SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740000|ref|YP_002161314.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740000|ref|YP_002161314.1|
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.74e-28
Family Transcriptional regulator Rrf2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197740000|ref|YP_002161314.1|
Sequence length 161
Comment Rrf2 family protein [Mycobacterium tuberculosis str. Haarlem]
Sequence
MRMSAKAEYAVRAMVQLATAASGTVVKTDDLAAAQGIPPQFLVDILTNLRTDRLVRSHRG
REGGYELARPGTEISIADVLRCIDGPLASVRDIGLGDLPYSGPTTALTDVWRALRASMRS
VLEETTLADVAGGALPEHVAQLADDYRAQESTRHGASRHGD
Download sequence
Identical sequences A0A045J240 A0A0H3MA07 A0A109S763 A0A109SMC9 A0A109SVT5 A0A197J1X9 A0A1A9E5P9 A0A1S1B8F8 A5U1Y5 F8M6L8 G0THW4 I6X0V2 M8CGH7 P67160 P9WME2 P9WME3
233413.Mb1318 336982.TBFG_11313 410289.BCG_1346 419947.MRA_1295 478434.TBMG_02694 561275.JTY_1321 83331.MT1325 83332.Rv1287 gi|449063355|ref|YP_007430438.1| gi|433641439|ref|YP_007287198.1| gi|383307158|ref|YP_005359969.1| gi|148822504|ref|YP_001287258.1| gi|386004276|ref|YP_005922555.1| gi|433626387|ref|YP_007260016.1| gi|525674022|ref|YP_008225391.1| gi|15608427|ref|NP_215803.1| gi|392433119|ref|YP_006474163.1| gi|433634350|ref|YP_007267977.1| gi|506925754|ref|YP_008006204.1| gi|121637215|ref|YP_977438.1| gi|31792479|ref|NP_854972.1| gi|148661074|ref|YP_001282597.1| gi|385998070|ref|YP_005916368.1| gi|479055248|ref|YP_007351054.1| gi|392385981|ref|YP_005307610.1| gi|224989690|ref|YP_002644377.1| gi|506925754|ref|YP_008006204.1| gi|375296909|ref|YP_005101176.1| gi|15840735|ref|NP_335772.1| gi|197740000|ref|YP_002161314.1| gi|253799668|ref|YP_003032669.1| gi|15608427|ref|NP_215803.1| gi|339631355|ref|YP_004722997.1| gi|340626302|ref|YP_004744754.1| NP_215803.1.84033 WP_003406624.1.100000 WP_003406624.1.100021 WP_003406624.1.100069 WP_003406624.1.100087 WP_003406624.1.10015 WP_003406624.1.100208 WP_003406624.1.100216 WP_003406624.1.10022 WP_003406624.1.100255 WP_003406624.1.100260 WP_003406624.1.100270 WP_003406624.1.100279 WP_003406624.1.100286 WP_003406624.1.100308 WP_003406624.1.100309 WP_003406624.1.100318 WP_003406624.1.100337 WP_003406624.1.100338 WP_003406624.1.10037 WP_003406624.1.100383 WP_003406624.1.100395 WP_003406624.1.100396 WP_003406624.1.1004 WP_003406624.1.100401 WP_003406624.1.100459 WP_003406624.1.100460 WP_003406624.1.100552 WP_003406624.1.100581 WP_003406624.1.100600 WP_003406624.1.100625 WP_003406624.1.10064 WP_003406624.1.100666 WP_003406624.1.100671 WP_003406624.1.100677 WP_003406624.1.100682 WP_003406624.1.100697 WP_003406624.1.100703 WP_003406624.1.100716 WP_003406624.1.100722 WP_003406624.1.100754 WP_003406624.1.100757 WP_003406624.1.100772 WP_003406624.1.1008 WP_003406624.1.100812 WP_003406624.1.100845 WP_003406624.1.100866 WP_003406624.1.10088 WP_003406624.1.100889 WP_003406624.1.10090 WP_003406624.1.100910 WP_003406624.1.100915 WP_003406624.1.100918 WP_003406624.1.100935 WP_003406624.1.100984 WP_003406624.1.100992 WP_003406624.1.100998 WP_003406624.1.101 WP_003406624.1.101025 WP_003406624.1.101028 WP_003406624.1.10104 WP_003406624.1.101048 WP_003406624.1.101054 WP_003406624.1.101075 WP_003406624.1.101143 WP_003406624.1.101146 WP_003406624.1.10116 WP_003406624.1.10117 WP_003406624.1.101209 WP_003406624.1.10125 WP_003406624.1.101290 WP_003406624.1.101323 WP_003406624.1.101324 WP_003406624.1.101350 WP_003406624.1.101367 WP_003406624.1.101398 WP_003406624.1.101403 WP_003406624.1.101421 WP_003406624.1.10144 WP_003406624.1.101442 WP_003406624.1.10145 WP_003406624.1.101452 WP_003406624.1.101456 WP_003406624.1.101481 WP_003406624.1.101493 WP_003406624.1.101496 WP_003406624.1.101525 WP_003406624.1.101533 WP_003406624.1.101535 WP_003406624.1.101553 WP_003406624.1.101558 WP_003406624.1.10156 WP_003406624.1.101573 WP_003406624.1.101576 WP_003406624.1.10159 WP_003406624.1.101592 WP_003406624.1.101604 WP_003406624.1.101607 WP_003406624.1.101622 WP_003406624.1.101644 WP_003406624.1.101659 WP_003406624.1.101671 WP_003406624.1.101687 WP_003406624.1.101698 WP_003406624.1.10170 WP_003406624.1.101713 WP_003406624.1.101722 WP_003406624.1.101733 WP_003406624.1.101743 WP_003406624.1.101753 WP_003406624.1.101754 WP_003406624.1.101764 WP_003406624.1.101773 WP_003406624.1.101795 WP_003406624.1.101797 WP_003406624.1.101798 WP_003406624.1.101802 WP_003406624.1.101826 WP_003406624.1.101836 WP_003406624.1.101858 WP_003406624.1.101859 WP_003406624.1.101862 WP_003406624.1.101888 WP_003406624.1.101894 WP_003406624.1.101899 WP_003406624.1.1019 WP_003406624.1.101923 WP_003406624.1.101925 WP_003406624.1.10193 WP_003406624.1.101996 WP_003406624.1.102 WP_003406624.1.102008 WP_003406624.1.102017 WP_003406624.1.102053 WP_003406624.1.102055 WP_003406624.1.102063 WP_003406624.1.102099 WP_003406624.1.1021 WP_003406624.1.10211 WP_003406624.1.102119 WP_003406624.1.102121 WP_003406624.1.102143 WP_003406624.1.10216 WP_003406624.1.10224 WP_003406624.1.10253 WP_003406624.1.10262 WP_003406624.1.10272 WP_003406624.1.10277 WP_003406624.1.1033 WP_003406624.1.10350 WP_003406624.1.10362 WP_003406624.1.10366 WP_003406624.1.10376 WP_003406624.1.10396 WP_003406624.1.10410 WP_003406624.1.10414 WP_003406624.1.10421 WP_003406624.1.10430 WP_003406624.1.1044 WP_003406624.1.10440 WP_003406624.1.10445 WP_003406624.1.10471 WP_003406624.1.10472 WP_003406624.1.10489 WP_003406624.1.105 WP_003406624.1.10518 WP_003406624.1.10523 WP_003406624.1.10545 WP_003406624.1.1057 WP_003406624.1.10594 WP_003406624.1.10603 WP_003406624.1.10606 WP_003406624.1.10615 WP_003406624.1.10623 WP_003406624.1.10635 WP_003406624.1.10643 WP_003406624.1.10648 WP_003406624.1.10662 WP_003406624.1.10709 WP_003406624.1.10735 WP_003406624.1.10740 WP_003406624.1.10756 WP_003406624.1.1078 WP_003406624.1.10791 WP_003406624.1.10799 WP_003406624.1.10825 WP_003406624.1.10848 WP_003406624.1.10863 WP_003406624.1.10879 WP_003406624.1.10912 WP_003406624.1.10916 WP_003406624.1.10923 WP_003406624.1.10927 WP_003406624.1.1095 WP_003406624.1.10956 WP_003406624.1.10958 WP_003406624.1.10962 WP_003406624.1.10980 WP_003406624.1.10981 WP_003406624.1.10993 WP_003406624.1.1100 WP_003406624.1.11040 WP_003406624.1.11061 WP_003406624.1.11070 WP_003406624.1.11141 WP_003406624.1.11171 WP_003406624.1.11175 WP_003406624.1.11176 WP_003406624.1.11222 WP_003406624.1.11236 WP_003406624.1.11329 WP_003406624.1.1133 WP_003406624.1.11342 WP_003406624.1.11373 WP_003406624.1.11376 WP_003406624.1.11390 WP_003406624.1.11402 WP_003406624.1.11481 WP_003406624.1.11487 WP_003406624.1.11489 WP_003406624.1.11491 WP_003406624.1.11514 WP_003406624.1.11587 WP_003406624.1.11589 WP_003406624.1.11596 WP_003406624.1.11604 WP_003406624.1.11610 WP_003406624.1.11697 WP_003406624.1.11707 WP_003406624.1.11752 WP_003406624.1.11758 WP_003406624.1.11761 WP_003406624.1.11775 WP_003406624.1.11804 WP_003406624.1.11822 WP_003406624.1.11826 WP_003406624.1.11856 WP_003406624.1.11898 WP_003406624.1.11906 WP_003406624.1.11939 WP_003406624.1.11960 WP_003406624.1.11961 WP_003406624.1.11972 WP_003406624.1.11984 WP_003406624.1.120 WP_003406624.1.12001 WP_003406624.1.12049 WP_003406624.1.12052 WP_003406624.1.12100 WP_003406624.1.12116 WP_003406624.1.12130 WP_003406624.1.12133 WP_003406624.1.12161 WP_003406624.1.12165 WP_003406624.1.12184 WP_003406624.1.12187 WP_003406624.1.12190 WP_003406624.1.12216 WP_003406624.1.12265 WP_003406624.1.12275 WP_003406624.1.12293 WP_003406624.1.12294 WP_003406624.1.123 WP_003406624.1.1231 WP_003406624.1.12314 WP_003406624.1.12327 WP_003406624.1.12338 WP_003406624.1.1236 WP_003406624.1.12371 WP_003406624.1.12372 WP_003406624.1.12389 WP_003406624.1.12406 WP_003406624.1.1241 WP_003406624.1.12421 WP_003406624.1.12424 WP_003406624.1.12446 WP_003406624.1.12464 WP_003406624.1.12479 WP_003406624.1.12519 WP_003406624.1.12523 WP_003406624.1.12526 WP_003406624.1.1255 WP_003406624.1.12550 WP_003406624.1.12551 WP_003406624.1.12563 WP_003406624.1.12611 WP_003406624.1.12669 WP_003406624.1.1267 WP_003406624.1.12672 WP_003406624.1.12692 WP_003406624.1.1271 WP_003406624.1.12710 WP_003406624.1.12768 WP_003406624.1.1279 WP_003406624.1.12794 WP_003406624.1.12801 WP_003406624.1.12804 WP_003406624.1.12821 WP_003406624.1.12841 WP_003406624.1.12854 WP_003406624.1.12871 WP_003406624.1.12901 WP_003406624.1.12941 WP_003406624.1.12947 WP_003406624.1.12957 WP_003406624.1.12972 WP_003406624.1.13028 WP_003406624.1.13043 WP_003406624.1.13086 WP_003406624.1.13087 WP_003406624.1.13090 WP_003406624.1.13096 WP_003406624.1.13163 WP_003406624.1.13175 WP_003406624.1.13183 WP_003406624.1.132 WP_003406624.1.13282 WP_003406624.1.13284 WP_003406624.1.13296 WP_003406624.1.13298 WP_003406624.1.13302 WP_003406624.1.13306 WP_003406624.1.13312 WP_003406624.1.13313 WP_003406624.1.13321 WP_003406624.1.13345 WP_003406624.1.13358 WP_003406624.1.13370 WP_003406624.1.13375 WP_003406624.1.1338 WP_003406624.1.13420 WP_003406624.1.13433 WP_003406624.1.13435 WP_003406624.1.13438 WP_003406624.1.13461 WP_003406624.1.13466 WP_003406624.1.13489 WP_003406624.1.13526 WP_003406624.1.13551 WP_003406624.1.13561 WP_003406624.1.13564 WP_003406624.1.13579 WP_003406624.1.13647 WP_003406624.1.13667 WP_003406624.1.13687 WP_003406624.1.13697 WP_003406624.1.13719 WP_003406624.1.13763 WP_003406624.1.1377 WP_003406624.1.13774 WP_003406624.1.13786 WP_003406624.1.13793 WP_003406624.1.13794 WP_003406624.1.13817 WP_003406624.1.13834 WP_003406624.1.13866 WP_003406624.1.13880 WP_003406624.1.13899 WP_003406624.1.13909 WP_003406624.1.13910 WP_003406624.1.13919 WP_003406624.1.13920 WP_003406624.1.13952 WP_003406624.1.13953 WP_003406624.1.13962 WP_003406624.1.1398 WP_003406624.1.13988 WP_003406624.1.14027 WP_003406624.1.14046 WP_003406624.1.14115 WP_003406624.1.1415 WP_003406624.1.14152 WP_003406624.1.14158 WP_003406624.1.14162 WP_003406624.1.14175 WP_003406624.1.14178 WP_003406624.1.14194 WP_003406624.1.14195 WP_003406624.1.14208 WP_003406624.1.14238 WP_003406624.1.14266 WP_003406624.1.14273 WP_003406624.1.14303 WP_003406624.1.14306 WP_003406624.1.14307 WP_003406624.1.14310 WP_003406624.1.14341 WP_003406624.1.14382 WP_003406624.1.14416 WP_003406624.1.14428 WP_003406624.1.14441 WP_003406624.1.14469 WP_003406624.1.14477 WP_003406624.1.14504 WP_003406624.1.14514 WP_003406624.1.1452 WP_003406624.1.14527 WP_003406624.1.1454 WP_003406624.1.14544 WP_003406624.1.14548 WP_003406624.1.14551 WP_003406624.1.14561 WP_003406624.1.14573 WP_003406624.1.1462 WP_003406624.1.14658 WP_003406624.1.14667 WP_003406624.1.14668 WP_003406624.1.14675 WP_003406624.1.14694 WP_003406624.1.14695 WP_003406624.1.14709 WP_003406624.1.14766 WP_003406624.1.14783 WP_003406624.1.14865 WP_003406624.1.14872 WP_003406624.1.14905 WP_003406624.1.14926 WP_003406624.1.14951 WP_003406624.1.14955 WP_003406624.1.15003 WP_003406624.1.15009 WP_003406624.1.15028 WP_003406624.1.15040 WP_003406624.1.15052 WP_003406624.1.15065 WP_003406624.1.15072 WP_003406624.1.15089 WP_003406624.1.1509 WP_003406624.1.15126 WP_003406624.1.15131 WP_003406624.1.15168 WP_003406624.1.15172 WP_003406624.1.15174 WP_003406624.1.15187 WP_003406624.1.15196 WP_003406624.1.15210 WP_003406624.1.15216 WP_003406624.1.15217 WP_003406624.1.1523 WP_003406624.1.15232 WP_003406624.1.15238 WP_003406624.1.15240 WP_003406624.1.15253 WP_003406624.1.15267 WP_003406624.1.1527 WP_003406624.1.15292 WP_003406624.1.15299 WP_003406624.1.15302 WP_003406624.1.15322 WP_003406624.1.1534 WP_003406624.1.15345 WP_003406624.1.15365 WP_003406624.1.15372 WP_003406624.1.15386 WP_003406624.1.15387 WP_003406624.1.15442 WP_003406624.1.15447 WP_003406624.1.15449 WP_003406624.1.15477 WP_003406624.1.15481 WP_003406624.1.15492 WP_003406624.1.15511 WP_003406624.1.15512 WP_003406624.1.15558 WP_003406624.1.15559 WP_003406624.1.15566 WP_003406624.1.15599 WP_003406624.1.1560 WP_003406624.1.15611 WP_003406624.1.1563 WP_003406624.1.15633 WP_003406624.1.15643 WP_003406624.1.15688 WP_003406624.1.15755 WP_003406624.1.15763 WP_003406624.1.15774 WP_003406624.1.1578 WP_003406624.1.15780 WP_003406624.1.15827 WP_003406624.1.15834 WP_003406624.1.15842 WP_003406624.1.15853 WP_003406624.1.15870 WP_003406624.1.15877 WP_003406624.1.15893 WP_003406624.1.15896 WP_003406624.1.15926 WP_003406624.1.15933 WP_003406624.1.15946 WP_003406624.1.15958 WP_003406624.1.15973 WP_003406624.1.15987 WP_003406624.1.15993 WP_003406624.1.16009 WP_003406624.1.16025 WP_003406624.1.16043 WP_003406624.1.16055 WP_003406624.1.16066 WP_003406624.1.16069 WP_003406624.1.16077 WP_003406624.1.16106 WP_003406624.1.16108 WP_003406624.1.16110 WP_003406624.1.16130 WP_003406624.1.16136 WP_003406624.1.16139 WP_003406624.1.16141 WP_003406624.1.16143 WP_003406624.1.1630 WP_003406624.1.16318 WP_003406624.1.1632 WP_003406624.1.16327 WP_003406624.1.16334 WP_003406624.1.16341 WP_003406624.1.16345 WP_003406624.1.16374 WP_003406624.1.16384 WP_003406624.1.16386 WP_003406624.1.164 WP_003406624.1.1642 WP_003406624.1.16421 WP_003406624.1.16424 WP_003406624.1.16426 WP_003406624.1.16431 WP_003406624.1.16438 WP_003406624.1.1644 WP_003406624.1.16442 WP_003406624.1.16448 WP_003406624.1.16451 WP_003406624.1.16476 WP_003406624.1.16480 WP_003406624.1.16494 WP_003406624.1.1652 WP_003406624.1.16549 WP_003406624.1.16560 WP_003406624.1.16598 WP_003406624.1.16609 WP_003406624.1.16619 WP_003406624.1.16620 WP_003406624.1.16622 WP_003406624.1.16637 WP_003406624.1.1669 WP_003406624.1.16707 WP_003406624.1.16724 WP_003406624.1.16731 WP_003406624.1.16743 WP_003406624.1.1683 WP_003406624.1.16837 WP_003406624.1.16852 WP_003406624.1.16937 WP_003406624.1.16940 WP_003406624.1.16950 WP_003406624.1.16959 WP_003406624.1.16968 WP_003406624.1.1697 WP_003406624.1.16973 WP_003406624.1.16977 WP_003406624.1.16987 WP_003406624.1.17005 WP_003406624.1.17006 WP_003406624.1.17010 WP_003406624.1.17015 WP_003406624.1.17019 WP_003406624.1.17039 WP_003406624.1.17041 WP_003406624.1.17052 WP_003406624.1.17057 WP_003406624.1.17062 WP_003406624.1.1707 WP_003406624.1.17094 WP_003406624.1.17130 WP_003406624.1.17138 WP_003406624.1.17147 WP_003406624.1.17167 WP_003406624.1.17224 WP_003406624.1.17251 WP_003406624.1.17288 WP_003406624.1.17304 WP_003406624.1.17314 WP_003406624.1.17345 WP_003406624.1.17381 WP_003406624.1.17391 WP_003406624.1.17412 WP_003406624.1.1743 WP_003406624.1.17440 WP_003406624.1.17466 WP_003406624.1.17477 WP_003406624.1.17483 WP_003406624.1.17505 WP_003406624.1.17527 WP_003406624.1.17535 WP_003406624.1.17540 WP_003406624.1.17553 WP_003406624.1.17558 WP_003406624.1.17599 WP_003406624.1.17635 WP_003406624.1.17655 WP_003406624.1.17679 WP_003406624.1.1768 WP_003406624.1.17687 WP_003406624.1.17700 WP_003406624.1.17710 WP_003406624.1.17713 WP_003406624.1.17722 WP_003406624.1.17746 WP_003406624.1.17788 WP_003406624.1.17798 WP_003406624.1.17803 WP_003406624.1.17816 WP_003406624.1.17821 WP_003406624.1.17830 WP_003406624.1.17868 WP_003406624.1.17878 WP_003406624.1.1792 WP_003406624.1.17923 WP_003406624.1.1795 WP_003406624.1.17955 WP_003406624.1.17973 WP_003406624.1.18009 WP_003406624.1.18013 WP_003406624.1.18033 WP_003406624.1.18057 WP_003406624.1.18065 WP_003406624.1.18070 WP_003406624.1.18116 WP_003406624.1.18120 WP_003406624.1.18126 WP_003406624.1.1817 WP_003406624.1.18170 WP_003406624.1.18206 WP_003406624.1.18216 WP_003406624.1.18240 WP_003406624.1.18257 WP_003406624.1.18297 WP_003406624.1.18306 WP_003406624.1.18364 WP_003406624.1.18399 WP_003406624.1.18411 WP_003406624.1.18444 WP_003406624.1.18448 WP_003406624.1.18467 WP_003406624.1.18476 WP_003406624.1.18522 WP_003406624.1.18580 WP_003406624.1.18582 WP_003406624.1.18587 WP_003406624.1.186 WP_003406624.1.18601 WP_003406624.1.18639 WP_003406624.1.18646 WP_003406624.1.18647 WP_003406624.1.1868 WP_003406624.1.18694 WP_003406624.1.18710 WP_003406624.1.18751 WP_003406624.1.18781 WP_003406624.1.18793 WP_003406624.1.18804 WP_003406624.1.18816 WP_003406624.1.18823 WP_003406624.1.18827 WP_003406624.1.18838 WP_003406624.1.18849 WP_003406624.1.18856 WP_003406624.1.18945 WP_003406624.1.1898 WP_003406624.1.19005 WP_003406624.1.19056 WP_003406624.1.19063 WP_003406624.1.19066 WP_003406624.1.19071 WP_003406624.1.19085 WP_003406624.1.19094 WP_003406624.1.19144 WP_003406624.1.19159 WP_003406624.1.19193 WP_003406624.1.19231 WP_003406624.1.19243 WP_003406624.1.19264 WP_003406624.1.19295 WP_003406624.1.19307 WP_003406624.1.19326 WP_003406624.1.1933 WP_003406624.1.19364 WP_003406624.1.19382 WP_003406624.1.19400 WP_003406624.1.19426 WP_003406624.1.19429 WP_003406624.1.19464 WP_003406624.1.19480 WP_003406624.1.19512 WP_003406624.1.19553 WP_003406624.1.19562 WP_003406624.1.19564 WP_003406624.1.19568 WP_003406624.1.19572 WP_003406624.1.19595 WP_003406624.1.19596 WP_003406624.1.19600 WP_003406624.1.19630 WP_003406624.1.1967 WP_003406624.1.19694 WP_003406624.1.1970 WP_003406624.1.19707 WP_003406624.1.19742 WP_003406624.1.19785 WP_003406624.1.19820 WP_003406624.1.19868 WP_003406624.1.19874 WP_003406624.1.19890 WP_003406624.1.19900 WP_003406624.1.19922 WP_003406624.1.19936 WP_003406624.1.19946 WP_003406624.1.19949 WP_003406624.1.19960 WP_003406624.1.19964 WP_003406624.1.20007 WP_003406624.1.20016 WP_003406624.1.20028 WP_003406624.1.2003 WP_003406624.1.20037 WP_003406624.1.20039 WP_003406624.1.20082 WP_003406624.1.20085 WP_003406624.1.20097 WP_003406624.1.20116 WP_003406624.1.20130 WP_003406624.1.20140 WP_003406624.1.20141 WP_003406624.1.20142 WP_003406624.1.20158 WP_003406624.1.20239 WP_003406624.1.20243 WP_003406624.1.20259 WP_003406624.1.20262 WP_003406624.1.20268 WP_003406624.1.20272 WP_003406624.1.20273 WP_003406624.1.20280 WP_003406624.1.20294 WP_003406624.1.20300 WP_003406624.1.20309 WP_003406624.1.20322 WP_003406624.1.2037 WP_003406624.1.20372 WP_003406624.1.20381 WP_003406624.1.204 WP_003406624.1.20427 WP_003406624.1.20432 WP_003406624.1.20457 WP_003406624.1.20459 WP_003406624.1.20460 WP_003406624.1.20542 WP_003406624.1.20578 WP_003406624.1.20608 WP_003406624.1.20624 WP_003406624.1.20628 WP_003406624.1.2066 WP_003406624.1.20707 WP_003406624.1.20722 WP_003406624.1.20729 WP_003406624.1.20742 WP_003406624.1.20751 WP_003406624.1.20776 WP_003406624.1.20843 WP_003406624.1.20850 WP_003406624.1.2086 WP_003406624.1.20868 WP_003406624.1.20876 WP_003406624.1.20897 WP_003406624.1.20898 WP_003406624.1.2090 WP_003406624.1.20911 WP_003406624.1.20916 WP_003406624.1.20921 WP_003406624.1.20926 WP_003406624.1.20927 WP_003406624.1.20951 WP_003406624.1.20970 WP_003406624.1.2104 WP_003406624.1.21070 WP_003406624.1.21127 WP_003406624.1.21135 WP_003406624.1.21173 WP_003406624.1.21187 WP_003406624.1.212 WP_003406624.1.2120 WP_003406624.1.21218 WP_003406624.1.21219 WP_003406624.1.2123 WP_003406624.1.21231 WP_003406624.1.21234 WP_003406624.1.2126 WP_003406624.1.21292 WP_003406624.1.21307 WP_003406624.1.2131 WP_003406624.1.21311 WP_003406624.1.21321 WP_003406624.1.21365 WP_003406624.1.2137 WP_003406624.1.21392 WP_003406624.1.21397 WP_003406624.1.21403 WP_003406624.1.21415 WP_003406624.1.21430 WP_003406624.1.21434 WP_003406624.1.21444 WP_003406624.1.21468 WP_003406624.1.21498 WP_003406624.1.21509 WP_003406624.1.21513 WP_003406624.1.21560 WP_003406624.1.21565 WP_003406624.1.21586 WP_003406624.1.21591 WP_003406624.1.21594 WP_003406624.1.21602 WP_003406624.1.21615 WP_003406624.1.21638 WP_003406624.1.21639 WP_003406624.1.21655 WP_003406624.1.21658 WP_003406624.1.2168 WP_003406624.1.2174 WP_003406624.1.21741 WP_003406624.1.21742 WP_003406624.1.21777 WP_003406624.1.21786 WP_003406624.1.21795 WP_003406624.1.218 WP_003406624.1.21826 WP_003406624.1.21829 WP_003406624.1.21840 WP_003406624.1.21843 WP_003406624.1.21872 WP_003406624.1.2188 WP_003406624.1.21882 WP_003406624.1.21906 WP_003406624.1.21912 WP_003406624.1.2194 WP_003406624.1.21941 WP_003406624.1.21956 WP_003406624.1.21958 WP_003406624.1.21960 WP_003406624.1.21971 WP_003406624.1.21973 WP_003406624.1.21983 WP_003406624.1.22003 WP_003406624.1.22013 WP_003406624.1.22025 WP_003406624.1.22036 WP_003406624.1.22075 WP_003406624.1.22092 WP_003406624.1.2212 WP_003406624.1.22127 WP_003406624.1.22140 WP_003406624.1.22233 WP_003406624.1.22255 WP_003406624.1.22277 WP_003406624.1.22305 WP_003406624.1.22348 WP_003406624.1.22356 WP_003406624.1.22366 WP_003406624.1.2238 WP_003406624.1.22380 WP_003406624.1.22437 WP_003406624.1.22438 WP_003406624.1.22445 WP_003406624.1.22490 WP_003406624.1.22511 WP_003406624.1.22524 WP_003406624.1.2253 WP_003406624.1.22585 WP_003406624.1.22589 WP_003406624.1.22606 WP_003406624.1.22608 WP_003406624.1.22609 WP_003406624.1.22618 WP_003406624.1.2262 WP_003406624.1.22624 WP_003406624.1.22629 WP_003406624.1.22647 WP_003406624.1.22664 WP_003406624.1.22665 WP_003406624.1.22670 WP_003406624.1.22674 WP_003406624.1.22680 WP_003406624.1.22725 WP_003406624.1.22728 WP_003406624.1.22733 WP_003406624.1.22737 WP_003406624.1.2275 WP_003406624.1.22754 WP_003406624.1.22797 WP_003406624.1.22800 WP_003406624.1.22804 WP_003406624.1.22829 WP_003406624.1.22840 WP_003406624.1.22844 WP_003406624.1.22963 WP_003406624.1.22970 WP_003406624.1.22996 WP_003406624.1.22997 WP_003406624.1.22999 WP_003406624.1.23015 WP_003406624.1.23032 WP_003406624.1.231 WP_003406624.1.23101 WP_003406624.1.2312 WP_003406624.1.23140 WP_003406624.1.23153 WP_003406624.1.23171 WP_003406624.1.23199 WP_003406624.1.2320 WP_003406624.1.23204 WP_003406624.1.23216 WP_003406624.1.23229 WP_003406624.1.23233 WP_003406624.1.2326 WP_003406624.1.23261 WP_003406624.1.23272 WP_003406624.1.23289 WP_003406624.1.2329 WP_003406624.1.23308 WP_003406624.1.23316 WP_003406624.1.23321 WP_003406624.1.23325 WP_003406624.1.2339 WP_003406624.1.23406 WP_003406624.1.23438 WP_003406624.1.23445 WP_003406624.1.23447 WP_003406624.1.23452 WP_003406624.1.23461 WP_003406624.1.2349 WP_003406624.1.23496 WP_003406624.1.23497 WP_003406624.1.23506 WP_003406624.1.23530 WP_003406624.1.23539 WP_003406624.1.23546 WP_003406624.1.23551 WP_003406624.1.23573 WP_003406624.1.23583 WP_003406624.1.23588 WP_003406624.1.23628 WP_003406624.1.23677 WP_003406624.1.23683 WP_003406624.1.23692 WP_003406624.1.23694 WP_003406624.1.23699 WP_003406624.1.2371 WP_003406624.1.23803 WP_003406624.1.23807 WP_003406624.1.23825 WP_003406624.1.23832 WP_003406624.1.2384 WP_003406624.1.23843 WP_003406624.1.23863 WP_003406624.1.2387 WP_003406624.1.23894 WP_003406624.1.23993 WP_003406624.1.2400 WP_003406624.1.24007 WP_003406624.1.24008 WP_003406624.1.24046 WP_003406624.1.24057 WP_003406624.1.24062 WP_003406624.1.24113 WP_003406624.1.24119 WP_003406624.1.24128 WP_003406624.1.24140 WP_003406624.1.24176 WP_003406624.1.24190 WP_003406624.1.24202 WP_003406624.1.24244 WP_003406624.1.24261 WP_003406624.1.24284 WP_003406624.1.24294 WP_003406624.1.24357 WP_003406624.1.24396 WP_003406624.1.24414 WP_003406624.1.24423 WP_003406624.1.2443 WP_003406624.1.24446 WP_003406624.1.24461 WP_003406624.1.24500 WP_003406624.1.24507 WP_003406624.1.24509 WP_003406624.1.24529 WP_003406624.1.24553 WP_003406624.1.24629 WP_003406624.1.24638 WP_003406624.1.24648 WP_003406624.1.2466 WP_003406624.1.24767 WP_003406624.1.24824 WP_003406624.1.24831 WP_003406624.1.24840 WP_003406624.1.24848 WP_003406624.1.24857 WP_003406624.1.2487 WP_003406624.1.24893 WP_003406624.1.24907 WP_003406624.1.24933 WP_003406624.1.24956 WP_003406624.1.24958 WP_003406624.1.24985 WP_003406624.1.2499 WP_003406624.1.25004 WP_003406624.1.2505 WP_003406624.1.25051 WP_003406624.1.2507 WP_003406624.1.25096 WP_003406624.1.25103 WP_003406624.1.25129 WP_003406624.1.25171 WP_003406624.1.25184 WP_003406624.1.25247 WP_003406624.1.25252 WP_003406624.1.25278 WP_003406624.1.25283 WP_003406624.1.25309 WP_003406624.1.25313 WP_003406624.1.25338 WP_003406624.1.25342 WP_003406624.1.25343 WP_003406624.1.25367 WP_003406624.1.25393 WP_003406624.1.25406 WP_003406624.1.25435 WP_003406624.1.25437 WP_003406624.1.25445 WP_003406624.1.25455 WP_003406624.1.25473 WP_003406624.1.25504 WP_003406624.1.25513 WP_003406624.1.25542 WP_003406624.1.25579 WP_003406624.1.25594 WP_003406624.1.25606 WP_003406624.1.25645 WP_003406624.1.2566 WP_003406624.1.25673 WP_003406624.1.25674 WP_003406624.1.25693 WP_003406624.1.25699 WP_003406624.1.25727 WP_003406624.1.25736 WP_003406624.1.25738 WP_003406624.1.25756 WP_003406624.1.25759 WP_003406624.1.2580 WP_003406624.1.25813 WP_003406624.1.25853 WP_003406624.1.25854 WP_003406624.1.25874 WP_003406624.1.25885 WP_003406624.1.25892 WP_003406624.1.25914 WP_003406624.1.25916 WP_003406624.1.2594 WP_003406624.1.25954 WP_003406624.1.25965 WP_003406624.1.25972 WP_003406624.1.26017 WP_003406624.1.26032 WP_003406624.1.26038 WP_003406624.1.26072 WP_003406624.1.26089 WP_003406624.1.26097 WP_003406624.1.26098 WP_003406624.1.26108 WP_003406624.1.26109 WP_003406624.1.26118 WP_003406624.1.26126 WP_003406624.1.2614 WP_003406624.1.26168 WP_003406624.1.26182 WP_003406624.1.26190 WP_003406624.1.2620 WP_003406624.1.26234 WP_003406624.1.26243 WP_003406624.1.26265 WP_003406624.1.26267 WP_003406624.1.26292 WP_003406624.1.26310 WP_003406624.1.26328 WP_003406624.1.26349 WP_003406624.1.26366 WP_003406624.1.26374 WP_003406624.1.26407 WP_003406624.1.26412 WP_003406624.1.26454 WP_003406624.1.26464 WP_003406624.1.2653 WP_003406624.1.26560 WP_003406624.1.26571 WP_003406624.1.2659 WP_003406624.1.26597 WP_003406624.1.26603 WP_003406624.1.26629 WP_003406624.1.26651 WP_003406624.1.26702 WP_003406624.1.26707 WP_003406624.1.26710 WP_003406624.1.26737 WP_003406624.1.26738 WP_003406624.1.26745 WP_003406624.1.26756 WP_003406624.1.2676 WP_003406624.1.2677 WP_003406624.1.26779 WP_003406624.1.26780 WP_003406624.1.26798 WP_003406624.1.26854 WP_003406624.1.26868 WP_003406624.1.26876 WP_003406624.1.26888 WP_003406624.1.26914 WP_003406624.1.26945 WP_003406624.1.26959 WP_003406624.1.26969 WP_003406624.1.26984 WP_003406624.1.26992 WP_003406624.1.27004 WP_003406624.1.27017 WP_003406624.1.27045 WP_003406624.1.27074 WP_003406624.1.27075 WP_003406624.1.27128 WP_003406624.1.27130 WP_003406624.1.27139 WP_003406624.1.27152 WP_003406624.1.27162 WP_003406624.1.27164 WP_003406624.1.27193 WP_003406624.1.27235 WP_003406624.1.27254 WP_003406624.1.27278 WP_003406624.1.27343 WP_003406624.1.27352 WP_003406624.1.27369 WP_003406624.1.27391 WP_003406624.1.27398 WP_003406624.1.27402 WP_003406624.1.27410 WP_003406624.1.27411 WP_003406624.1.27449 WP_003406624.1.27460 WP_003406624.1.27463 WP_003406624.1.2749 WP_003406624.1.27492 WP_003406624.1.27528 WP_003406624.1.27541 WP_003406624.1.27576 WP_003406624.1.27582 WP_003406624.1.27596 WP_003406624.1.27607 WP_003406624.1.2766 WP_003406624.1.277 WP_003406624.1.27724 WP_003406624.1.27730 WP_003406624.1.27736 WP_003406624.1.27743 WP_003406624.1.27750 WP_003406624.1.27771 WP_003406624.1.27779 WP_003406624.1.27795 WP_003406624.1.27803 WP_003406624.1.27819 WP_003406624.1.27835 WP_003406624.1.27915 WP_003406624.1.27935 WP_003406624.1.27962 WP_003406624.1.28053 WP_003406624.1.28092 WP_003406624.1.28106 WP_003406624.1.28131 WP_003406624.1.28142 WP_003406624.1.28159 WP_003406624.1.2816 WP_003406624.1.28161 WP_003406624.1.28192 WP_003406624.1.28202 WP_003406624.1.28241 WP_003406624.1.28242 WP_003406624.1.28251 WP_003406624.1.28255 WP_003406624.1.28269 WP_003406624.1.28276 WP_003406624.1.28293 WP_003406624.1.28331 WP_003406624.1.28367 WP_003406624.1.28378 WP_003406624.1.28391 WP_003406624.1.2842 WP_003406624.1.28448 WP_003406624.1.2847 WP_003406624.1.28471 WP_003406624.1.28473 WP_003406624.1.28493 WP_003406624.1.28497 WP_003406624.1.28530 WP_003406624.1.28545 WP_003406624.1.28561 WP_003406624.1.28567 WP_003406624.1.28585 WP_003406624.1.286 WP_003406624.1.28610 WP_003406624.1.28617 WP_003406624.1.28634 WP_003406624.1.28642 WP_003406624.1.28671 WP_003406624.1.28682 WP_003406624.1.28698 WP_003406624.1.28703 WP_003406624.1.28739 WP_003406624.1.28758 WP_003406624.1.28781 WP_003406624.1.28787 WP_003406624.1.28827 WP_003406624.1.28839 WP_003406624.1.28847 WP_003406624.1.28850 WP_003406624.1.28851 WP_003406624.1.28865 WP_003406624.1.28897 WP_003406624.1.28914 WP_003406624.1.28935 WP_003406624.1.28936 WP_003406624.1.28939 WP_003406624.1.28943 WP_003406624.1.28952 WP_003406624.1.28975 WP_003406624.1.2899 WP_003406624.1.28993 WP_003406624.1.29000 WP_003406624.1.2901 WP_003406624.1.29028 WP_003406624.1.29033 WP_003406624.1.29058 WP_003406624.1.29078 WP_003406624.1.29102 WP_003406624.1.29115 WP_003406624.1.2916 WP_003406624.1.29217 WP_003406624.1.29223 WP_003406624.1.29234 WP_003406624.1.29264 WP_003406624.1.29275 WP_003406624.1.29306 WP_003406624.1.29339 WP_003406624.1.29348 WP_003406624.1.29364 WP_003406624.1.29367 WP_003406624.1.2938 WP_003406624.1.29399 WP_003406624.1.29426 WP_003406624.1.2944 WP_003406624.1.29449 WP_003406624.1.29450 WP_003406624.1.29452 WP_003406624.1.2949 WP_003406624.1.29510 WP_003406624.1.29515 WP_003406624.1.29525 WP_003406624.1.2953 WP_003406624.1.29559 WP_003406624.1.29587 WP_003406624.1.2959 WP_003406624.1.29592 WP_003406624.1.29599 WP_003406624.1.29611 WP_003406624.1.29632 WP_003406624.1.29649 WP_003406624.1.2965 WP_003406624.1.29659 WP_003406624.1.2969 WP_003406624.1.29696 WP_003406624.1.29698 WP_003406624.1.29718 WP_003406624.1.29742 WP_003406624.1.29745 WP_003406624.1.29747 WP_003406624.1.29769 WP_003406624.1.29825 WP_003406624.1.29830 WP_003406624.1.29847 WP_003406624.1.29861 WP_003406624.1.29869 WP_003406624.1.29883 WP_003406624.1.29890 WP_003406624.1.299 WP_003406624.1.29931 WP_003406624.1.29960 WP_003406624.1.30014 WP_003406624.1.3004 WP_003406624.1.30040 WP_003406624.1.30043 WP_003406624.1.30074 WP_003406624.1.30097 WP_003406624.1.30101 WP_003406624.1.30106 WP_003406624.1.30114 WP_003406624.1.30126 WP_003406624.1.30131 WP_003406624.1.30138 WP_003406624.1.30139 WP_003406624.1.30145 WP_003406624.1.30211 WP_003406624.1.30235 WP_003406624.1.30237 WP_003406624.1.3027 WP_003406624.1.30279 WP_003406624.1.30282 WP_003406624.1.30283 WP_003406624.1.30288 WP_003406624.1.30291 WP_003406624.1.30363 WP_003406624.1.30374 WP_003406624.1.30404 WP_003406624.1.3043 WP_003406624.1.30433 WP_003406624.1.30438 WP_003406624.1.30462 WP_003406624.1.30464 WP_003406624.1.30468 WP_003406624.1.30500 WP_003406624.1.3057 WP_003406624.1.30574 WP_003406624.1.30628 WP_003406624.1.30641 WP_003406624.1.30642 WP_003406624.1.30661 WP_003406624.1.30669 WP_003406624.1.30683 WP_003406624.1.30699 WP_003406624.1.30709 WP_003406624.1.30713 WP_003406624.1.30716 WP_003406624.1.30719 WP_003406624.1.30730 WP_003406624.1.30732 WP_003406624.1.30736 WP_003406624.1.30745 WP_003406624.1.30760 WP_003406624.1.30791 WP_003406624.1.308 WP_003406624.1.30807 WP_003406624.1.30818 WP_003406624.1.30824 WP_003406624.1.30848 WP_003406624.1.30877 WP_003406624.1.30888 WP_003406624.1.30901 WP_003406624.1.30903 WP_003406624.1.30912 WP_003406624.1.30913 WP_003406624.1.30914 WP_003406624.1.30919 WP_003406624.1.30977 WP_003406624.1.3100 WP_003406624.1.31002 WP_003406624.1.3101 WP_003406624.1.31034 WP_003406624.1.31047 WP_003406624.1.31070 WP_003406624.1.31074 WP_003406624.1.31102 WP_003406624.1.31127 WP_003406624.1.31184 WP_003406624.1.31199 WP_003406624.1.31226 WP_003406624.1.31230 WP_003406624.1.31233 WP_003406624.1.31263 WP_003406624.1.31264 WP_003406624.1.31270 WP_003406624.1.31287 WP_003406624.1.31290 WP_003406624.1.31304 WP_003406624.1.31346 WP_003406624.1.31348 WP_003406624.1.31354 WP_003406624.1.31390 WP_003406624.1.31414 WP_003406624.1.31417 WP_003406624.1.31428 WP_003406624.1.3143 WP_003406624.1.31458 WP_003406624.1.31483 WP_003406624.1.3149 WP_003406624.1.31498 WP_003406624.1.31507 WP_003406624.1.31537 WP_003406624.1.31548 WP_003406624.1.31569 WP_003406624.1.316 WP_003406624.1.31629 WP_003406624.1.31666 WP_003406624.1.31693 WP_003406624.1.31703 WP_003406624.1.31744 WP_003406624.1.31745 WP_003406624.1.31770 WP_003406624.1.31776 WP_003406624.1.31783 WP_003406624.1.318 WP_003406624.1.3184 WP_003406624.1.31840 WP_003406624.1.31880 WP_003406624.1.31911 WP_003406624.1.31930 WP_003406624.1.31932 WP_003406624.1.31955 WP_003406624.1.31985 WP_003406624.1.31991 WP_003406624.1.31995 WP_003406624.1.32004 WP_003406624.1.32039 WP_003406624.1.3204 WP_003406624.1.32045 WP_003406624.1.32071 WP_003406624.1.32098 WP_003406624.1.32132 WP_003406624.1.32157 WP_003406624.1.32164 WP_003406624.1.32179 WP_003406624.1.32198 WP_003406624.1.32297 WP_003406624.1.32317 WP_003406624.1.32383 WP_003406624.1.32400 WP_003406624.1.32403 WP_003406624.1.32416 WP_003406624.1.32421 WP_003406624.1.32433 WP_003406624.1.32461 WP_003406624.1.32482 WP_003406624.1.32503 WP_003406624.1.32556 WP_003406624.1.32562 WP_003406624.1.32569 WP_003406624.1.32592 WP_003406624.1.32620 WP_003406624.1.32647 WP_003406624.1.32653 WP_003406624.1.32654 WP_003406624.1.3268 WP_003406624.1.32695 WP_003406624.1.32706 WP_003406624.1.32716 WP_003406624.1.32738 WP_003406624.1.32752 WP_003406624.1.32780 WP_003406624.1.32781 WP_003406624.1.32793 WP_003406624.1.32799 WP_003406624.1.32822 WP_003406624.1.32833 WP_003406624.1.32862 WP_003406624.1.32880 WP_003406624.1.32897 WP_003406624.1.32909 WP_003406624.1.32935 WP_003406624.1.32974 WP_003406624.1.33007 WP_003406624.1.3302 WP_003406624.1.33028 WP_003406624.1.33035 WP_003406624.1.33044 WP_003406624.1.33054 WP_003406624.1.33082 WP_003406624.1.33141 WP_003406624.1.33148 WP_003406624.1.33155 WP_003406624.1.33168 WP_003406624.1.3321 WP_003406624.1.33215 WP_003406624.1.3325 WP_003406624.1.3327 WP_003406624.1.33278 WP_003406624.1.33288 WP_003406624.1.33305 WP_003406624.1.3331 WP_003406624.1.33319 WP_003406624.1.3333 WP_003406624.1.33393 WP_003406624.1.33403 WP_003406624.1.33452 WP_003406624.1.33467 WP_003406624.1.33477 WP_003406624.1.3349 WP_003406624.1.33519 WP_003406624.1.33542 WP_003406624.1.33601 WP_003406624.1.33602 WP_003406624.1.33633 WP_003406624.1.33646 WP_003406624.1.33673 WP_003406624.1.3369 WP_003406624.1.33705 WP_003406624.1.33762 WP_003406624.1.33783 WP_003406624.1.33789 WP_003406624.1.3383 WP_003406624.1.33832 WP_003406624.1.33839 WP_003406624.1.33848 WP_003406624.1.3387 WP_003406624.1.33886 WP_003406624.1.33895 WP_003406624.1.33906 WP_003406624.1.33912 WP_003406624.1.33954 WP_003406624.1.3399 WP_003406624.1.34042 WP_003406624.1.3405 WP_003406624.1.34055 WP_003406624.1.34056 WP_003406624.1.34065 WP_003406624.1.3408 WP_003406624.1.34090 WP_003406624.1.34109 WP_003406624.1.34111 WP_003406624.1.34131 WP_003406624.1.34152 WP_003406624.1.34153 WP_003406624.1.34163 WP_003406624.1.34181 WP_003406624.1.34197 WP_003406624.1.34198 WP_003406624.1.34215 WP_003406624.1.34219 WP_003406624.1.34255 WP_003406624.1.34260 WP_003406624.1.34275 WP_003406624.1.343 WP_003406624.1.34347 WP_003406624.1.34358 WP_003406624.1.34392 WP_003406624.1.344 WP_003406624.1.34428 WP_003406624.1.3443 WP_003406624.1.34435 WP_003406624.1.34446 WP_003406624.1.34499 WP_003406624.1.34505 WP_003406624.1.34516 WP_003406624.1.34529 WP_003406624.1.34551 WP_003406624.1.34563 WP_003406624.1.34576 WP_003406624.1.34581 WP_003406624.1.34588 WP_003406624.1.34596 WP_003406624.1.34599 WP_003406624.1.34639 WP_003406624.1.34673 WP_003406624.1.34724 WP_003406624.1.34740 WP_003406624.1.34755 WP_003406624.1.34777 WP_003406624.1.34783 WP_003406624.1.34841 WP_003406624.1.34908 WP_003406624.1.34919 WP_003406624.1.3492 WP_003406624.1.34933 WP_003406624.1.34945 WP_003406624.1.34946 WP_003406624.1.34954 WP_003406624.1.34960 WP_003406624.1.34961 WP_003406624.1.34963 WP_003406624.1.34965 WP_003406624.1.34968 WP_003406624.1.35023 WP_003406624.1.35069 WP_003406624.1.35072 WP_003406624.1.35078 WP_003406624.1.35100 WP_003406624.1.35146 WP_003406624.1.35156 WP_003406624.1.35160 WP_003406624.1.35162 WP_003406624.1.35173 WP_003406624.1.35176 WP_003406624.1.3520 WP_003406624.1.35213 WP_003406624.1.35221 WP_003406624.1.35246 WP_003406624.1.35278 WP_003406624.1.35301 WP_003406624.1.35311 WP_003406624.1.35312 WP_003406624.1.35317 WP_003406624.1.35319 WP_003406624.1.35347 WP_003406624.1.35363 WP_003406624.1.35382 WP_003406624.1.35385 WP_003406624.1.35396 WP_003406624.1.35397 WP_003406624.1.35403 WP_003406624.1.35426 WP_003406624.1.35439 WP_003406624.1.35455 WP_003406624.1.3548 WP_003406624.1.35484 WP_003406624.1.35492 WP_003406624.1.3553 WP_003406624.1.35553 WP_003406624.1.35555 WP_003406624.1.35561 WP_003406624.1.35602 WP_003406624.1.35610 WP_003406624.1.35635 WP_003406624.1.35657 WP_003406624.1.35680 WP_003406624.1.35687 WP_003406624.1.35689 WP_003406624.1.35707 WP_003406624.1.35732 WP_003406624.1.35754 WP_003406624.1.35767 WP_003406624.1.35770 WP_003406624.1.35771 WP_003406624.1.35780 WP_003406624.1.35805 WP_003406624.1.35811 WP_003406624.1.35821 WP_003406624.1.3584 WP_003406624.1.35848 WP_003406624.1.35864 WP_003406624.1.35874 WP_003406624.1.35876 WP_003406624.1.35897 WP_003406624.1.35899 WP_003406624.1.35923 WP_003406624.1.3593 WP_003406624.1.35954 WP_003406624.1.36005 WP_003406624.1.36014 WP_003406624.1.36023 WP_003406624.1.36051 WP_003406624.1.36053 WP_003406624.1.36075 WP_003406624.1.36089 WP_003406624.1.36097 WP_003406624.1.36098 WP_003406624.1.36116 WP_003406624.1.36145 WP_003406624.1.36156 WP_003406624.1.36205 WP_003406624.1.36228 WP_003406624.1.36246 WP_003406624.1.36252 WP_003406624.1.36260 WP_003406624.1.36270 WP_003406624.1.36271 WP_003406624.1.36303 WP_003406624.1.36309 WP_003406624.1.36315 WP_003406624.1.36319 WP_003406624.1.36321 WP_003406624.1.36326 WP_003406624.1.3634 WP_003406624.1.36356 WP_003406624.1.36357 WP_003406624.1.36385 WP_003406624.1.36399 WP_003406624.1.36436 WP_003406624.1.36465 WP_003406624.1.36469 WP_003406624.1.36473 WP_003406624.1.36485 WP_003406624.1.36508 WP_003406624.1.36540 WP_003406624.1.36561 WP_003406624.1.36571 WP_003406624.1.36573 WP_003406624.1.36578 WP_003406624.1.36585 WP_003406624.1.36597 WP_003406624.1.36614 WP_003406624.1.36657 WP_003406624.1.36674 WP_003406624.1.36720 WP_003406624.1.36727 WP_003406624.1.36733 WP_003406624.1.36785 WP_003406624.1.36810 WP_003406624.1.36844 WP_003406624.1.36851 WP_003406624.1.36862 WP_003406624.1.36893 WP_003406624.1.36901 WP_003406624.1.36921 WP_003406624.1.36935 WP_003406624.1.36941 WP_003406624.1.3695 WP_003406624.1.36951 WP_003406624.1.36968 WP_003406624.1.3700 WP_003406624.1.37004 WP_003406624.1.37012 WP_003406624.1.37071 WP_003406624.1.37088 WP_003406624.1.37131 WP_003406624.1.37157 WP_003406624.1.37175 WP_003406624.1.37188 WP_003406624.1.37213 WP_003406624.1.37229 WP_003406624.1.3724 WP_003406624.1.37277 WP_003406624.1.37305 WP_003406624.1.37330 WP_003406624.1.37389 WP_003406624.1.37400 WP_003406624.1.37440 WP_003406624.1.37459 WP_003406624.1.37468 WP_003406624.1.37475 WP_003406624.1.37484 WP_003406624.1.37601 WP_003406624.1.37612 WP_003406624.1.37632 WP_003406624.1.37643 WP_003406624.1.37655 WP_003406624.1.37660 WP_003406624.1.37674 WP_003406624.1.37700 WP_003406624.1.37701 WP_003406624.1.37709 WP_003406624.1.37711 WP_003406624.1.37721 WP_003406624.1.37722 WP_003406624.1.37747 WP_003406624.1.37765 WP_003406624.1.37772 WP_003406624.1.37804 WP_003406624.1.37809 WP_003406624.1.37859 WP_003406624.1.37877 WP_003406624.1.37913 WP_003406624.1.37943 WP_003406624.1.37950 WP_003406624.1.37973 WP_003406624.1.37975 WP_003406624.1.37983 WP_003406624.1.38 WP_003406624.1.38002 WP_003406624.1.3802 WP_003406624.1.38039 WP_003406624.1.38040 WP_003406624.1.38067 WP_003406624.1.38068 WP_003406624.1.38135 WP_003406624.1.38138 WP_003406624.1.38144 WP_003406624.1.38158 WP_003406624.1.38159 WP_003406624.1.38210 WP_003406624.1.38233 WP_003406624.1.38240 WP_003406624.1.38299 WP_003406624.1.38332 WP_003406624.1.38347 WP_003406624.1.38354 WP_003406624.1.38380 WP_003406624.1.38384 WP_003406624.1.38389 WP_003406624.1.38398 WP_003406624.1.38402 WP_003406624.1.38418 WP_003406624.1.38421 WP_003406624.1.38466 WP_003406624.1.38477 WP_003406624.1.38483 WP_003406624.1.3849 WP_003406624.1.385 WP_003406624.1.38530 WP_003406624.1.38535 WP_003406624.1.38539 WP_003406624.1.38594 WP_003406624.1.38601 WP_003406624.1.38611 WP_003406624.1.38638 WP_003406624.1.38639 WP_003406624.1.38646 WP_003406624.1.38648 WP_003406624.1.38654 WP_003406624.1.38659 WP_003406624.1.38660 WP_003406624.1.38666 WP_003406624.1.38671 WP_003406624.1.38672 WP_003406624.1.38677 WP_003406624.1.38750 WP_003406624.1.38772 WP_003406624.1.38812 WP_003406624.1.38821 WP_003406624.1.38844 WP_003406624.1.38863 WP_003406624.1.38865 WP_003406624.1.38873 WP_003406624.1.3889 WP_003406624.1.38894 WP_003406624.1.38909 WP_003406624.1.38939 WP_003406624.1.38974 WP_003406624.1.38975 WP_003406624.1.38991 WP_003406624.1.39025 WP_003406624.1.39070 WP_003406624.1.39072 WP_003406624.1.39095 WP_003406624.1.39106 WP_003406624.1.39165 WP_003406624.1.39174 WP_003406624.1.39176 WP_003406624.1.39178 WP_003406624.1.39190 WP_003406624.1.39201 WP_003406624.1.39207 WP_003406624.1.39211 WP_003406624.1.39236 WP_003406624.1.39239 WP_003406624.1.39252 WP_003406624.1.39288 WP_003406624.1.39295 WP_003406624.1.39306 WP_003406624.1.39359 WP_003406624.1.39364 WP_003406624.1.39400 WP_003406624.1.39447 WP_003406624.1.3945 WP_003406624.1.39450 WP_003406624.1.39455 WP_003406624.1.3949 WP_003406624.1.39521 WP_003406624.1.39560 WP_003406624.1.39592 WP_003406624.1.39593 WP_003406624.1.396 WP_003406624.1.3960 WP_003406624.1.39616 WP_003406624.1.39654 WP_003406624.1.39657 WP_003406624.1.39661 WP_003406624.1.39674 WP_003406624.1.39678 WP_003406624.1.3968 WP_003406624.1.39694 WP_003406624.1.3971 WP_003406624.1.39718 WP_003406624.1.39728 WP_003406624.1.39739 WP_003406624.1.39748 WP_003406624.1.39751 WP_003406624.1.39759 WP_003406624.1.39801 WP_003406624.1.39804 WP_003406624.1.39848 WP_003406624.1.39877 WP_003406624.1.39925 WP_003406624.1.3994 WP_003406624.1.39959 WP_003406624.1.3996 WP_003406624.1.39960 WP_003406624.1.3997 WP_003406624.1.39980 WP_003406624.1.40000 WP_003406624.1.40028 WP_003406624.1.40029 WP_003406624.1.4003 WP_003406624.1.40094 WP_003406624.1.40096 WP_003406624.1.40150 WP_003406624.1.40156 WP_003406624.1.40174 WP_003406624.1.40186 WP_003406624.1.40276 WP_003406624.1.40277 WP_003406624.1.40323 WP_003406624.1.40336 WP_003406624.1.40353 WP_003406624.1.4036 WP_003406624.1.40372 WP_003406624.1.40402 WP_003406624.1.40413 WP_003406624.1.40440 WP_003406624.1.40446 WP_003406624.1.40451 WP_003406624.1.40455 WP_003406624.1.40523 WP_003406624.1.40543 WP_003406624.1.40641 WP_003406624.1.40646 WP_003406624.1.40651 WP_003406624.1.40653 WP_003406624.1.4067 WP_003406624.1.40705 WP_003406624.1.40723 WP_003406624.1.40731 WP_003406624.1.40735 WP_003406624.1.40795 WP_003406624.1.40799 WP_003406624.1.40852 WP_003406624.1.40876 WP_003406624.1.40881 WP_003406624.1.40922 WP_003406624.1.40948 WP_003406624.1.4095 WP_003406624.1.40956 WP_003406624.1.40957 WP_003406624.1.40964 WP_003406624.1.4097 WP_003406624.1.410 WP_003406624.1.41000 WP_003406624.1.41055 WP_003406624.1.41108 WP_003406624.1.41123 WP_003406624.1.41177 WP_003406624.1.41202 WP_003406624.1.41219 WP_003406624.1.41231 WP_003406624.1.41249 WP_003406624.1.4127 WP_003406624.1.41296 WP_003406624.1.41355 WP_003406624.1.41376 WP_003406624.1.41430 WP_003406624.1.41447 WP_003406624.1.41469 WP_003406624.1.41504 WP_003406624.1.41553 WP_003406624.1.41564 WP_003406624.1.41583 WP_003406624.1.41616 WP_003406624.1.41632 WP_003406624.1.41635 WP_003406624.1.41636 WP_003406624.1.41648 WP_003406624.1.41660 WP_003406624.1.41685 WP_003406624.1.41695 WP_003406624.1.41704 WP_003406624.1.4171 WP_003406624.1.41719 WP_003406624.1.41733 WP_003406624.1.41744 WP_003406624.1.41774 WP_003406624.1.41791 WP_003406624.1.41803 WP_003406624.1.41820 WP_003406624.1.41828 WP_003406624.1.41829 WP_003406624.1.41860 WP_003406624.1.41912 WP_003406624.1.41921 WP_003406624.1.41933 WP_003406624.1.41944 WP_003406624.1.42043 WP_003406624.1.42075 WP_003406624.1.42078 WP_003406624.1.42094 WP_003406624.1.42112 WP_003406624.1.4212 WP_003406624.1.42122 WP_003406624.1.42134 WP_003406624.1.42183 WP_003406624.1.42188 WP_003406624.1.42201 WP_003406624.1.42202 WP_003406624.1.42208 WP_003406624.1.42247 WP_003406624.1.42255 WP_003406624.1.42273 WP_003406624.1.42278 WP_003406624.1.42304 WP_003406624.1.42309 WP_003406624.1.42370 WP_003406624.1.42385 WP_003406624.1.42400 WP_003406624.1.42409 WP_003406624.1.42414 WP_003406624.1.42417 WP_003406624.1.42430 WP_003406624.1.42461 WP_003406624.1.42465 WP_003406624.1.42467 WP_003406624.1.42473 WP_003406624.1.4248 WP_003406624.1.42494 WP_003406624.1.42519 WP_003406624.1.42524 WP_003406624.1.42534 WP_003406624.1.4255 WP_003406624.1.42562 WP_003406624.1.42568 WP_003406624.1.42570 WP_003406624.1.42618 WP_003406624.1.42660 WP_003406624.1.42695 WP_003406624.1.42704 WP_003406624.1.42705 WP_003406624.1.42722 WP_003406624.1.42777 WP_003406624.1.42782 WP_003406624.1.42835 WP_003406624.1.42839 WP_003406624.1.42842 WP_003406624.1.42905 WP_003406624.1.42916 WP_003406624.1.42930 WP_003406624.1.42971 WP_003406624.1.43005 WP_003406624.1.43009 WP_003406624.1.43053 WP_003406624.1.43082 WP_003406624.1.43087 WP_003406624.1.43098 WP_003406624.1.43208 WP_003406624.1.43236 WP_003406624.1.43246 WP_003406624.1.43255 WP_003406624.1.43266 WP_003406624.1.43269 WP_003406624.1.43273 WP_003406624.1.43296 WP_003406624.1.43306 WP_003406624.1.4335 WP_003406624.1.43368 WP_003406624.1.43395 WP_003406624.1.43457 WP_003406624.1.43462 WP_003406624.1.43475 WP_003406624.1.43478 WP_003406624.1.43484 WP_003406624.1.43557 WP_003406624.1.43578 WP_003406624.1.43588 WP_003406624.1.43643 WP_003406624.1.43664 WP_003406624.1.43684 WP_003406624.1.43686 WP_003406624.1.43706 WP_003406624.1.43716 WP_003406624.1.4377 WP_003406624.1.43781 WP_003406624.1.43794 WP_003406624.1.43815 WP_003406624.1.43846 WP_003406624.1.43861 WP_003406624.1.43863 WP_003406624.1.43866 WP_003406624.1.43872 WP_003406624.1.43885 WP_003406624.1.43897 WP_003406624.1.4390 WP_003406624.1.43902 WP_003406624.1.43921 WP_003406624.1.43936 WP_003406624.1.43937 WP_003406624.1.43960 WP_003406624.1.43965 WP_003406624.1.4399 WP_003406624.1.43993 WP_003406624.1.43996 WP_003406624.1.44 WP_003406624.1.44001 WP_003406624.1.44008 WP_003406624.1.44016 WP_003406624.1.44033 WP_003406624.1.44037 WP_003406624.1.44041 WP_003406624.1.44070 WP_003406624.1.44071 WP_003406624.1.44076 WP_003406624.1.44104 WP_003406624.1.44111 WP_003406624.1.44124 WP_003406624.1.44169 WP_003406624.1.44219 WP_003406624.1.44237 WP_003406624.1.44277 WP_003406624.1.44279 WP_003406624.1.44336 WP_003406624.1.44355 WP_003406624.1.44358 WP_003406624.1.4438 WP_003406624.1.44390 WP_003406624.1.44392 WP_003406624.1.4441 WP_003406624.1.44415 WP_003406624.1.44464 WP_003406624.1.44466 WP_003406624.1.44489 WP_003406624.1.44492 WP_003406624.1.44494 WP_003406624.1.44500 WP_003406624.1.44519 WP_003406624.1.44526 WP_003406624.1.44532 WP_003406624.1.44534 WP_003406624.1.44562 WP_003406624.1.44589 WP_003406624.1.44597 WP_003406624.1.44600 WP_003406624.1.44602 WP_003406624.1.44615 WP_003406624.1.4464 WP_003406624.1.44651 WP_003406624.1.44659 WP_003406624.1.44665 WP_003406624.1.44694 WP_003406624.1.44700 WP_003406624.1.44713 WP_003406624.1.44735 WP_003406624.1.44740 WP_003406624.1.44757 WP_003406624.1.4476 WP_003406624.1.44761 WP_003406624.1.44767 WP_003406624.1.44776 WP_003406624.1.44779 WP_003406624.1.44786 WP_003406624.1.44808 WP_003406624.1.44864 WP_003406624.1.44901 WP_003406624.1.44908 WP_003406624.1.44913 WP_003406624.1.4492 WP_003406624.1.44939 WP_003406624.1.44979 WP_003406624.1.44981 WP_003406624.1.45002 WP_003406624.1.45011 WP_003406624.1.4504 WP_003406624.1.45062 WP_003406624.1.45066 WP_003406624.1.45081 WP_003406624.1.45113 WP_003406624.1.45129 WP_003406624.1.45135 WP_003406624.1.45147 WP_003406624.1.45168 WP_003406624.1.4517 WP_003406624.1.45181 WP_003406624.1.45185 WP_003406624.1.45192 WP_003406624.1.45200 WP_003406624.1.45205 WP_003406624.1.45211 WP_003406624.1.45249 WP_003406624.1.4526 WP_003406624.1.45286 WP_003406624.1.45326 WP_003406624.1.45347 WP_003406624.1.45374 WP_003406624.1.45390 WP_003406624.1.454 WP_003406624.1.45407 WP_003406624.1.45451 WP_003406624.1.45453 WP_003406624.1.45460 WP_003406624.1.45463 WP_003406624.1.45470 WP_003406624.1.45474 WP_003406624.1.45491 WP_003406624.1.45510 WP_003406624.1.45563 WP_003406624.1.45584 WP_003406624.1.45590 WP_003406624.1.45619 WP_003406624.1.45626 WP_003406624.1.45631 WP_003406624.1.45666 WP_003406624.1.45697 WP_003406624.1.4571 WP_003406624.1.45731 WP_003406624.1.45743 WP_003406624.1.45765 WP_003406624.1.45776 WP_003406624.1.45783 WP_003406624.1.45805 WP_003406624.1.45815 WP_003406624.1.45849 WP_003406624.1.45867 WP_003406624.1.45884 WP_003406624.1.4590 WP_003406624.1.45923 WP_003406624.1.45926 WP_003406624.1.45963 WP_003406624.1.45989 WP_003406624.1.45992 WP_003406624.1.46025 WP_003406624.1.46083 WP_003406624.1.46090 WP_003406624.1.46092 WP_003406624.1.46100 WP_003406624.1.46101 WP_003406624.1.46103 WP_003406624.1.46107 WP_003406624.1.46127 WP_003406624.1.46128 WP_003406624.1.46129 WP_003406624.1.46141 WP_003406624.1.46150 WP_003406624.1.46201 WP_003406624.1.46226 WP_003406624.1.46253 WP_003406624.1.46268 WP_003406624.1.46285 WP_003406624.1.46300 WP_003406624.1.46313 WP_003406624.1.46336 WP_003406624.1.46365 WP_003406624.1.46370 WP_003406624.1.46381 WP_003406624.1.46402 WP_003406624.1.46411 WP_003406624.1.4644 WP_003406624.1.46442 WP_003406624.1.46453 WP_003406624.1.46463 WP_003406624.1.46478 WP_003406624.1.46492 WP_003406624.1.46521 WP_003406624.1.4653 WP_003406624.1.46532 WP_003406624.1.46539 WP_003406624.1.46568 WP_003406624.1.46585 WP_003406624.1.46609 WP_003406624.1.46613 WP_003406624.1.46625 WP_003406624.1.46642 WP_003406624.1.46647 WP_003406624.1.46674 WP_003406624.1.46724 WP_003406624.1.46758 WP_003406624.1.46773 WP_003406624.1.46777 WP_003406624.1.46786 WP_003406624.1.46792 WP_003406624.1.46847 WP_003406624.1.46851 WP_003406624.1.4687 WP_003406624.1.46897 WP_003406624.1.46936 WP_003406624.1.46980 WP_003406624.1.47011 WP_003406624.1.47012 WP_003406624.1.47066 WP_003406624.1.47077 WP_003406624.1.47083 WP_003406624.1.47106 WP_003406624.1.47142 WP_003406624.1.47147 WP_003406624.1.47166 WP_003406624.1.47178 WP_003406624.1.47179 WP_003406624.1.47194 WP_003406624.1.47207 WP_003406624.1.47210 WP_003406624.1.47261 WP_003406624.1.47262 WP_003406624.1.47402 WP_003406624.1.47423 WP_003406624.1.47467 WP_003406624.1.47502 WP_003406624.1.4751 WP_003406624.1.47511 WP_003406624.1.47537 WP_003406624.1.47540 WP_003406624.1.47568 WP_003406624.1.47572 WP_003406624.1.47588 WP_003406624.1.47636 WP_003406624.1.4764 WP_003406624.1.47653 WP_003406624.1.47679 WP_003406624.1.47681 WP_003406624.1.47690 WP_003406624.1.4771 WP_003406624.1.47717 WP_003406624.1.47743 WP_003406624.1.47754 WP_003406624.1.47773 WP_003406624.1.47776 WP_003406624.1.47780 WP_003406624.1.47805 WP_003406624.1.47832 WP_003406624.1.47847 WP_003406624.1.47858 WP_003406624.1.47861 WP_003406624.1.47868 WP_003406624.1.47893 WP_003406624.1.47899 WP_003406624.1.479 WP_003406624.1.47912 WP_003406624.1.47913 WP_003406624.1.47926 WP_003406624.1.4794 WP_003406624.1.47943 WP_003406624.1.47944 WP_003406624.1.47959 WP_003406624.1.47974 WP_003406624.1.47993 WP_003406624.1.48004 WP_003406624.1.48039 WP_003406624.1.48050 WP_003406624.1.48084 WP_003406624.1.48097 WP_003406624.1.48101 WP_003406624.1.48109 WP_003406624.1.4813 WP_003406624.1.48130 WP_003406624.1.48135 WP_003406624.1.48143 WP_003406624.1.48152 WP_003406624.1.48155 WP_003406624.1.48170 WP_003406624.1.48173 WP_003406624.1.48177 WP_003406624.1.48185 WP_003406624.1.48204 WP_003406624.1.48219 WP_003406624.1.4823 WP_003406624.1.48240 WP_003406624.1.48256 WP_003406624.1.48264 WP_003406624.1.48287 WP_003406624.1.48330 WP_003406624.1.48333 WP_003406624.1.48348 WP_003406624.1.48354 WP_003406624.1.48372 WP_003406624.1.48383 WP_003406624.1.48388 WP_003406624.1.48419 WP_003406624.1.48423 WP_003406624.1.48443 WP_003406624.1.48450 WP_003406624.1.48462 WP_003406624.1.48543 WP_003406624.1.48550 WP_003406624.1.48605 WP_003406624.1.48618 WP_003406624.1.4863 WP_003406624.1.48648 WP_003406624.1.48658 WP_003406624.1.48666 WP_003406624.1.48687 WP_003406624.1.48779 WP_003406624.1.4878 WP_003406624.1.48798 WP_003406624.1.48802 WP_003406624.1.48826 WP_003406624.1.48831 WP_003406624.1.48843 WP_003406624.1.48857 WP_003406624.1.4890 WP_003406624.1.48946 WP_003406624.1.48979 WP_003406624.1.49017 WP_003406624.1.49048 WP_003406624.1.49059 WP_003406624.1.4906 WP_003406624.1.4907 WP_003406624.1.49103 WP_003406624.1.49110 WP_003406624.1.49111 WP_003406624.1.49112 WP_003406624.1.4919 WP_003406624.1.49251 WP_003406624.1.49254 WP_003406624.1.49263 WP_003406624.1.49291 WP_003406624.1.49296 WP_003406624.1.49335 WP_003406624.1.49337 WP_003406624.1.49419 WP_003406624.1.49426 WP_003406624.1.49437 WP_003406624.1.49439 WP_003406624.1.49474 WP_003406624.1.49506 WP_003406624.1.49516 WP_003406624.1.49523 WP_003406624.1.49526 WP_003406624.1.49532 WP_003406624.1.49588 WP_003406624.1.4959 WP_003406624.1.49678 WP_003406624.1.49687 WP_003406624.1.49699 WP_003406624.1.49709 WP_003406624.1.4971 WP_003406624.1.4972 WP_003406624.1.49736 WP_003406624.1.49746 WP_003406624.1.49764 WP_003406624.1.49773 WP_003406624.1.49796 WP_003406624.1.49814 WP_003406624.1.49815 WP_003406624.1.49816 WP_003406624.1.49839 WP_003406624.1.49857 WP_003406624.1.49878 WP_003406624.1.49880 WP_003406624.1.49944 WP_003406624.1.4999 WP_003406624.1.49990 WP_003406624.1.50068 WP_003406624.1.50077 WP_003406624.1.5008 WP_003406624.1.50081 WP_003406624.1.50122 WP_003406624.1.50126 WP_003406624.1.50149 WP_003406624.1.50162 WP_003406624.1.5018 WP_003406624.1.50194 WP_003406624.1.50218 WP_003406624.1.50235 WP_003406624.1.50249 WP_003406624.1.50265 WP_003406624.1.50271 WP_003406624.1.50324 WP_003406624.1.50347 WP_003406624.1.50372 WP_003406624.1.50398 WP_003406624.1.50407 WP_003406624.1.50444 WP_003406624.1.50466 WP_003406624.1.50472 WP_003406624.1.5048 WP_003406624.1.50498 WP_003406624.1.5050 WP_003406624.1.50540 WP_003406624.1.50554 WP_003406624.1.50557 WP_003406624.1.50601 WP_003406624.1.50610 WP_003406624.1.50632 WP_003406624.1.50633 WP_003406624.1.50642 WP_003406624.1.50655 WP_003406624.1.50659 WP_003406624.1.50683 WP_003406624.1.50689 WP_003406624.1.50692 WP_003406624.1.50714 WP_003406624.1.50729 WP_003406624.1.50756 WP_003406624.1.50784 WP_003406624.1.50794 WP_003406624.1.50841 WP_003406624.1.50860 WP_003406624.1.50868 WP_003406624.1.50877 WP_003406624.1.5096 WP_003406624.1.50981 WP_003406624.1.50987 WP_003406624.1.51003 WP_003406624.1.51009 WP_003406624.1.51037 WP_003406624.1.51074 WP_003406624.1.51082 WP_003406624.1.51101 WP_003406624.1.51116 WP_003406624.1.51149 WP_003406624.1.51156 WP_003406624.1.51157 WP_003406624.1.51213 WP_003406624.1.51232 WP_003406624.1.51239 WP_003406624.1.51247 WP_003406624.1.51266 WP_003406624.1.51279 WP_003406624.1.51291 WP_003406624.1.51294 WP_003406624.1.51301 WP_003406624.1.51329 WP_003406624.1.51391 WP_003406624.1.51422 WP_003406624.1.51445 WP_003406624.1.51455 WP_003406624.1.51466 WP_003406624.1.51468 WP_003406624.1.51478 WP_003406624.1.51497 WP_003406624.1.51520 WP_003406624.1.51593 WP_003406624.1.51628 WP_003406624.1.5164 WP_003406624.1.51647 WP_003406624.1.51660 WP_003406624.1.51696 WP_003406624.1.51721 WP_003406624.1.51788 WP_003406624.1.51795 WP_003406624.1.51801 WP_003406624.1.51817 WP_003406624.1.51819 WP_003406624.1.51854 WP_003406624.1.51923 WP_003406624.1.51942 WP_003406624.1.51948 WP_003406624.1.51963 WP_003406624.1.51969 WP_003406624.1.52000 WP_003406624.1.52001 WP_003406624.1.52003 WP_003406624.1.52006 WP_003406624.1.52036 WP_003406624.1.52038 WP_003406624.1.52046 WP_003406624.1.52059 WP_003406624.1.52069 WP_003406624.1.52082 WP_003406624.1.52102 WP_003406624.1.52106 WP_003406624.1.52166 WP_003406624.1.52168 WP_003406624.1.52173 WP_003406624.1.52178 WP_003406624.1.52206 WP_003406624.1.52216 WP_003406624.1.52238 WP_003406624.1.52241 WP_003406624.1.52280 WP_003406624.1.52314 WP_003406624.1.52385 WP_003406624.1.52390 WP_003406624.1.524 WP_003406624.1.52460 WP_003406624.1.52485 WP_003406624.1.52486 WP_003406624.1.52495 WP_003406624.1.52504 WP_003406624.1.52522 WP_003406624.1.52531 WP_003406624.1.52533 WP_003406624.1.52545 WP_003406624.1.52553 WP_003406624.1.52563 WP_003406624.1.52564 WP_003406624.1.52574 WP_003406624.1.52641 WP_003406624.1.52673 WP_003406624.1.52674 WP_003406624.1.52708 WP_003406624.1.52713 WP_003406624.1.52761 WP_003406624.1.52778 WP_003406624.1.52791 WP_003406624.1.52797 WP_003406624.1.52818 WP_003406624.1.52872 WP_003406624.1.52873 WP_003406624.1.52891 WP_003406624.1.52892 WP_003406624.1.52909 WP_003406624.1.52970 WP_003406624.1.52998 WP_003406624.1.53053 WP_003406624.1.53056 WP_003406624.1.5306 WP_003406624.1.53088 WP_003406624.1.5309 WP_003406624.1.531 WP_003406624.1.53117 WP_003406624.1.53118 WP_003406624.1.53142 WP_003406624.1.53143 WP_003406624.1.53157 WP_003406624.1.53167 WP_003406624.1.53200 WP_003406624.1.53204 WP_003406624.1.53213 WP_003406624.1.53217 WP_003406624.1.53226 WP_003406624.1.53229 WP_003406624.1.53230 WP_003406624.1.53237 WP_003406624.1.53254 WP_003406624.1.53257 WP_003406624.1.5327 WP_003406624.1.53276 WP_003406624.1.53278 WP_003406624.1.533 WP_003406624.1.53302 WP_003406624.1.53306 WP_003406624.1.5334 WP_003406624.1.5335 WP_003406624.1.53353 WP_003406624.1.53381 WP_003406624.1.53413 WP_003406624.1.53458 WP_003406624.1.53460 WP_003406624.1.53480 WP_003406624.1.53517 WP_003406624.1.53522 WP_003406624.1.53525 WP_003406624.1.53526 WP_003406624.1.53553 WP_003406624.1.53606 WP_003406624.1.53609 WP_003406624.1.53628 WP_003406624.1.53643 WP_003406624.1.53667 WP_003406624.1.53679 WP_003406624.1.53715 WP_003406624.1.53730 WP_003406624.1.53742 WP_003406624.1.53743 WP_003406624.1.53754 WP_003406624.1.53775 WP_003406624.1.53803 WP_003406624.1.53818 WP_003406624.1.53822 WP_003406624.1.53853 WP_003406624.1.53865 WP_003406624.1.53888 WP_003406624.1.53900 WP_003406624.1.53912 WP_003406624.1.53914 WP_003406624.1.53952 WP_003406624.1.53973 WP_003406624.1.5398 WP_003406624.1.5408 WP_003406624.1.54089 WP_003406624.1.54093 WP_003406624.1.54099 WP_003406624.1.54112 WP_003406624.1.54125 WP_003406624.1.54141 WP_003406624.1.54162 WP_003406624.1.54179 WP_003406624.1.54206 WP_003406624.1.54218 WP_003406624.1.54225 WP_003406624.1.54227 WP_003406624.1.54232 WP_003406624.1.54241 WP_003406624.1.54245 WP_003406624.1.54247 WP_003406624.1.54260 WP_003406624.1.54275 WP_003406624.1.54280 WP_003406624.1.5429 WP_003406624.1.54294 WP_003406624.1.54314 WP_003406624.1.54347 WP_003406624.1.54351 WP_003406624.1.54370 WP_003406624.1.54428 WP_003406624.1.54449 WP_003406624.1.54494 WP_003406624.1.54502 WP_003406624.1.54514 WP_003406624.1.54519 WP_003406624.1.5452 WP_003406624.1.54531 WP_003406624.1.54537 WP_003406624.1.54553 WP_003406624.1.54555 WP_003406624.1.54575 WP_003406624.1.54633 WP_003406624.1.54686 WP_003406624.1.54687 WP_003406624.1.54705 WP_003406624.1.54730 WP_003406624.1.54732 WP_003406624.1.5475 WP_003406624.1.54797 WP_003406624.1.54807 WP_003406624.1.54836 WP_003406624.1.54838 WP_003406624.1.54860 WP_003406624.1.54888 WP_003406624.1.54897 WP_003406624.1.54905 WP_003406624.1.54909 WP_003406624.1.54937 WP_003406624.1.54939 WP_003406624.1.54944 WP_003406624.1.54945 WP_003406624.1.54953 WP_003406624.1.54964 WP_003406624.1.55015 WP_003406624.1.55022 WP_003406624.1.55023 WP_003406624.1.55051 WP_003406624.1.55072 WP_003406624.1.55088 WP_003406624.1.55106 WP_003406624.1.55126 WP_003406624.1.55128 WP_003406624.1.55140 WP_003406624.1.55150 WP_003406624.1.55210 WP_003406624.1.55227 WP_003406624.1.55248 WP_003406624.1.55257 WP_003406624.1.55258 WP_003406624.1.55267 WP_003406624.1.55279 WP_003406624.1.55307 WP_003406624.1.55326 WP_003406624.1.55328 WP_003406624.1.5533 WP_003406624.1.55345 WP_003406624.1.55396 WP_003406624.1.55398 WP_003406624.1.55441 WP_003406624.1.55459 WP_003406624.1.55501 WP_003406624.1.55504 WP_003406624.1.55578 WP_003406624.1.55626 WP_003406624.1.55641 WP_003406624.1.5569 WP_003406624.1.55723 WP_003406624.1.55735 WP_003406624.1.5574 WP_003406624.1.55772 WP_003406624.1.55802 WP_003406624.1.55807 WP_003406624.1.55819 WP_003406624.1.55821 WP_003406624.1.5583 WP_003406624.1.55849 WP_003406624.1.55856 WP_003406624.1.55860 WP_003406624.1.55882 WP_003406624.1.55883 WP_003406624.1.55894 WP_003406624.1.55902 WP_003406624.1.55908 WP_003406624.1.55909 WP_003406624.1.5591 WP_003406624.1.55961 WP_003406624.1.55977 WP_003406624.1.55983 WP_003406624.1.56028 WP_003406624.1.56057 WP_003406624.1.56060 WP_003406624.1.56107 WP_003406624.1.56132 WP_003406624.1.56163 WP_003406624.1.56167 WP_003406624.1.56178 WP_003406624.1.56287 WP_003406624.1.56292 WP_003406624.1.56327 WP_003406624.1.56341 WP_003406624.1.56359 WP_003406624.1.56365 WP_003406624.1.56394 WP_003406624.1.56443 WP_003406624.1.56473 WP_003406624.1.56478 WP_003406624.1.56500 WP_003406624.1.56517 WP_003406624.1.56534 WP_003406624.1.5656 WP_003406624.1.56577 WP_003406624.1.56593 WP_003406624.1.56625 WP_003406624.1.56637 WP_003406624.1.56670 WP_003406624.1.56697 WP_003406624.1.567 WP_003406624.1.56701 WP_003406624.1.56709 WP_003406624.1.56729 WP_003406624.1.56743 WP_003406624.1.56755 WP_003406624.1.56764 WP_003406624.1.56769 WP_003406624.1.56770 WP_003406624.1.56795 WP_003406624.1.5681 WP_003406624.1.56827 WP_003406624.1.56839 WP_003406624.1.56863 WP_003406624.1.56868 WP_003406624.1.56869 WP_003406624.1.56915 WP_003406624.1.56926 WP_003406624.1.56961 WP_003406624.1.56971 WP_003406624.1.56972 WP_003406624.1.57023 WP_003406624.1.57035 WP_003406624.1.57077 WP_003406624.1.57087 WP_003406624.1.57094 WP_003406624.1.57134 WP_003406624.1.57151 WP_003406624.1.57169 WP_003406624.1.57208 WP_003406624.1.57212 WP_003406624.1.57230 WP_003406624.1.5724 WP_003406624.1.5725 WP_003406624.1.5727 WP_003406624.1.57273 WP_003406624.1.573 WP_003406624.1.57314 WP_003406624.1.57326 WP_003406624.1.57328 WP_003406624.1.57331 WP_003406624.1.57340 WP_003406624.1.57351 WP_003406624.1.57352 WP_003406624.1.57380 WP_003406624.1.57430 WP_003406624.1.5744 WP_003406624.1.57440 WP_003406624.1.5745 WP_003406624.1.57461 WP_003406624.1.57469 WP_003406624.1.57489 WP_003406624.1.575 WP_003406624.1.57509 WP_003406624.1.57519 WP_003406624.1.57525 WP_003406624.1.57551 WP_003406624.1.5758 WP_003406624.1.57596 WP_003406624.1.57604 WP_003406624.1.57616 WP_003406624.1.57617 WP_003406624.1.57619 WP_003406624.1.57627 WP_003406624.1.57642 WP_003406624.1.57658 WP_003406624.1.57667 WP_003406624.1.57675 WP_003406624.1.57689 WP_003406624.1.57708 WP_003406624.1.57794 WP_003406624.1.57821 WP_003406624.1.57825 WP_003406624.1.57843 WP_003406624.1.57906 WP_003406624.1.57924 WP_003406624.1.57926 WP_003406624.1.57930 WP_003406624.1.57957 WP_003406624.1.57960 WP_003406624.1.57964 WP_003406624.1.57991 WP_003406624.1.58000 WP_003406624.1.58086 WP_003406624.1.58101 WP_003406624.1.58103 WP_003406624.1.58108 WP_003406624.1.5811 WP_003406624.1.58121 WP_003406624.1.58145 WP_003406624.1.58164 WP_003406624.1.58174 WP_003406624.1.582 WP_003406624.1.58202 WP_003406624.1.58209 WP_003406624.1.58215 WP_003406624.1.5824 WP_003406624.1.58250 WP_003406624.1.58259 WP_003406624.1.58283 WP_003406624.1.58288 WP_003406624.1.5830 WP_003406624.1.58303 WP_003406624.1.58311 WP_003406624.1.58330 WP_003406624.1.58359 WP_003406624.1.58386 WP_003406624.1.58393 WP_003406624.1.58431 WP_003406624.1.5844 WP_003406624.1.58457 WP_003406624.1.58488 WP_003406624.1.58518 WP_003406624.1.58534 WP_003406624.1.58559 WP_003406624.1.58567 WP_003406624.1.58573 WP_003406624.1.58602 WP_003406624.1.58612 WP_003406624.1.58619 WP_003406624.1.58630 WP_003406624.1.5865 WP_003406624.1.58671 WP_003406624.1.58690 WP_003406624.1.58702 WP_003406624.1.58743 WP_003406624.1.58754 WP_003406624.1.5879 WP_003406624.1.5881 WP_003406624.1.58824 WP_003406624.1.58848 WP_003406624.1.58857 WP_003406624.1.58891 WP_003406624.1.58892 WP_003406624.1.5890 WP_003406624.1.58904 WP_003406624.1.58921 WP_003406624.1.58930 WP_003406624.1.58939 WP_003406624.1.58941 WP_003406624.1.58953 WP_003406624.1.58961 WP_003406624.1.5898 WP_003406624.1.59025 WP_003406624.1.59029 WP_003406624.1.59037 WP_003406624.1.59044 WP_003406624.1.59085 WP_003406624.1.59088 WP_003406624.1.59112 WP_003406624.1.59130 WP_003406624.1.5914 WP_003406624.1.59147 WP_003406624.1.59166 WP_003406624.1.59205 WP_003406624.1.59209 WP_003406624.1.59237 WP_003406624.1.59240 WP_003406624.1.59253 WP_003406624.1.59254 WP_003406624.1.59262 WP_003406624.1.59270 WP_003406624.1.5928 WP_003406624.1.59304 WP_003406624.1.59305 WP_003406624.1.59309 WP_003406624.1.59316 WP_003406624.1.59326 WP_003406624.1.59328 WP_003406624.1.59333 WP_003406624.1.59338 WP_003406624.1.59388 WP_003406624.1.59428 WP_003406624.1.59487 WP_003406624.1.59537 WP_003406624.1.59561 WP_003406624.1.59677 WP_003406624.1.59722 WP_003406624.1.59727 WP_003406624.1.59732 WP_003406624.1.59738 WP_003406624.1.59750 WP_003406624.1.59757 WP_003406624.1.59761 WP_003406624.1.59808 WP_003406624.1.59850 WP_003406624.1.59856 WP_003406624.1.59860 WP_003406624.1.59861 WP_003406624.1.5987 WP_003406624.1.59878 WP_003406624.1.59888 WP_003406624.1.5996 WP_003406624.1.59961 WP_003406624.1.59974 WP_003406624.1.6000 WP_003406624.1.60007 WP_003406624.1.60016 WP_003406624.1.6003 WP_003406624.1.60047 WP_003406624.1.6007 WP_003406624.1.60091 WP_003406624.1.60121 WP_003406624.1.60125 WP_003406624.1.60135 WP_003406624.1.60139 WP_003406624.1.60152 WP_003406624.1.60171 WP_003406624.1.60197 WP_003406624.1.6020 WP_003406624.1.60205 WP_003406624.1.60207 WP_003406624.1.60215 WP_003406624.1.60217 WP_003406624.1.60267 WP_003406624.1.60288 WP_003406624.1.60291 WP_003406624.1.60301 WP_003406624.1.60305 WP_003406624.1.60312 WP_003406624.1.60313 WP_003406624.1.60314 WP_003406624.1.60367 WP_003406624.1.60376 WP_003406624.1.60403 WP_003406624.1.60413 WP_003406624.1.60421 WP_003406624.1.60451 WP_003406624.1.60460 WP_003406624.1.60479 WP_003406624.1.60487 WP_003406624.1.60512 WP_003406624.1.60573 WP_003406624.1.60583 WP_003406624.1.60632 WP_003406624.1.60657 WP_003406624.1.60687 WP_003406624.1.60689 WP_003406624.1.60727 WP_003406624.1.60738 WP_003406624.1.60763 WP_003406624.1.6077 WP_003406624.1.60791 WP_003406624.1.60834 WP_003406624.1.60870 WP_003406624.1.60878 WP_003406624.1.60879 WP_003406624.1.60913 WP_003406624.1.60978 WP_003406624.1.61000 WP_003406624.1.61001 WP_003406624.1.61012 WP_003406624.1.61014 WP_003406624.1.61015 WP_003406624.1.61037 WP_003406624.1.61052 WP_003406624.1.61065 WP_003406624.1.61100 WP_003406624.1.61101 WP_003406624.1.61138 WP_003406624.1.61142 WP_003406624.1.61198 WP_003406624.1.612 WP_003406624.1.61234 WP_003406624.1.61256 WP_003406624.1.61281 WP_003406624.1.61314 WP_003406624.1.61321 WP_003406624.1.61326 WP_003406624.1.61328 WP_003406624.1.61368 WP_003406624.1.61391 WP_003406624.1.61406 WP_003406624.1.61409 WP_003406624.1.61420 WP_003406624.1.61422 WP_003406624.1.61425 WP_003406624.1.61428 WP_003406624.1.61469 WP_003406624.1.61494 WP_003406624.1.61522 WP_003406624.1.61552 WP_003406624.1.61557 WP_003406624.1.61567 WP_003406624.1.61571 WP_003406624.1.61573 WP_003406624.1.61584 WP_003406624.1.61586 WP_003406624.1.6159 WP_003406624.1.61592 WP_003406624.1.6160 WP_003406624.1.61614 WP_003406624.1.6163 WP_003406624.1.61655 WP_003406624.1.61665 WP_003406624.1.61669 WP_003406624.1.61682 WP_003406624.1.61692 WP_003406624.1.61719 WP_003406624.1.61728 WP_003406624.1.61750 WP_003406624.1.61754 WP_003406624.1.61755 WP_003406624.1.61757 WP_003406624.1.61778 WP_003406624.1.6179 WP_003406624.1.61793 WP_003406624.1.61816 WP_003406624.1.61842 WP_003406624.1.61850 WP_003406624.1.61862 WP_003406624.1.61865 WP_003406624.1.61868 WP_003406624.1.61911 WP_003406624.1.61925 WP_003406624.1.61941 WP_003406624.1.61953 WP_003406624.1.61979 WP_003406624.1.61986 WP_003406624.1.61987 WP_003406624.1.61998 WP_003406624.1.62021 WP_003406624.1.62087 WP_003406624.1.62089 WP_003406624.1.62101 WP_003406624.1.62104 WP_003406624.1.6211 WP_003406624.1.62132 WP_003406624.1.62162 WP_003406624.1.62225 WP_003406624.1.62230 WP_003406624.1.62238 WP_003406624.1.62249 WP_003406624.1.62270 WP_003406624.1.62281 WP_003406624.1.62307 WP_003406624.1.6231 WP_003406624.1.62359 WP_003406624.1.62360 WP_003406624.1.62371 WP_003406624.1.62379 WP_003406624.1.62395 WP_003406624.1.62408 WP_003406624.1.62449 WP_003406624.1.62468 WP_003406624.1.6248 WP_003406624.1.62508 WP_003406624.1.62565 WP_003406624.1.62594 WP_003406624.1.62606 WP_003406624.1.62616 WP_003406624.1.62666 WP_003406624.1.62687 WP_003406624.1.62715 WP_003406624.1.62730 WP_003406624.1.62738 WP_003406624.1.62761 WP_003406624.1.62766 WP_003406624.1.62786 WP_003406624.1.62813 WP_003406624.1.62839 WP_003406624.1.62841 WP_003406624.1.62909 WP_003406624.1.62936 WP_003406624.1.6294 WP_003406624.1.6295 WP_003406624.1.62962 WP_003406624.1.63007 WP_003406624.1.63019 WP_003406624.1.63032 WP_003406624.1.63037 WP_003406624.1.63064 WP_003406624.1.63066 WP_003406624.1.63072 WP_003406624.1.6308 WP_003406624.1.63081 WP_003406624.1.63096 WP_003406624.1.63106 WP_003406624.1.6314 WP_003406624.1.63144 WP_003406624.1.63154 WP_003406624.1.63160 WP_003406624.1.63161 WP_003406624.1.63166 WP_003406624.1.63175 WP_003406624.1.63194 WP_003406624.1.6322 WP_003406624.1.63222 WP_003406624.1.63247 WP_003406624.1.6328 WP_003406624.1.63291 WP_003406624.1.63312 WP_003406624.1.63317 WP_003406624.1.63331 WP_003406624.1.63373 WP_003406624.1.63384 WP_003406624.1.63403 WP_003406624.1.63424 WP_003406624.1.63428 WP_003406624.1.6345 WP_003406624.1.63464 WP_003406624.1.63483 WP_003406624.1.63502 WP_003406624.1.63504 WP_003406624.1.63522 WP_003406624.1.63530 WP_003406624.1.63538 WP_003406624.1.63564 WP_003406624.1.63567 WP_003406624.1.63596 WP_003406624.1.63600 WP_003406624.1.63623 WP_003406624.1.63624 WP_003406624.1.63625 WP_003406624.1.63627 WP_003406624.1.63654 WP_003406624.1.63662 WP_003406624.1.63711 WP_003406624.1.63734 WP_003406624.1.63807 WP_003406624.1.63819 WP_003406624.1.63844 WP_003406624.1.63888 WP_003406624.1.63913 WP_003406624.1.63915 WP_003406624.1.63918 WP_003406624.1.63961 WP_003406624.1.63970 WP_003406624.1.64000 WP_003406624.1.64027 WP_003406624.1.64058 WP_003406624.1.64065 WP_003406624.1.6407 WP_003406624.1.64082 WP_003406624.1.64091 WP_003406624.1.64102 WP_003406624.1.64104 WP_003406624.1.64119 WP_003406624.1.64169 WP_003406624.1.64219 WP_003406624.1.6422 WP_003406624.1.64222 WP_003406624.1.64223 WP_003406624.1.64228 WP_003406624.1.64235 WP_003406624.1.64249 WP_003406624.1.6427 WP_003406624.1.64278 WP_003406624.1.64287 WP_003406624.1.64414 WP_003406624.1.64419 WP_003406624.1.6443 WP_003406624.1.64463 WP_003406624.1.64480 WP_003406624.1.64497 WP_003406624.1.64506 WP_003406624.1.64511 WP_003406624.1.64513 WP_003406624.1.64514 WP_003406624.1.64515 WP_003406624.1.64522 WP_003406624.1.64526 WP_003406624.1.64543 WP_003406624.1.6456 WP_003406624.1.64567 WP_003406624.1.64588 WP_003406624.1.64589 WP_003406624.1.64594 WP_003406624.1.64595 WP_003406624.1.64608 WP_003406624.1.64619 WP_003406624.1.64629 WP_003406624.1.6464 WP_003406624.1.64664 WP_003406624.1.64669 WP_003406624.1.64672 WP_003406624.1.64680 WP_003406624.1.64682 WP_003406624.1.64727 WP_003406624.1.64729 WP_003406624.1.64774 WP_003406624.1.64776 WP_003406624.1.64802 WP_003406624.1.64832 WP_003406624.1.6486 WP_003406624.1.64870 WP_003406624.1.64898 WP_003406624.1.64922 WP_003406624.1.64924 WP_003406624.1.6493 WP_003406624.1.64937 WP_003406624.1.64941 WP_003406624.1.64966 WP_003406624.1.64973 WP_003406624.1.65001 WP_003406624.1.65026 WP_003406624.1.65053 WP_003406624.1.65070 WP_003406624.1.65079 WP_003406624.1.65102 WP_003406624.1.65157 WP_003406624.1.65181 WP_003406624.1.65212 WP_003406624.1.65229 WP_003406624.1.6523 WP_003406624.1.65253 WP_003406624.1.65289 WP_003406624.1.65291 WP_003406624.1.65315 WP_003406624.1.65329 WP_003406624.1.65359 WP_003406624.1.6536 WP_003406624.1.65374 WP_003406624.1.65386 WP_003406624.1.65414 WP_003406624.1.65416 WP_003406624.1.65433 WP_003406624.1.65455 WP_003406624.1.65467 WP_003406624.1.65488 WP_003406624.1.65529 WP_003406624.1.65539 WP_003406624.1.65583 WP_003406624.1.65612 WP_003406624.1.65623 WP_003406624.1.65635 WP_003406624.1.65637 WP_003406624.1.65648 WP_003406624.1.65683 WP_003406624.1.65686 WP_003406624.1.65688 WP_003406624.1.65707 WP_003406624.1.65733 WP_003406624.1.65746 WP_003406624.1.65747 WP_003406624.1.65759 WP_003406624.1.65816 WP_003406624.1.65830 WP_003406624.1.65858 WP_003406624.1.65862 WP_003406624.1.65869 WP_003406624.1.65893 WP_003406624.1.65929 WP_003406624.1.65932 WP_003406624.1.65958 WP_003406624.1.65974 WP_003406624.1.66004 WP_003406624.1.66013 WP_003406624.1.6606 WP_003406624.1.66089 WP_003406624.1.66149 WP_003406624.1.66151 WP_003406624.1.66229 WP_003406624.1.66276 WP_003406624.1.66293 WP_003406624.1.66297 WP_003406624.1.66323 WP_003406624.1.66325 WP_003406624.1.6633 WP_003406624.1.66334 WP_003406624.1.66355 WP_003406624.1.66367 WP_003406624.1.66394 WP_003406624.1.66396 WP_003406624.1.66451 WP_003406624.1.66455 WP_003406624.1.66457 WP_003406624.1.66460 WP_003406624.1.66464 WP_003406624.1.66466 WP_003406624.1.66487 WP_003406624.1.66504 WP_003406624.1.66544 WP_003406624.1.66558 WP_003406624.1.66580 WP_003406624.1.66582 WP_003406624.1.66612 WP_003406624.1.66615 WP_003406624.1.66617 WP_003406624.1.66635 WP_003406624.1.66656 WP_003406624.1.66663 WP_003406624.1.66675 WP_003406624.1.66715 WP_003406624.1.66718 WP_003406624.1.66762 WP_003406624.1.66776 WP_003406624.1.66808 WP_003406624.1.66817 WP_003406624.1.66819 WP_003406624.1.66826 WP_003406624.1.66830 WP_003406624.1.66842 WP_003406624.1.66868 WP_003406624.1.66878 WP_003406624.1.66880 WP_003406624.1.66893 WP_003406624.1.66961 WP_003406624.1.67005 WP_003406624.1.6704 WP_003406624.1.67044 WP_003406624.1.67061 WP_003406624.1.67089 WP_003406624.1.67098 WP_003406624.1.67146 WP_003406624.1.67170 WP_003406624.1.67197 WP_003406624.1.67198 WP_003406624.1.6720 WP_003406624.1.67207 WP_003406624.1.67218 WP_003406624.1.67220 WP_003406624.1.67225 WP_003406624.1.67231 WP_003406624.1.6724 WP_003406624.1.67257 WP_003406624.1.67298 WP_003406624.1.67307 WP_003406624.1.67324 WP_003406624.1.67332 WP_003406624.1.67346 WP_003406624.1.67354 WP_003406624.1.67360 WP_003406624.1.67381 WP_003406624.1.67396 WP_003406624.1.67417 WP_003406624.1.67422 WP_003406624.1.67453 WP_003406624.1.67459 WP_003406624.1.6746 WP_003406624.1.67473 WP_003406624.1.67481 WP_003406624.1.67482 WP_003406624.1.67496 WP_003406624.1.67499 WP_003406624.1.67516 WP_003406624.1.67523 WP_003406624.1.67536 WP_003406624.1.67575 WP_003406624.1.67587 WP_003406624.1.67598 WP_003406624.1.67600 WP_003406624.1.67602 WP_003406624.1.67630 WP_003406624.1.67679 WP_003406624.1.67692 WP_003406624.1.67744 WP_003406624.1.6775 WP_003406624.1.67750 WP_003406624.1.6777 WP_003406624.1.67809 WP_003406624.1.67816 WP_003406624.1.67844 WP_003406624.1.67848 WP_003406624.1.67870 WP_003406624.1.67888 WP_003406624.1.67915 WP_003406624.1.67945 WP_003406624.1.67949 WP_003406624.1.67980 WP_003406624.1.67982 WP_003406624.1.68022 WP_003406624.1.68029 WP_003406624.1.68037 WP_003406624.1.68038 WP_003406624.1.68045 WP_003406624.1.68057 WP_003406624.1.68083 WP_003406624.1.68088 WP_003406624.1.68106 WP_003406624.1.68110 WP_003406624.1.68153 WP_003406624.1.68164 WP_003406624.1.68169 WP_003406624.1.68193 WP_003406624.1.68212 WP_003406624.1.68227 WP_003406624.1.68243 WP_003406624.1.6825 WP_003406624.1.68297 WP_003406624.1.68309 WP_003406624.1.68325 WP_003406624.1.68329 WP_003406624.1.68340 WP_003406624.1.68384 WP_003406624.1.68388 WP_003406624.1.68429 WP_003406624.1.6843 WP_003406624.1.68433 WP_003406624.1.68444 WP_003406624.1.68465 WP_003406624.1.68484 WP_003406624.1.68518 WP_003406624.1.68569 WP_003406624.1.68576 WP_003406624.1.68580 WP_003406624.1.68586 WP_003406624.1.68623 WP_003406624.1.68624 WP_003406624.1.68637 WP_003406624.1.68646 WP_003406624.1.68667 WP_003406624.1.68669 WP_003406624.1.68672 WP_003406624.1.68684 WP_003406624.1.68704 WP_003406624.1.68708 WP_003406624.1.6872 WP_003406624.1.68730 WP_003406624.1.68734 WP_003406624.1.68748 WP_003406624.1.68754 WP_003406624.1.6876 WP_003406624.1.68761 WP_003406624.1.68763 WP_003406624.1.68766 WP_003406624.1.68774 WP_003406624.1.68796 WP_003406624.1.68824 WP_003406624.1.68832 WP_003406624.1.68833 WP_003406624.1.68841 WP_003406624.1.68859 WP_003406624.1.68876 WP_003406624.1.68906 WP_003406624.1.68916 WP_003406624.1.68923 WP_003406624.1.68945 WP_003406624.1.6896 WP_003406624.1.68981 WP_003406624.1.68984 WP_003406624.1.68997 WP_003406624.1.69008 WP_003406624.1.69076 WP_003406624.1.69079 WP_003406624.1.6908 WP_003406624.1.69082 WP_003406624.1.69178 WP_003406624.1.69181 WP_003406624.1.69208 WP_003406624.1.69231 WP_003406624.1.69256 WP_003406624.1.69311 WP_003406624.1.69315 WP_003406624.1.69322 WP_003406624.1.69342 WP_003406624.1.6935 WP_003406624.1.6936 WP_003406624.1.69369 WP_003406624.1.69374 WP_003406624.1.69398 WP_003406624.1.69401 WP_003406624.1.69426 WP_003406624.1.69427 WP_003406624.1.69429 WP_003406624.1.6949 WP_003406624.1.6951 WP_003406624.1.69511 WP_003406624.1.69526 WP_003406624.1.69528 WP_003406624.1.69547 WP_003406624.1.69573 WP_003406624.1.69581 WP_003406624.1.6960 WP_003406624.1.69617 WP_003406624.1.69634 WP_003406624.1.69647 WP_003406624.1.69659 WP_003406624.1.69673 WP_003406624.1.69682 WP_003406624.1.69684 WP_003406624.1.69686 WP_003406624.1.69707 WP_003406624.1.69709 WP_003406624.1.69723 WP_003406624.1.69736 WP_003406624.1.69778 WP_003406624.1.69800 WP_003406624.1.69802 WP_003406624.1.69845 WP_003406624.1.69870 WP_003406624.1.69873 WP_003406624.1.69898 WP_003406624.1.69913 WP_003406624.1.69925 WP_003406624.1.69938 WP_003406624.1.69955 WP_003406624.1.69957 WP_003406624.1.69981 WP_003406624.1.69990 WP_003406624.1.70 WP_003406624.1.70000 WP_003406624.1.70017 WP_003406624.1.70032 WP_003406624.1.70055 WP_003406624.1.70062 WP_003406624.1.70072 WP_003406624.1.70131 WP_003406624.1.70132 WP_003406624.1.7022 WP_003406624.1.70227 WP_003406624.1.70255 WP_003406624.1.70271 WP_003406624.1.70274 WP_003406624.1.7029 WP_003406624.1.70325 WP_003406624.1.70328 WP_003406624.1.70356 WP_003406624.1.70364 WP_003406624.1.70368 WP_003406624.1.70369 WP_003406624.1.70418 WP_003406624.1.70422 WP_003406624.1.70435 WP_003406624.1.70444 WP_003406624.1.70463 WP_003406624.1.70471 WP_003406624.1.70480 WP_003406624.1.70494 WP_003406624.1.70498 WP_003406624.1.70505 WP_003406624.1.70525 WP_003406624.1.70573 WP_003406624.1.70577 WP_003406624.1.70610 WP_003406624.1.70615 WP_003406624.1.70618 WP_003406624.1.70622 WP_003406624.1.70626 WP_003406624.1.70668 WP_003406624.1.70699 WP_003406624.1.70704 WP_003406624.1.70729 WP_003406624.1.70757 WP_003406624.1.70782 WP_003406624.1.70796 WP_003406624.1.70830 WP_003406624.1.70834 WP_003406624.1.7084 WP_003406624.1.70840 WP_003406624.1.70864 WP_003406624.1.70871 WP_003406624.1.70915 WP_003406624.1.70955 WP_003406624.1.70958 WP_003406624.1.70964 WP_003406624.1.70976 WP_003406624.1.71015 WP_003406624.1.71026 WP_003406624.1.71063 WP_003406624.1.71076 WP_003406624.1.71083 WP_003406624.1.7111 WP_003406624.1.71118 WP_003406624.1.71128 WP_003406624.1.7113 WP_003406624.1.71187 WP_003406624.1.71191 WP_003406624.1.71255 WP_003406624.1.71258 WP_003406624.1.71259 WP_003406624.1.71289 WP_003406624.1.71326 WP_003406624.1.71329 WP_003406624.1.71331 WP_003406624.1.71344 WP_003406624.1.71390 WP_003406624.1.71399 WP_003406624.1.71414 WP_003406624.1.71440 WP_003406624.1.71457 WP_003406624.1.7146 WP_003406624.1.71464 WP_003406624.1.71490 WP_003406624.1.71492 WP_003406624.1.71509 WP_003406624.1.71516 WP_003406624.1.71517 WP_003406624.1.71527 WP_003406624.1.71532 WP_003406624.1.71545 WP_003406624.1.71546 WP_003406624.1.71569 WP_003406624.1.71604 WP_003406624.1.71621 WP_003406624.1.71630 WP_003406624.1.71638 WP_003406624.1.71654 WP_003406624.1.71664 WP_003406624.1.71665 WP_003406624.1.71683 WP_003406624.1.71701 WP_003406624.1.71718 WP_003406624.1.71731 WP_003406624.1.71778 WP_003406624.1.71781 WP_003406624.1.71803 WP_003406624.1.71820 WP_003406624.1.71847 WP_003406624.1.7185 WP_003406624.1.71851 WP_003406624.1.71871 WP_003406624.1.71909 WP_003406624.1.71957 WP_003406624.1.71970 WP_003406624.1.72047 WP_003406624.1.72061 WP_003406624.1.72062 WP_003406624.1.72072 WP_003406624.1.72111 WP_003406624.1.72122 WP_003406624.1.72128 WP_003406624.1.72143 WP_003406624.1.7216 WP_003406624.1.72168 WP_003406624.1.72179 WP_003406624.1.72209 WP_003406624.1.72218 WP_003406624.1.72219 WP_003406624.1.72227 WP_003406624.1.7224 WP_003406624.1.72268 WP_003406624.1.72332 WP_003406624.1.72380 WP_003406624.1.72401 WP_003406624.1.72405 WP_003406624.1.72420 WP_003406624.1.72441 WP_003406624.1.72451 WP_003406624.1.72452 WP_003406624.1.72457 WP_003406624.1.72459 WP_003406624.1.72460 WP_003406624.1.72466 WP_003406624.1.72487 WP_003406624.1.72488 WP_003406624.1.72492 WP_003406624.1.72506 WP_003406624.1.72543 WP_003406624.1.7256 WP_003406624.1.72576 WP_003406624.1.72578 WP_003406624.1.72585 WP_003406624.1.72591 WP_003406624.1.72592 WP_003406624.1.72640 WP_003406624.1.7266 WP_003406624.1.72661 WP_003406624.1.72684 WP_003406624.1.72739 WP_003406624.1.72744 WP_003406624.1.72755 WP_003406624.1.72759 WP_003406624.1.72784 WP_003406624.1.72792 WP_003406624.1.72826 WP_003406624.1.72831 WP_003406624.1.72852 WP_003406624.1.72853 WP_003406624.1.72879 WP_003406624.1.72880 WP_003406624.1.72938 WP_003406624.1.72954 WP_003406624.1.72957 WP_003406624.1.72959 WP_003406624.1.72973 WP_003406624.1.7298 WP_003406624.1.72982 WP_003406624.1.72988 WP_003406624.1.72993 WP_003406624.1.73006 WP_003406624.1.73013 WP_003406624.1.73025 WP_003406624.1.73028 WP_003406624.1.73042 WP_003406624.1.73045 WP_003406624.1.73092 WP_003406624.1.73118 WP_003406624.1.7312 WP_003406624.1.73127 WP_003406624.1.73134 WP_003406624.1.73150 WP_003406624.1.73154 WP_003406624.1.73163 WP_003406624.1.73182 WP_003406624.1.73205 WP_003406624.1.7321 WP_003406624.1.73310 WP_003406624.1.73315 WP_003406624.1.73365 WP_003406624.1.73391 WP_003406624.1.73404 WP_003406624.1.73424 WP_003406624.1.73436 WP_003406624.1.73445 WP_003406624.1.73453 WP_003406624.1.73465 WP_003406624.1.73466 WP_003406624.1.73470 WP_003406624.1.73471 WP_003406624.1.73478 WP_003406624.1.73482 WP_003406624.1.73507 WP_003406624.1.73532 WP_003406624.1.73550 WP_003406624.1.73564 WP_003406624.1.73623 WP_003406624.1.73629 WP_003406624.1.73644 WP_003406624.1.7366 WP_003406624.1.73661 WP_003406624.1.7368 WP_003406624.1.73688 WP_003406624.1.73723 WP_003406624.1.73744 WP_003406624.1.73750 WP_003406624.1.73760 WP_003406624.1.73774 WP_003406624.1.7379 WP_003406624.1.73813 WP_003406624.1.73840 WP_003406624.1.73876 WP_003406624.1.7389 WP_003406624.1.73986 WP_003406624.1.74016 WP_003406624.1.74039 WP_003406624.1.74083 WP_003406624.1.74101 WP_003406624.1.74107 WP_003406624.1.74120 WP_003406624.1.74129 WP_003406624.1.74144 WP_003406624.1.7417 WP_003406624.1.74190 WP_003406624.1.74210 WP_003406624.1.7423 WP_003406624.1.74259 WP_003406624.1.74262 WP_003406624.1.74269 WP_003406624.1.74282 WP_003406624.1.74291 WP_003406624.1.74296 WP_003406624.1.74304 WP_003406624.1.7432 WP_003406624.1.74347 WP_003406624.1.7436 WP_003406624.1.74378 WP_003406624.1.74382 WP_003406624.1.74395 WP_003406624.1.74400 WP_003406624.1.74401 WP_003406624.1.74432 WP_003406624.1.74442 WP_003406624.1.74477 WP_003406624.1.74487 WP_003406624.1.74499 WP_003406624.1.74504 WP_003406624.1.74511 WP_003406624.1.74523 WP_003406624.1.74525 WP_003406624.1.74551 WP_003406624.1.74555 WP_003406624.1.74628 WP_003406624.1.74641 WP_003406624.1.74653 WP_003406624.1.74660 WP_003406624.1.74683 WP_003406624.1.7469 WP_003406624.1.74725 WP_003406624.1.74760 WP_003406624.1.74786 WP_003406624.1.74809 WP_003406624.1.74820 WP_003406624.1.74870 WP_003406624.1.74881 WP_003406624.1.74888 WP_003406624.1.74952 WP_003406624.1.7496 WP_003406624.1.74988 WP_003406624.1.75043 WP_003406624.1.75045 WP_003406624.1.75055 WP_003406624.1.75078 WP_003406624.1.75081 WP_003406624.1.75120 WP_003406624.1.75163 WP_003406624.1.75188 WP_003406624.1.75200 WP_003406624.1.75202 WP_003406624.1.75234 WP_003406624.1.75239 WP_003406624.1.75250 WP_003406624.1.75263 WP_003406624.1.75281 WP_003406624.1.75342 WP_003406624.1.7535 WP_003406624.1.75376 WP_003406624.1.75391 WP_003406624.1.75395 WP_003406624.1.75441 WP_003406624.1.75510 WP_003406624.1.75581 WP_003406624.1.75598 WP_003406624.1.75635 WP_003406624.1.75645 WP_003406624.1.75665 WP_003406624.1.75671 WP_003406624.1.75741 WP_003406624.1.75749 WP_003406624.1.75772 WP_003406624.1.75774 WP_003406624.1.75811 WP_003406624.1.75833 WP_003406624.1.7585 WP_003406624.1.75864 WP_003406624.1.75868 WP_003406624.1.75878 WP_003406624.1.75927 WP_003406624.1.75946 WP_003406624.1.75968 WP_003406624.1.75974 WP_003406624.1.76007 WP_003406624.1.76016 WP_003406624.1.76032 WP_003406624.1.76037 WP_003406624.1.7604 WP_003406624.1.76045 WP_003406624.1.76052 WP_003406624.1.76058 WP_003406624.1.76064 WP_003406624.1.76110 WP_003406624.1.76126 WP_003406624.1.76133 WP_003406624.1.76138 WP_003406624.1.76157 WP_003406624.1.76172 WP_003406624.1.76177 WP_003406624.1.76183 WP_003406624.1.76209 WP_003406624.1.76239 WP_003406624.1.76272 WP_003406624.1.76277 WP_003406624.1.76280 WP_003406624.1.76281 WP_003406624.1.76291 WP_003406624.1.76297 WP_003406624.1.76360 WP_003406624.1.76379 WP_003406624.1.76403 WP_003406624.1.76413 WP_003406624.1.76414 WP_003406624.1.76427 WP_003406624.1.76436 WP_003406624.1.76442 WP_003406624.1.76443 WP_003406624.1.76456 WP_003406624.1.76521 WP_003406624.1.76533 WP_003406624.1.76616 WP_003406624.1.76625 WP_003406624.1.76629 WP_003406624.1.76635 WP_003406624.1.76638 WP_003406624.1.76639 WP_003406624.1.76640 WP_003406624.1.76644 WP_003406624.1.76677 WP_003406624.1.76678 WP_003406624.1.76679 WP_003406624.1.76734 WP_003406624.1.76744 WP_003406624.1.76750 WP_003406624.1.76754 WP_003406624.1.76757 WP_003406624.1.76781 WP_003406624.1.76818 WP_003406624.1.76824 WP_003406624.1.76835 WP_003406624.1.76873 WP_003406624.1.76881 WP_003406624.1.76888 WP_003406624.1.76900 WP_003406624.1.7691 WP_003406624.1.76947 WP_003406624.1.76954 WP_003406624.1.76955 WP_003406624.1.76963 WP_003406624.1.76976 WP_003406624.1.770 WP_003406624.1.77000 WP_003406624.1.77008 WP_003406624.1.77021 WP_003406624.1.77056 WP_003406624.1.77065 WP_003406624.1.77075 WP_003406624.1.77093 WP_003406624.1.77107 WP_003406624.1.77115 WP_003406624.1.77118 WP_003406624.1.77125 WP_003406624.1.77141 WP_003406624.1.77142 WP_003406624.1.77166 WP_003406624.1.77250 WP_003406624.1.77252 WP_003406624.1.77260 WP_003406624.1.77266 WP_003406624.1.77280 WP_003406624.1.77285 WP_003406624.1.77312 WP_003406624.1.77348 WP_003406624.1.77351 WP_003406624.1.77352 WP_003406624.1.77361 WP_003406624.1.774 WP_003406624.1.7740 WP_003406624.1.77404 WP_003406624.1.77425 WP_003406624.1.77463 WP_003406624.1.77474 WP_003406624.1.7748 WP_003406624.1.77484 WP_003406624.1.77491 WP_003406624.1.77499 WP_003406624.1.77510 WP_003406624.1.77530 WP_003406624.1.77554 WP_003406624.1.77559 WP_003406624.1.77599 WP_003406624.1.77605 WP_003406624.1.7762 WP_003406624.1.77627 WP_003406624.1.77649 WP_003406624.1.77654 WP_003406624.1.7766 WP_003406624.1.77667 WP_003406624.1.77704 WP_003406624.1.77706 WP_003406624.1.77726 WP_003406624.1.77774 WP_003406624.1.7778 WP_003406624.1.77790 WP_003406624.1.77809 WP_003406624.1.77820 WP_003406624.1.77843 WP_003406624.1.77855 WP_003406624.1.77865 WP_003406624.1.77868 WP_003406624.1.77879 WP_003406624.1.77890 WP_003406624.1.77909 WP_003406624.1.77911 WP_003406624.1.77931 WP_003406624.1.77984 WP_003406624.1.78020 WP_003406624.1.78024 WP_003406624.1.78075 WP_003406624.1.78084 WP_003406624.1.78086 WP_003406624.1.7809 WP_003406624.1.78098 WP_003406624.1.78105 WP_003406624.1.78113 WP_003406624.1.78136 WP_003406624.1.78162 WP_003406624.1.7817 WP_003406624.1.78200 WP_003406624.1.78216 WP_003406624.1.78236 WP_003406624.1.78238 WP_003406624.1.78322 WP_003406624.1.78338 WP_003406624.1.7836 WP_003406624.1.78360 WP_003406624.1.78386 WP_003406624.1.78429 WP_003406624.1.78435 WP_003406624.1.7844 WP_003406624.1.78459 WP_003406624.1.78488 WP_003406624.1.7849 WP_003406624.1.78499 WP_003406624.1.785 WP_003406624.1.78516 WP_003406624.1.78524 WP_003406624.1.78526 WP_003406624.1.78538 WP_003406624.1.78544 WP_003406624.1.78545 WP_003406624.1.78547 WP_003406624.1.78574 WP_003406624.1.78580 WP_003406624.1.7860 WP_003406624.1.78620 WP_003406624.1.78646 WP_003406624.1.78648 WP_003406624.1.78649 WP_003406624.1.78655 WP_003406624.1.78657 WP_003406624.1.78659 WP_003406624.1.7869 WP_003406624.1.78692 WP_003406624.1.78760 WP_003406624.1.78766 WP_003406624.1.78776 WP_003406624.1.78778 WP_003406624.1.78784 WP_003406624.1.78788 WP_003406624.1.78790 WP_003406624.1.78793 WP_003406624.1.78848 WP_003406624.1.78860 WP_003406624.1.7887 WP_003406624.1.78884 WP_003406624.1.78932 WP_003406624.1.78969 WP_003406624.1.78977 WP_003406624.1.78980 WP_003406624.1.79005 WP_003406624.1.79016 WP_003406624.1.79033 WP_003406624.1.79064 WP_003406624.1.79066 WP_003406624.1.79068 WP_003406624.1.79077 WP_003406624.1.79095 WP_003406624.1.79112 WP_003406624.1.79122 WP_003406624.1.79145 WP_003406624.1.79152 WP_003406624.1.79163 WP_003406624.1.79182 WP_003406624.1.79198 WP_003406624.1.79213 WP_003406624.1.79218 WP_003406624.1.79268 WP_003406624.1.79273 WP_003406624.1.79278 WP_003406624.1.79290 WP_003406624.1.79319 WP_003406624.1.79325 WP_003406624.1.79326 WP_003406624.1.7933 WP_003406624.1.79330 WP_003406624.1.79339 WP_003406624.1.79394 WP_003406624.1.79399 WP_003406624.1.79413 WP_003406624.1.79422 WP_003406624.1.79445 WP_003406624.1.79447 WP_003406624.1.79455 WP_003406624.1.79471 WP_003406624.1.79480 WP_003406624.1.79482 WP_003406624.1.79488 WP_003406624.1.79500 WP_003406624.1.79502 WP_003406624.1.79508 WP_003406624.1.79514 WP_003406624.1.79561 WP_003406624.1.79565 WP_003406624.1.79578 WP_003406624.1.79588 WP_003406624.1.79598 WP_003406624.1.79615 WP_003406624.1.79684 WP_003406624.1.79698 WP_003406624.1.797 WP_003406624.1.79744 WP_003406624.1.79784 WP_003406624.1.79802 WP_003406624.1.79806 WP_003406624.1.79819 WP_003406624.1.79826 WP_003406624.1.79828 WP_003406624.1.79851 WP_003406624.1.79853 WP_003406624.1.79863 WP_003406624.1.79881 WP_003406624.1.79885 WP_003406624.1.79898 WP_003406624.1.7990 WP_003406624.1.79900 WP_003406624.1.79913 WP_003406624.1.79918 WP_003406624.1.79947 WP_003406624.1.79948 WP_003406624.1.7995 WP_003406624.1.7997 WP_003406624.1.80004 WP_003406624.1.80015 WP_003406624.1.80022 WP_003406624.1.80030 WP_003406624.1.80054 WP_003406624.1.80084 WP_003406624.1.80099 WP_003406624.1.80129 WP_003406624.1.80177 WP_003406624.1.80234 WP_003406624.1.8026 WP_003406624.1.80275 WP_003406624.1.8029 WP_003406624.1.80299 WP_003406624.1.80300 WP_003406624.1.80304 WP_003406624.1.80326 WP_003406624.1.80351 WP_003406624.1.8037 WP_003406624.1.80370 WP_003406624.1.80387 WP_003406624.1.80399 WP_003406624.1.8044 WP_003406624.1.80451 WP_003406624.1.80458 WP_003406624.1.80461 WP_003406624.1.80490 WP_003406624.1.80503 WP_003406624.1.80507 WP_003406624.1.80552 WP_003406624.1.80576 WP_003406624.1.80588 WP_003406624.1.80599 WP_003406624.1.8060 WP_003406624.1.80624 WP_003406624.1.80636 WP_003406624.1.80669 WP_003406624.1.80673 WP_003406624.1.80711 WP_003406624.1.80714 WP_003406624.1.80743 WP_003406624.1.80784 WP_003406624.1.80815 WP_003406624.1.80853 WP_003406624.1.80918 WP_003406624.1.8093 WP_003406624.1.80967 WP_003406624.1.8097 WP_003406624.1.80988 WP_003406624.1.81007 WP_003406624.1.81013 WP_003406624.1.8105 WP_003406624.1.81059 WP_003406624.1.81063 WP_003406624.1.81066 WP_003406624.1.81075 WP_003406624.1.81091 WP_003406624.1.81119 WP_003406624.1.81125 WP_003406624.1.81136 WP_003406624.1.8114 WP_003406624.1.81189 WP_003406624.1.81192 WP_003406624.1.812 WP_003406624.1.81230 WP_003406624.1.81249 WP_003406624.1.81250 WP_003406624.1.81264 WP_003406624.1.8128 WP_003406624.1.81287 WP_003406624.1.81297 WP_003406624.1.8138 WP_003406624.1.81407 WP_003406624.1.8143 WP_003406624.1.81439 WP_003406624.1.81465 WP_003406624.1.81505 WP_003406624.1.81529 WP_003406624.1.81538 WP_003406624.1.81541 WP_003406624.1.81560 WP_003406624.1.81561 WP_003406624.1.81567 WP_003406624.1.81583 WP_003406624.1.81686 WP_003406624.1.81712 WP_003406624.1.81720 WP_003406624.1.81731 WP_003406624.1.81774 WP_003406624.1.81788 WP_003406624.1.81809 WP_003406624.1.81820 WP_003406624.1.81850 WP_003406624.1.81883 WP_003406624.1.81891 WP_003406624.1.81911 WP_003406624.1.81918 WP_003406624.1.82011 WP_003406624.1.82048 WP_003406624.1.82069 WP_003406624.1.82071 WP_003406624.1.82108 WP_003406624.1.82136 WP_003406624.1.82142 WP_003406624.1.8215 WP_003406624.1.82158 WP_003406624.1.8217 WP_003406624.1.82209 WP_003406624.1.82210 WP_003406624.1.82228 WP_003406624.1.82236 WP_003406624.1.82251 WP_003406624.1.82271 WP_003406624.1.82305 WP_003406624.1.82307 WP_003406624.1.82317 WP_003406624.1.8232 WP_003406624.1.82346 WP_003406624.1.82374 WP_003406624.1.82385 WP_003406624.1.82429 WP_003406624.1.82460 WP_003406624.1.82462 WP_003406624.1.82483 WP_003406624.1.82494 WP_003406624.1.82531 WP_003406624.1.82546 WP_003406624.1.82547 WP_003406624.1.82549 WP_003406624.1.82577 WP_003406624.1.82592 WP_003406624.1.82597 WP_003406624.1.82598 WP_003406624.1.82625 WP_003406624.1.82642 WP_003406624.1.82651 WP_003406624.1.82653 WP_003406624.1.82681 WP_003406624.1.82685 WP_003406624.1.8271 WP_003406624.1.82712 WP_003406624.1.8273 WP_003406624.1.82743 WP_003406624.1.82757 WP_003406624.1.82774 WP_003406624.1.82803 WP_003406624.1.82836 WP_003406624.1.82860 WP_003406624.1.82871 WP_003406624.1.82892 WP_003406624.1.82935 WP_003406624.1.82957 WP_003406624.1.82973 WP_003406624.1.82981 WP_003406624.1.82983 WP_003406624.1.83004 WP_003406624.1.83009 WP_003406624.1.83044 WP_003406624.1.83065 WP_003406624.1.83074 WP_003406624.1.83110 WP_003406624.1.83146 WP_003406624.1.83149 WP_003406624.1.83159 WP_003406624.1.8317 WP_003406624.1.83173 WP_003406624.1.83181 WP_003406624.1.83182 WP_003406624.1.83191 WP_003406624.1.83197 WP_003406624.1.83212 WP_003406624.1.8326 WP_003406624.1.83262 WP_003406624.1.83268 WP_003406624.1.83273 WP_003406624.1.83309 WP_003406624.1.83332 WP_003406624.1.83334 WP_003406624.1.83341 WP_003406624.1.83349 WP_003406624.1.8335 WP_003406624.1.83353 WP_003406624.1.83367 WP_003406624.1.83380 WP_003406624.1.83381 WP_003406624.1.83389 WP_003406624.1.83408 WP_003406624.1.83409 WP_003406624.1.83435 WP_003406624.1.83470 WP_003406624.1.83524 WP_003406624.1.83526 WP_003406624.1.8358 WP_003406624.1.83589 WP_003406624.1.83601 WP_003406624.1.83611 WP_003406624.1.83638 WP_003406624.1.83648 WP_003406624.1.83656 WP_003406624.1.83667 WP_003406624.1.83689 WP_003406624.1.83692 WP_003406624.1.83704 WP_003406624.1.83705 WP_003406624.1.83766 WP_003406624.1.83793 WP_003406624.1.83794 WP_003406624.1.83802 WP_003406624.1.83805 WP_003406624.1.83839 WP_003406624.1.83842 WP_003406624.1.83850 WP_003406624.1.83861 WP_003406624.1.83884 WP_003406624.1.83920 WP_003406624.1.83929 WP_003406624.1.83930 WP_003406624.1.83975 WP_003406624.1.83991 WP_003406624.1.8400 WP_003406624.1.84027 WP_003406624.1.8404 WP_003406624.1.84057 WP_003406624.1.84070 WP_003406624.1.8409 WP_003406624.1.84112 WP_003406624.1.84146 WP_003406624.1.8415 WP_003406624.1.84176 WP_003406624.1.84186 WP_003406624.1.84192 WP_003406624.1.84228 WP_003406624.1.8424 WP_003406624.1.84244 WP_003406624.1.84259 WP_003406624.1.8426 WP_003406624.1.84277 WP_003406624.1.84287 WP_003406624.1.8434 WP_003406624.1.84388 WP_003406624.1.84408 WP_003406624.1.84409 WP_003406624.1.84438 WP_003406624.1.84460 WP_003406624.1.84488 WP_003406624.1.84504 WP_003406624.1.84620 WP_003406624.1.84623 WP_003406624.1.84641 WP_003406624.1.84655 WP_003406624.1.84666 WP_003406624.1.84670 WP_003406624.1.84739 WP_003406624.1.84748 WP_003406624.1.84766 WP_003406624.1.84772 WP_003406624.1.84774 WP_003406624.1.848 WP_003406624.1.84812 WP_003406624.1.84836 WP_003406624.1.84839 WP_003406624.1.84846 WP_003406624.1.84873 WP_003406624.1.84911 WP_003406624.1.84938 WP_003406624.1.84968 WP_003406624.1.84973 WP_003406624.1.84981 WP_003406624.1.84985 WP_003406624.1.8503 WP_003406624.1.85038 WP_003406624.1.85041 WP_003406624.1.85043 WP_003406624.1.8505 WP_003406624.1.85074 WP_003406624.1.8509 WP_003406624.1.8512 WP_003406624.1.85148 WP_003406624.1.8518 WP_003406624.1.8522 WP_003406624.1.85242 WP_003406624.1.85276 WP_003406624.1.85281 WP_003406624.1.85284 WP_003406624.1.85314 WP_003406624.1.85319 WP_003406624.1.85330 WP_003406624.1.85341 WP_003406624.1.85346 WP_003406624.1.8535 WP_003406624.1.85363 WP_003406624.1.85371 WP_003406624.1.85377 WP_003406624.1.85387 WP_003406624.1.85399 WP_003406624.1.85458 WP_003406624.1.8546 WP_003406624.1.85464 WP_003406624.1.85478 WP_003406624.1.85480 WP_003406624.1.85488 WP_003406624.1.85495 WP_003406624.1.85551 WP_003406624.1.85557 WP_003406624.1.85577 WP_003406624.1.85597 WP_003406624.1.85599 WP_003406624.1.85610 WP_003406624.1.8563 WP_003406624.1.85648 WP_003406624.1.85679 WP_003406624.1.85704 WP_003406624.1.85717 WP_003406624.1.85727 WP_003406624.1.85763 WP_003406624.1.85808 WP_003406624.1.85819 WP_003406624.1.85820 WP_003406624.1.85823 WP_003406624.1.85832 WP_003406624.1.8586 WP_003406624.1.85872 WP_003406624.1.85894 WP_003406624.1.85909 WP_003406624.1.85913 WP_003406624.1.85953 WP_003406624.1.85986 WP_003406624.1.86000 WP_003406624.1.86024 WP_003406624.1.86025 WP_003406624.1.86032 WP_003406624.1.86048 WP_003406624.1.86052 WP_003406624.1.86067 WP_003406624.1.86103 WP_003406624.1.86122 WP_003406624.1.86124 WP_003406624.1.86160 WP_003406624.1.86164 WP_003406624.1.86168 WP_003406624.1.86190 WP_003406624.1.86204 WP_003406624.1.86208 WP_003406624.1.86235 WP_003406624.1.86249 WP_003406624.1.86260 WP_003406624.1.86290 WP_003406624.1.863 WP_003406624.1.86327 WP_003406624.1.86334 WP_003406624.1.86337 WP_003406624.1.86368 WP_003406624.1.86377 WP_003406624.1.86425 WP_003406624.1.86459 WP_003406624.1.8649 WP_003406624.1.86499 WP_003406624.1.86520 WP_003406624.1.86561 WP_003406624.1.86568 WP_003406624.1.86575 WP_003406624.1.86584 WP_003406624.1.86605 WP_003406624.1.86626 WP_003406624.1.86648 WP_003406624.1.8666 WP_003406624.1.86684 WP_003406624.1.86696 WP_003406624.1.86705 WP_003406624.1.86718 WP_003406624.1.86725 WP_003406624.1.86757 WP_003406624.1.86766 WP_003406624.1.86801 WP_003406624.1.86814 WP_003406624.1.86820 WP_003406624.1.86825 WP_003406624.1.86834 WP_003406624.1.8685 WP_003406624.1.86851 WP_003406624.1.86855 WP_003406624.1.86867 WP_003406624.1.86877 WP_003406624.1.86883 WP_003406624.1.8689 WP_003406624.1.86892 WP_003406624.1.86933 WP_003406624.1.86941 WP_003406624.1.86950 WP_003406624.1.86962 WP_003406624.1.86963 WP_003406624.1.86979 WP_003406624.1.8700 WP_003406624.1.87001 WP_003406624.1.87002 WP_003406624.1.87031 WP_003406624.1.87116 WP_003406624.1.87117 WP_003406624.1.8714 WP_003406624.1.87162 WP_003406624.1.87178 WP_003406624.1.87191 WP_003406624.1.87201 WP_003406624.1.87209 WP_003406624.1.87240 WP_003406624.1.87266 WP_003406624.1.87273 WP_003406624.1.87275 WP_003406624.1.8733 WP_003406624.1.87345 WP_003406624.1.87369 WP_003406624.1.8737 WP_003406624.1.87401 WP_003406624.1.87404 WP_003406624.1.87406 WP_003406624.1.87409 WP_003406624.1.87444 WP_003406624.1.87446 WP_003406624.1.87459 WP_003406624.1.87472 WP_003406624.1.87489 WP_003406624.1.87494 WP_003406624.1.87496 WP_003406624.1.87582 WP_003406624.1.87588 WP_003406624.1.87617 WP_003406624.1.87619 WP_003406624.1.87620 WP_003406624.1.87634 WP_003406624.1.87643 WP_003406624.1.8765 WP_003406624.1.87650 WP_003406624.1.87654 WP_003406624.1.87658 WP_003406624.1.87665 WP_003406624.1.87676 WP_003406624.1.87677 WP_003406624.1.87684 WP_003406624.1.87692 WP_003406624.1.87707 WP_003406624.1.87732 WP_003406624.1.87784 WP_003406624.1.87796 WP_003406624.1.87809 WP_003406624.1.87817 WP_003406624.1.87827 WP_003406624.1.87831 WP_003406624.1.87835 WP_003406624.1.87837 WP_003406624.1.87866 WP_003406624.1.8789 WP_003406624.1.87911 WP_003406624.1.87924 WP_003406624.1.87951 WP_003406624.1.87955 WP_003406624.1.87956 WP_003406624.1.87991 WP_003406624.1.88 WP_003406624.1.88002 WP_003406624.1.88037 WP_003406624.1.88039 WP_003406624.1.88072 WP_003406624.1.88077 WP_003406624.1.88121 WP_003406624.1.88180 WP_003406624.1.88191 WP_003406624.1.88205 WP_003406624.1.88217 WP_003406624.1.88219 WP_003406624.1.88245 WP_003406624.1.88253 WP_003406624.1.88294 WP_003406624.1.88315 WP_003406624.1.88316 WP_003406624.1.88320 WP_003406624.1.88338 WP_003406624.1.8840 WP_003406624.1.88437 WP_003406624.1.88453 WP_003406624.1.88469 WP_003406624.1.88489 WP_003406624.1.88507 WP_003406624.1.88521 WP_003406624.1.88530 WP_003406624.1.88537 WP_003406624.1.88541 WP_003406624.1.88592 WP_003406624.1.88616 WP_003406624.1.88618 WP_003406624.1.8862 WP_003406624.1.88625 WP_003406624.1.88632 WP_003406624.1.88634 WP_003406624.1.88649 WP_003406624.1.8870 WP_003406624.1.88737 WP_003406624.1.888 WP_003406624.1.88824 WP_003406624.1.88886 WP_003406624.1.88965 WP_003406624.1.88985 WP_003406624.1.8902 WP_003406624.1.89025 WP_003406624.1.89041 WP_003406624.1.89046 WP_003406624.1.89082 WP_003406624.1.89162 WP_003406624.1.89168 WP_003406624.1.8917 WP_003406624.1.89193 WP_003406624.1.89205 WP_003406624.1.89207 WP_003406624.1.89225 WP_003406624.1.8925 WP_003406624.1.89277 WP_003406624.1.89286 WP_003406624.1.89293 WP_003406624.1.89320 WP_003406624.1.8935 WP_003406624.1.89371 WP_003406624.1.89378 WP_003406624.1.89392 WP_003406624.1.89406 WP_003406624.1.8943 WP_003406624.1.89451 WP_003406624.1.89453 WP_003406624.1.89473 WP_003406624.1.89475 WP_003406624.1.89483 WP_003406624.1.895 WP_003406624.1.89513 WP_003406624.1.89517 WP_003406624.1.89522 WP_003406624.1.8954 WP_003406624.1.89543 WP_003406624.1.89567 WP_003406624.1.8957 WP_003406624.1.89572 WP_003406624.1.89589 WP_003406624.1.89607 WP_003406624.1.89613 WP_003406624.1.89625 WP_003406624.1.89648 WP_003406624.1.8967 WP_003406624.1.89670 WP_003406624.1.89676 WP_003406624.1.89729 WP_003406624.1.89739 WP_003406624.1.89762 WP_003406624.1.8977 WP_003406624.1.89802 WP_003406624.1.89808 WP_003406624.1.8982 WP_003406624.1.89829 WP_003406624.1.89831 WP_003406624.1.89844 WP_003406624.1.89849 WP_003406624.1.8989 WP_003406624.1.89901 WP_003406624.1.89903 WP_003406624.1.89909 WP_003406624.1.8992 WP_003406624.1.89922 WP_003406624.1.89926 WP_003406624.1.89963 WP_003406624.1.89971 WP_003406624.1.8998 WP_003406624.1.89987 WP_003406624.1.900 WP_003406624.1.90048 WP_003406624.1.9007 WP_003406624.1.90080 WP_003406624.1.90130 WP_003406624.1.90134 WP_003406624.1.90137 WP_003406624.1.90157 WP_003406624.1.90184 WP_003406624.1.90199 WP_003406624.1.90231 WP_003406624.1.90245 WP_003406624.1.90308 WP_003406624.1.90322 WP_003406624.1.90328 WP_003406624.1.90372 WP_003406624.1.90439 WP_003406624.1.90481 WP_003406624.1.90499 WP_003406624.1.9050 WP_003406624.1.90527 WP_003406624.1.90550 WP_003406624.1.90560 WP_003406624.1.90612 WP_003406624.1.90640 WP_003406624.1.90672 WP_003406624.1.90691 WP_003406624.1.90711 WP_003406624.1.90722 WP_003406624.1.90744 WP_003406624.1.9075 WP_003406624.1.90756 WP_003406624.1.90767 WP_003406624.1.90771 WP_003406624.1.90785 WP_003406624.1.90788 WP_003406624.1.90800 WP_003406624.1.90810 WP_003406624.1.90816 WP_003406624.1.90819 WP_003406624.1.9082 WP_003406624.1.90831 WP_003406624.1.90884 WP_003406624.1.90899 WP_003406624.1.90906 WP_003406624.1.90958 WP_003406624.1.90976 WP_003406624.1.90977 WP_003406624.1.90987 WP_003406624.1.9102 WP_003406624.1.91026 WP_003406624.1.91032 WP_003406624.1.91043 WP_003406624.1.91053 WP_003406624.1.91082 WP_003406624.1.91106 WP_003406624.1.91112 WP_003406624.1.91144 WP_003406624.1.91151 WP_003406624.1.91157 WP_003406624.1.91167 WP_003406624.1.91169 WP_003406624.1.91192 WP_003406624.1.91201 WP_003406624.1.91207 WP_003406624.1.91208 WP_003406624.1.91211 WP_003406624.1.91214 WP_003406624.1.91230 WP_003406624.1.91244 WP_003406624.1.91251 WP_003406624.1.91260 WP_003406624.1.91265 WP_003406624.1.9128 WP_003406624.1.91284 WP_003406624.1.91294 WP_003406624.1.91303 WP_003406624.1.91322 WP_003406624.1.91352 WP_003406624.1.91386 WP_003406624.1.9139 WP_003406624.1.91398 WP_003406624.1.91411 WP_003406624.1.91430 WP_003406624.1.91436 WP_003406624.1.91483 WP_003406624.1.91496 WP_003406624.1.91507 WP_003406624.1.91508 WP_003406624.1.91576 WP_003406624.1.91589 WP_003406624.1.91694 WP_003406624.1.91695 WP_003406624.1.91713 WP_003406624.1.91716 WP_003406624.1.91717 WP_003406624.1.91728 WP_003406624.1.91743 WP_003406624.1.91759 WP_003406624.1.91784 WP_003406624.1.91785 WP_003406624.1.91786 WP_003406624.1.91802 WP_003406624.1.91822 WP_003406624.1.91828 WP_003406624.1.9189 WP_003406624.1.91896 WP_003406624.1.9190 WP_003406624.1.91915 WP_003406624.1.91931 WP_003406624.1.91937 WP_003406624.1.91944 WP_003406624.1.91953 WP_003406624.1.91957 WP_003406624.1.91976 WP_003406624.1.91978 WP_003406624.1.92021 WP_003406624.1.92083 WP_003406624.1.92127 WP_003406624.1.92144 WP_003406624.1.92150 WP_003406624.1.92153 WP_003406624.1.92190 WP_003406624.1.92192 WP_003406624.1.92200 WP_003406624.1.92220 WP_003406624.1.92221 WP_003406624.1.92222 WP_003406624.1.92273 WP_003406624.1.92289 WP_003406624.1.9229 WP_003406624.1.92294 WP_003406624.1.92300 WP_003406624.1.92317 WP_003406624.1.92334 WP_003406624.1.92338 WP_003406624.1.92345 WP_003406624.1.92356 WP_003406624.1.92364 WP_003406624.1.92380 WP_003406624.1.92416 WP_003406624.1.92428 WP_003406624.1.92447 WP_003406624.1.92456 WP_003406624.1.92467 WP_003406624.1.92471 WP_003406624.1.92490 WP_003406624.1.92508 WP_003406624.1.9251 WP_003406624.1.92511 WP_003406624.1.92523 WP_003406624.1.92527 WP_003406624.1.92536 WP_003406624.1.92592 WP_003406624.1.92597 WP_003406624.1.92603 WP_003406624.1.92606 WP_003406624.1.92610 WP_003406624.1.92613 WP_003406624.1.9263 WP_003406624.1.9265 WP_003406624.1.92650 WP_003406624.1.92660 WP_003406624.1.92677 WP_003406624.1.92685 WP_003406624.1.92689 WP_003406624.1.92690 WP_003406624.1.92706 WP_003406624.1.92714 WP_003406624.1.92736 WP_003406624.1.9274 WP_003406624.1.92752 WP_003406624.1.92760 WP_003406624.1.92777 WP_003406624.1.92803 WP_003406624.1.92833 WP_003406624.1.92856 WP_003406624.1.92881 WP_003406624.1.92892 WP_003406624.1.92907 WP_003406624.1.92908 WP_003406624.1.9291 WP_003406624.1.92917 WP_003406624.1.92996 WP_003406624.1.93006 WP_003406624.1.93008 WP_003406624.1.93009 WP_003406624.1.93015 WP_003406624.1.93043 WP_003406624.1.9307 WP_003406624.1.93083 WP_003406624.1.93097 WP_003406624.1.93137 WP_003406624.1.93192 WP_003406624.1.93199 WP_003406624.1.93203 WP_003406624.1.93212 WP_003406624.1.93234 WP_003406624.1.93245 WP_003406624.1.93257 WP_003406624.1.93265 WP_003406624.1.93297 WP_003406624.1.93320 WP_003406624.1.93328 WP_003406624.1.93337 WP_003406624.1.93343 WP_003406624.1.93349 WP_003406624.1.93363 WP_003406624.1.93377 WP_003406624.1.9338 WP_003406624.1.93407 WP_003406624.1.93417 WP_003406624.1.93419 WP_003406624.1.93426 WP_003406624.1.9344 WP_003406624.1.93443 WP_003406624.1.93447 WP_003406624.1.93470 WP_003406624.1.93483 WP_003406624.1.93487 WP_003406624.1.93495 WP_003406624.1.93499 WP_003406624.1.93516 WP_003406624.1.93536 WP_003406624.1.93544 WP_003406624.1.93555 WP_003406624.1.93560 WP_003406624.1.93564 WP_003406624.1.9357 WP_003406624.1.93573 WP_003406624.1.93576 WP_003406624.1.93588 WP_003406624.1.9363 WP_003406624.1.93645 WP_003406624.1.93649 WP_003406624.1.93659 WP_003406624.1.93677 WP_003406624.1.9368 WP_003406624.1.93689 WP_003406624.1.93693 WP_003406624.1.93698 WP_003406624.1.93706 WP_003406624.1.9371 WP_003406624.1.93792 WP_003406624.1.93823 WP_003406624.1.93871 WP_003406624.1.9388 WP_003406624.1.93894 WP_003406624.1.93903 WP_003406624.1.93907 WP_003406624.1.93913 WP_003406624.1.93946 WP_003406624.1.93950 WP_003406624.1.93953 WP_003406624.1.93954 WP_003406624.1.93988 WP_003406624.1.9407 WP_003406624.1.94143 WP_003406624.1.94154 WP_003406624.1.94184 WP_003406624.1.94204 WP_003406624.1.94205 WP_003406624.1.94226 WP_003406624.1.94231 WP_003406624.1.94256 WP_003406624.1.94261 WP_003406624.1.94281 WP_003406624.1.94292 WP_003406624.1.94297 WP_003406624.1.9431 WP_003406624.1.94326 WP_003406624.1.94339 WP_003406624.1.94392 WP_003406624.1.94416 WP_003406624.1.94421 WP_003406624.1.94456 WP_003406624.1.94470 WP_003406624.1.94480 WP_003406624.1.94495 WP_003406624.1.94511 WP_003406624.1.94512 WP_003406624.1.94525 WP_003406624.1.94528 WP_003406624.1.94564 WP_003406624.1.946 WP_003406624.1.94602 WP_003406624.1.94623 WP_003406624.1.94629 WP_003406624.1.9465 WP_003406624.1.94673 WP_003406624.1.94714 WP_003406624.1.94730 WP_003406624.1.94736 WP_003406624.1.94776 WP_003406624.1.9478 WP_003406624.1.94834 WP_003406624.1.94852 WP_003406624.1.94872 WP_003406624.1.9488 WP_003406624.1.94902 WP_003406624.1.94916 WP_003406624.1.94979 WP_003406624.1.94994 WP_003406624.1.94996 WP_003406624.1.94998 WP_003406624.1.95007 WP_003406624.1.95010 WP_003406624.1.95015 WP_003406624.1.95034 WP_003406624.1.95068 WP_003406624.1.95081 WP_003406624.1.95082 WP_003406624.1.9509 WP_003406624.1.95096 WP_003406624.1.95112 WP_003406624.1.95138 WP_003406624.1.9514 WP_003406624.1.95179 WP_003406624.1.95188 WP_003406624.1.95190 WP_003406624.1.95234 WP_003406624.1.95241 WP_003406624.1.95245 WP_003406624.1.95257 WP_003406624.1.95279 WP_003406624.1.9531 WP_003406624.1.95335 WP_003406624.1.95344 WP_003406624.1.9535 WP_003406624.1.95370 WP_003406624.1.95392 WP_003406624.1.95416 WP_003406624.1.95417 WP_003406624.1.95454 WP_003406624.1.95455 WP_003406624.1.95491 WP_003406624.1.95497 WP_003406624.1.95508 WP_003406624.1.95509 WP_003406624.1.95529 WP_003406624.1.95556 WP_003406624.1.95557 WP_003406624.1.95565 WP_003406624.1.95578 WP_003406624.1.95580 WP_003406624.1.95585 WP_003406624.1.95643 WP_003406624.1.95679 WP_003406624.1.95685 WP_003406624.1.957 WP_003406624.1.95724 WP_003406624.1.95727 WP_003406624.1.95730 WP_003406624.1.95735 WP_003406624.1.95758 WP_003406624.1.95772 WP_003406624.1.95797 WP_003406624.1.95839 WP_003406624.1.9585 WP_003406624.1.9590 WP_003406624.1.95902 WP_003406624.1.95908 WP_003406624.1.95924 WP_003406624.1.95926 WP_003406624.1.95953 WP_003406624.1.95958 WP_003406624.1.95964 WP_003406624.1.95973 WP_003406624.1.96006 WP_003406624.1.9602 WP_003406624.1.96036 WP_003406624.1.96062 WP_003406624.1.96065 WP_003406624.1.96098 WP_003406624.1.96146 WP_003406624.1.96166 WP_003406624.1.96171 WP_003406624.1.96182 WP_003406624.1.96204 WP_003406624.1.96230 WP_003406624.1.96235 WP_003406624.1.96242 WP_003406624.1.96245 WP_003406624.1.96254 WP_003406624.1.96259 WP_003406624.1.96286 WP_003406624.1.96313 WP_003406624.1.96318 WP_003406624.1.96345 WP_003406624.1.96360 WP_003406624.1.96373 WP_003406624.1.96456 WP_003406624.1.96486 WP_003406624.1.96569 WP_003406624.1.96573 WP_003406624.1.96575 WP_003406624.1.96576 WP_003406624.1.96611 WP_003406624.1.96621 WP_003406624.1.9667 WP_003406624.1.96681 WP_003406624.1.96726 WP_003406624.1.96733 WP_003406624.1.96742 WP_003406624.1.96754 WP_003406624.1.9678 WP_003406624.1.96832 WP_003406624.1.9685 WP_003406624.1.97008 WP_003406624.1.97009 WP_003406624.1.97056 WP_003406624.1.97084 WP_003406624.1.97087 WP_003406624.1.97094 WP_003406624.1.97096 WP_003406624.1.97099 WP_003406624.1.97108 WP_003406624.1.97113 WP_003406624.1.97122 WP_003406624.1.97127 WP_003406624.1.97129 WP_003406624.1.97136 WP_003406624.1.9716 WP_003406624.1.97176 WP_003406624.1.97222 WP_003406624.1.97223 WP_003406624.1.97237 WP_003406624.1.97242 WP_003406624.1.97270 WP_003406624.1.97283 WP_003406624.1.97296 WP_003406624.1.97321 WP_003406624.1.97325 WP_003406624.1.97330 WP_003406624.1.97366 WP_003406624.1.97376 WP_003406624.1.97380 WP_003406624.1.9739 WP_003406624.1.97462 WP_003406624.1.97517 WP_003406624.1.97519 WP_003406624.1.97535 WP_003406624.1.97540 WP_003406624.1.97545 WP_003406624.1.97546 WP_003406624.1.97550 WP_003406624.1.97568 WP_003406624.1.97577 WP_003406624.1.97584 WP_003406624.1.9759 WP_003406624.1.97591 WP_003406624.1.97596 WP_003406624.1.97609 WP_003406624.1.97618 WP_003406624.1.9763 WP_003406624.1.97669 WP_003406624.1.97673 WP_003406624.1.97700 WP_003406624.1.97701 WP_003406624.1.9773 WP_003406624.1.97730 WP_003406624.1.97740 WP_003406624.1.97751 WP_003406624.1.97754 WP_003406624.1.97797 WP_003406624.1.9782 WP_003406624.1.9784 WP_003406624.1.97888 WP_003406624.1.9790 WP_003406624.1.9795 WP_003406624.1.97951 WP_003406624.1.97958 WP_003406624.1.97966 WP_003406624.1.97977 WP_003406624.1.97979 WP_003406624.1.97995 WP_003406624.1.98018 WP_003406624.1.98034 WP_003406624.1.98052 WP_003406624.1.98071 WP_003406624.1.98072 WP_003406624.1.98113 WP_003406624.1.98114 WP_003406624.1.98128 WP_003406624.1.98181 WP_003406624.1.98188 WP_003406624.1.98189 WP_003406624.1.98213 WP_003406624.1.98225 WP_003406624.1.98291 WP_003406624.1.98335 WP_003406624.1.98350 WP_003406624.1.98395 WP_003406624.1.98412 WP_003406624.1.98441 WP_003406624.1.98443 WP_003406624.1.98462 WP_003406624.1.9848 WP_003406624.1.98482 WP_003406624.1.98486 WP_003406624.1.98488 WP_003406624.1.98503 WP_003406624.1.98516 WP_003406624.1.98524 WP_003406624.1.98536 WP_003406624.1.98541 WP_003406624.1.98566 WP_003406624.1.98576 WP_003406624.1.98590 WP_003406624.1.98594 WP_003406624.1.98599 WP_003406624.1.98629 WP_003406624.1.98645 WP_003406624.1.98646 WP_003406624.1.98649 WP_003406624.1.98656 WP_003406624.1.9867 WP_003406624.1.98674 WP_003406624.1.98697 WP_003406624.1.98701 WP_003406624.1.98739 WP_003406624.1.98749 WP_003406624.1.98765 WP_003406624.1.98770 WP_003406624.1.98777 WP_003406624.1.98778 WP_003406624.1.98802 WP_003406624.1.98838 WP_003406624.1.98850 WP_003406624.1.98906 WP_003406624.1.98935 WP_003406624.1.98948 WP_003406624.1.98953 WP_003406624.1.98984 WP_003406624.1.99000 WP_003406624.1.99023 WP_003406624.1.99030 WP_003406624.1.99037 WP_003406624.1.99055 WP_003406624.1.99062 WP_003406624.1.99086 WP_003406624.1.99115 WP_003406624.1.99117 WP_003406624.1.99161 WP_003406624.1.99176 WP_003406624.1.99205 WP_003406624.1.99211 WP_003406624.1.99216 WP_003406624.1.99222 WP_003406624.1.99251 WP_003406624.1.99269 WP_003406624.1.99294 WP_003406624.1.99312 WP_003406624.1.99315 WP_003406624.1.99316 WP_003406624.1.99322 WP_003406624.1.99328 WP_003406624.1.99365 WP_003406624.1.99368 WP_003406624.1.99379 WP_003406624.1.99396 WP_003406624.1.99402 WP_003406624.1.99404 WP_003406624.1.99419 WP_003406624.1.99438 WP_003406624.1.99460 WP_003406624.1.99468 WP_003406624.1.99473 WP_003406624.1.99513 WP_003406624.1.99529 WP_003406624.1.99548 WP_003406624.1.99572 WP_003406624.1.99575 WP_003406624.1.99578 WP_003406624.1.99605 WP_003406624.1.99609 WP_003406624.1.99617 WP_003406624.1.99635 WP_003406624.1.99650 WP_003406624.1.99672 WP_003406624.1.99701 WP_003406624.1.99711 WP_003406624.1.99716 WP_003406624.1.99740 WP_003406624.1.99745 WP_003406624.1.99749 WP_003406624.1.9976 WP_003406624.1.99798 WP_003406624.1.99817 WP_003406624.1.99832 WP_003406624.1.99847 WP_003406624.1.99852 WP_003406624.1.99886 WP_003406624.1.99897 WP_003406624.1.99899 WP_003406624.1.99915 WP_003406624.1.9993 WP_003406624.1.99982 WP_003406624.1.99991 gi|378771049|ref|YP_005170782.1| gi|433630392|ref|YP_007264020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]