 WP_003406047.1.94143 WP_003406047.1.94154 WP_003406047.1.94184 WP_003406047.1.94204 WP_003406047.1.94205 WP_003406047.1.94226 WP_003406047.1.94231 WP_003406047.1.94256 WP_003406047.1.94261 WP_003406047.1.94281 WP_003406047.1.94292 WP_003406047.1.94297 WP_003406047.1.9431 WP_003406047.1.94326 WP_003406047.1.94339 WP_003406047.1.94392 WP_003406047.1.94416 WP_003406047.1.94421 WP_003406047.1.94456 WP_003406047.1.94470 WP_003406047.1.94480 WP_003406047.1.94495 WP_003406047.1.94511 WP_003406047.1.94512 WP_003406047.1.94525 WP_003406047.1.94528 WP_003406047.1.94564 WP_003406047.1.946 WP_003406047.1.94602 WP_003406047.1.94623 WP_003406047.1.94629 WP_003406047.1.9465 WP_003406047.1.94673 WP_003406047.1.94714 WP_003406047.1.94730 WP_003406047.1.94736 WP_003406047.1.94776 WP_003406047.1.9478 WP_003406047.1.94834 WP_003406047.1.94852 WP_003406047.1.94872 WP_003406047.1.9488 WP_003406047.1.94902 WP_003406047.1.94916 WP_003406047.1.94979 WP_003406047.1.94996 WP_003406047.1.94998 WP_003406047.1.95007 WP_003406047.1.95010 WP_003406047.1.95015 WP_003406047.1.95034 WP_003406047.1.95068 WP_003406047.1.95081 WP_003406047.1.95082 WP_003406047.1.9509 WP_003406047.1.95096 WP_003406047.1.95112 WP_003406047.1.95138 WP_003406047.1.95179 WP_003406047.1.95188 WP_003406047.1.95190 WP_003406047.1.95234 WP_003406047.1.95241 WP_003406047.1.95245 WP_003406047.1.95257 WP_003406047.1.95279 WP_003406047.1.9531 WP_003406047.1.95335 WP_003406047.1.95344 WP_003406047.1.9535 WP_003406047.1.95370 WP_003406047.1.95392 WP_003406047.1.95416 WP_003406047.1.95417 WP_003406047.1.95454 WP_003406047.1.95455 WP_003406047.1.95491 WP_003406047.1.95497 WP_003406047.1.95508 WP_003406047.1.95509 WP_003406047.1.95529 WP_003406047.1.95556 WP_003406047.1.95557 WP_003406047.1.95565 WP_003406047.1.95578 WP_003406047.1.95580 WP_003406047.1.95585 WP_003406047.1.95643 WP_003406047.1.95679 WP_003406047.1.95685 WP_003406047.1.957 WP_003406047.1.95724 WP_003406047.1.95727 WP_003406047.1.95730 WP_003406047.1.95735 WP_003406047.1.95772 WP_003406047.1.95797 WP_003406047.1.95839 WP_003406047.1.9585 WP_003406047.1.9590 WP_003406047.1.95902 WP_003406047.1.95908 WP_003406047.1.95924 WP_003406047.1.95926 WP_003406047.1.95953 WP_003406047.1.95958 WP_003406047.1.95964 WP_003406047.1.95973 WP_003406047.1.96006 WP_003406047.1.9602 WP_003406047.1.96036 WP_003406047.1.96062 WP_003406047.1.96065 WP_003406047.1.96098 WP_003406047.1.96146 WP_003406047.1.96166 WP_003406047.1.96171 WP_003406047.1.96182 WP_003406047.1.96204 WP_003406047.1.96230 WP_003406047.1.96235 WP_003406047.1.96242 WP_003406047.1.96245 WP_003406047.1.96254 WP_003406047.1.96259 WP_003406047.1.96286 WP_003406047.1.96313 WP_003406047.1.96318 WP_003406047.1.96345 WP_003406047.1.96360 WP_003406047.1.96373 WP_003406047.1.96456 WP_003406047.1.96486 WP_003406047.1.96560 WP_003406047.1.96569 WP_003406047.1.96573 WP_003406047.1.96576 WP_003406047.1.96611 WP_003406047.1.96621 WP_003406047.1.9667 WP_003406047.1.96681 WP_003406047.1.96726 WP_003406047.1.96733 WP_003406047.1.96742 WP_003406047.1.96754 WP_003406047.1.9678 WP_003406047.1.96832 WP_003406047.1.97008 WP_003406047.1.97009 WP_003406047.1.97056 WP_003406047.1.97084 WP_003406047.1.97087 WP_003406047.1.97094 WP_003406047.1.97096 WP_003406047.1.97099 WP_003406047.1.97108 WP_003406047.1.97113 WP_003406047.1.97122 WP_003406047.1.97129 WP_003406047.1.97136 WP_003406047.1.9716 WP_003406047.1.97176 WP_003406047.1.97222 WP_003406047.1.97223 WP_003406047.1.97237 WP_003406047.1.97242 WP_003406047.1.97270 WP_003406047.1.97283 WP_003406047.1.97296 WP_003406047.1.97321 WP_003406047.1.97325 WP_003406047.1.97330 WP_003406047.1.97366 WP_003406047.1.97376 WP_003406047.1.97380 WP_003406047.1.9739 WP_003406047.1.97462 WP_003406047.1.97517 WP_003406047.1.97519 WP_003406047.1.97535 WP_003406047.1.97545 WP_003406047.1.97546 WP_003406047.1.97550 WP_003406047.1.97568 WP_003406047.1.97577 WP_003406047.1.97584 WP_003406047.1.97591 WP_003406047.1.97596 WP_003406047.1.97609 WP_003406047.1.97618 WP_003406047.1.9763 WP_003406047.1.97669 WP_003406047.1.97673 WP_003406047.1.97700 WP_003406047.1.97701 WP_003406047.1.9773 WP_003406047.1.97730 WP_003406047.1.97740 WP_003406047.1.97751 WP_003406047.1.97754 WP_003406047.1.97797 WP_003406047.1.9782 WP_003406047.1.9784 WP_003406047.1.97888 WP_003406047.1.9790 WP_003406047.1.9795 WP_003406047.1.97951 WP_003406047.1.97958 WP_003406047.1.97966 WP_003406047.1.97977 WP_003406047.1.97995 WP_003406047.1.98018 WP_003406047.1.98034 WP_003406047.1.98052 WP_003406047.1.98071 WP_003406047.1.98072 WP_003406047.1.98113 WP_003406047.1.98114 WP_003406047.1.98128 WP_003406047.1.98181 WP_003406047.1.98188 WP_003406047.1.98189 WP_003406047.1.98213 WP_003406047.1.98225 WP_003406047.1.98291 WP_003406047.1.98335 WP_003406047.1.98350 WP_003406047.1.98395 WP_003406047.1.98412 WP_003406047.1.98441 WP_003406047.1.98443 WP_003406047.1.98462 WP_003406047.1.9848 WP_003406047.1.98482 WP_003406047.1.98486 WP_003406047.1.98488 WP_003406047.1.98503 WP_003406047.1.98516 WP_003406047.1.98524 WP_003406047.1.98536 WP_003406047.1.98541 WP_003406047.1.98566 WP_003406047.1.98576 WP_003406047.1.98590 WP_003406047.1.98594 WP_003406047.1.98599 WP_003406047.1.98629 WP_003406047.1.98645 WP_003406047.1.98646 WP_003406047.1.98649 WP_003406047.1.98656 WP_003406047.1.9867 WP_003406047.1.98674 WP_003406047.1.98697 WP_003406047.1.98701 WP_003406047.1.98739 WP_003406047.1.98749 WP_003406047.1.98765 WP_003406047.1.98770 WP_003406047.1.98777 WP_003406047.1.98778 WP_003406047.1.98802 WP_003406047.1.98838 WP_003406047.1.98850 WP_003406047.1.98906 WP_003406047.1.98935 WP_003406047.1.98948 WP_003406047.1.98953 WP_003406047.1.98984 WP_003406047.1.99000 WP_003406047.1.99023 WP_003406047.1.99030 WP_003406047.1.99037 WP_003406047.1.99055 WP_003406047.1.99062 WP_003406047.1.99086 WP_003406047.1.99115 WP_003406047.1.99117 WP_003406047.1.99161 WP_003406047.1.99176 WP_003406047.1.99205 WP_003406047.1.99211 WP_003406047.1.99216 WP_003406047.1.99222 WP_003406047.1.99251 WP_003406047.1.99269 WP_003406047.1.99294 WP_003406047.1.99312 WP_003406047.1.99315 WP_003406047.1.99316 WP_003406047.1.99322 WP_003406047.1.99328 WP_003406047.1.99365 WP_003406047.1.99368 WP_003406047.1.99379 WP_003406047.1.99396 WP_003406047.1.99402 WP_003406047.1.99404 WP_003406047.1.99419 WP_003406047.1.99438 WP_003406047.1.99460 WP_003406047.1.99468 WP_003406047.1.99473 WP_003406047.1.99513 WP_003406047.1.99529 WP_003406047.1.99548 WP_003406047.1.99572 WP_003406047.1.99575 WP_003406047.1.99605 WP_003406047.1.99609 WP_003406047.1.99617 WP_003406047.1.99635 WP_003406047.1.99650 WP_003406047.1.99672 WP_003406047.1.99701 WP_003406047.1.99711 WP_003406047.1.99716 WP_003406047.1.99740 WP_003406047.1.99745 WP_003406047.1.99749 WP_003406047.1.9976 WP_003406047.1.99798 WP_003406047.1.99817 WP_003406047.1.99847 WP_003406047.1.99852 WP_003406047.1.99886 WP_003406047.1.99897 WP_003406047.1.99899 WP_003406047.1.99915 WP_003406047.1.9993 WP_003406047.1.99991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]