SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740486|ref|YP_002161800.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740486|ref|YP_002161800.1|
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.98e-29
Family Penicillinase repressor 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197740486|ref|YP_002161800.1|
Sequence length 138
Comment transcriptional regulator BlaI [Mycobacterium tuberculosis str. Haarlem]
Sequence
MAKLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMTVLQRLAKKNLVLQ
IRDDRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALA
ELEAGHGNRPPAGAATET
Download sequence
Identical sequences A0A045KFY9 A0A0H3LGM0 A0A109SND3 A0A109SX71 A0A197J4A7 A0A1S1BFB8 A5U3L3 F8M9K9 G0TLA9 I6YBR8 M8CMQ0 P9WMJ4 P9WMJ5 R4M6D6 R4M6I4
gi|148661652|ref|YP_001283175.1| gi|392386501|ref|YP_005308130.1| gi|385998622|ref|YP_005916920.1| 336982.TBFG_11874 419947.MRA_1857 478434.TBMG_02148 83331.MT1894 83332.Rv1846c gi|383307669|ref|YP_005360480.1| gi|494692372|ref|YP_007957915.1| gi|392432574|ref|YP_006473618.1| gi|197740486|ref|YP_002161800.1| gi|15608983|ref|NP_216362.1| gi|339631899|ref|YP_004723541.1| gi|494696212|ref|YP_007961715.1| gi|375296360|ref|YP_005100627.1| gi|433626939|ref|YP_007260568.1| gi|479055803|ref|YP_007351609.1| gi|506926324|ref|YP_008006774.1| gi|148823057|ref|YP_001287811.1| IPRv1846cPALZ Rv1846c gi|340626854|ref|YP_004745306.1| gi|253799110|ref|YP_003032111.1| gi|15841314|ref|NP_336351.1| gi|471337792|ref|YP_007610505.1| gi|506926324|ref|YP_008006774.1| gi|15608983|ref|NP_216362.1| NP_216362.1.84033 WP_003409301.1.100021 WP_003409301.1.100069 WP_003409301.1.100087 WP_003409301.1.10015 WP_003409301.1.100208 WP_003409301.1.100216 WP_003409301.1.10022 WP_003409301.1.100255 WP_003409301.1.100260 WP_003409301.1.100270 WP_003409301.1.100279 WP_003409301.1.100286 WP_003409301.1.100308 WP_003409301.1.100309 WP_003409301.1.100318 WP_003409301.1.100338 WP_003409301.1.10037 WP_003409301.1.100383 WP_003409301.1.100395 WP_003409301.1.100396 WP_003409301.1.1004 WP_003409301.1.100401 WP_003409301.1.100459 WP_003409301.1.100460 WP_003409301.1.100552 WP_003409301.1.100581 WP_003409301.1.100600 WP_003409301.1.100625 WP_003409301.1.10064 WP_003409301.1.100666 WP_003409301.1.100677 WP_003409301.1.100697 WP_003409301.1.100703 WP_003409301.1.100716 WP_003409301.1.100722 WP_003409301.1.100754 WP_003409301.1.100757 WP_003409301.1.100772 WP_003409301.1.1008 WP_003409301.1.100812 WP_003409301.1.100845 WP_003409301.1.100866 WP_003409301.1.10088 WP_003409301.1.100889 WP_003409301.1.10090 WP_003409301.1.100910 WP_003409301.1.100915 WP_003409301.1.100918 WP_003409301.1.100935 WP_003409301.1.100984 WP_003409301.1.100992 WP_003409301.1.100998 WP_003409301.1.101 WP_003409301.1.101025 WP_003409301.1.101028 WP_003409301.1.10104 WP_003409301.1.101048 WP_003409301.1.101054 WP_003409301.1.101075 WP_003409301.1.101143 WP_003409301.1.10116 WP_003409301.1.10117 WP_003409301.1.101209 WP_003409301.1.10125 WP_003409301.1.101290 WP_003409301.1.101323 WP_003409301.1.101324 WP_003409301.1.101350 WP_003409301.1.101367 WP_003409301.1.101398 WP_003409301.1.101403 WP_003409301.1.101421 WP_003409301.1.10144 WP_003409301.1.101442 WP_003409301.1.10145 WP_003409301.1.101452 WP_003409301.1.101456 WP_003409301.1.101481 WP_003409301.1.101493 WP_003409301.1.101496 WP_003409301.1.101525 WP_003409301.1.101533 WP_003409301.1.101535 WP_003409301.1.101553 WP_003409301.1.101558 WP_003409301.1.10156 WP_003409301.1.101573 WP_003409301.1.101576 WP_003409301.1.10159 WP_003409301.1.101592 WP_003409301.1.101604 WP_003409301.1.101607 WP_003409301.1.101622 WP_003409301.1.101644 WP_003409301.1.101659 WP_003409301.1.101671 WP_003409301.1.101687 WP_003409301.1.101698 WP_003409301.1.10170 WP_003409301.1.101713 WP_003409301.1.101722 WP_003409301.1.101733 WP_003409301.1.101743 WP_003409301.1.101753 WP_003409301.1.101754 WP_003409301.1.101764 WP_003409301.1.101773 WP_003409301.1.101795 WP_003409301.1.101797 WP_003409301.1.101798 WP_003409301.1.101802 WP_003409301.1.101826 WP_003409301.1.101836 WP_003409301.1.101858 WP_003409301.1.101859 WP_003409301.1.101862 WP_003409301.1.101888 WP_003409301.1.101894 WP_003409301.1.101899 WP_003409301.1.1019 WP_003409301.1.101923 WP_003409301.1.101925 WP_003409301.1.10193 WP_003409301.1.102 WP_003409301.1.102008 WP_003409301.1.102017 WP_003409301.1.102053 WP_003409301.1.102055 WP_003409301.1.102063 WP_003409301.1.102099 WP_003409301.1.1021 WP_003409301.1.10211 WP_003409301.1.102119 WP_003409301.1.102121 WP_003409301.1.10216 WP_003409301.1.10224 WP_003409301.1.10253 WP_003409301.1.10262 WP_003409301.1.10272 WP_003409301.1.10277 WP_003409301.1.1033 WP_003409301.1.10350 WP_003409301.1.10362 WP_003409301.1.10366 WP_003409301.1.10376 WP_003409301.1.10396 WP_003409301.1.10410 WP_003409301.1.10430 WP_003409301.1.1044 WP_003409301.1.10440 WP_003409301.1.10445 WP_003409301.1.10471 WP_003409301.1.10472 WP_003409301.1.10489 WP_003409301.1.105 WP_003409301.1.10518 WP_003409301.1.10523 WP_003409301.1.10545 WP_003409301.1.1057 WP_003409301.1.10594 WP_003409301.1.10603 WP_003409301.1.10606 WP_003409301.1.10615 WP_003409301.1.10623 WP_003409301.1.10635 WP_003409301.1.10643 WP_003409301.1.10648 WP_003409301.1.10662 WP_003409301.1.10709 WP_003409301.1.10735 WP_003409301.1.10740 WP_003409301.1.10756 WP_003409301.1.1078 WP_003409301.1.10791 WP_003409301.1.10799 WP_003409301.1.10825 WP_003409301.1.10848 WP_003409301.1.10863 WP_003409301.1.10879 WP_003409301.1.10912 WP_003409301.1.10916 WP_003409301.1.10923 WP_003409301.1.1095 WP_003409301.1.10956 WP_003409301.1.10958 WP_003409301.1.10962 WP_003409301.1.10980 WP_003409301.1.10981 WP_003409301.1.10993 WP_003409301.1.1100 WP_003409301.1.11040 WP_003409301.1.11061 WP_003409301.1.11070 WP_003409301.1.11171 WP_003409301.1.11175 WP_003409301.1.11176 WP_003409301.1.11222 WP_003409301.1.11236 WP_003409301.1.11329 WP_003409301.1.1133 WP_003409301.1.11342 WP_003409301.1.11373 WP_003409301.1.11376 WP_003409301.1.11390 WP_003409301.1.11402 WP_003409301.1.11481 WP_003409301.1.11487 WP_003409301.1.11489 WP_003409301.1.11514 WP_003409301.1.11589 WP_003409301.1.11596 WP_003409301.1.11604 WP_003409301.1.11610 WP_003409301.1.11697 WP_003409301.1.11707 WP_003409301.1.11752 WP_003409301.1.11758 WP_003409301.1.11761 WP_003409301.1.11775 WP_003409301.1.11804 WP_003409301.1.11822 WP_003409301.1.11826 WP_003409301.1.11856 WP_003409301.1.11898 WP_003409301.1.11906 WP_003409301.1.11939 WP_003409301.1.11960 WP_003409301.1.11961 WP_003409301.1.11972 WP_003409301.1.120 WP_003409301.1.12001 WP_003409301.1.12049 WP_003409301.1.12052 WP_003409301.1.12100 WP_003409301.1.12116 WP_003409301.1.12133 WP_003409301.1.12161 WP_003409301.1.12165 WP_003409301.1.12184 WP_003409301.1.12190 WP_003409301.1.12216 WP_003409301.1.12265 WP_003409301.1.12275 WP_003409301.1.12294 WP_003409301.1.123 WP_003409301.1.1231 WP_003409301.1.12314 WP_003409301.1.12327 WP_003409301.1.12338 WP_003409301.1.1236 WP_003409301.1.12371 WP_003409301.1.12372 WP_003409301.1.12389 WP_003409301.1.12406 WP_003409301.1.1241 WP_003409301.1.12421 WP_003409301.1.12446 WP_003409301.1.12479 WP_003409301.1.12519 WP_003409301.1.12523 WP_003409301.1.12526 WP_003409301.1.1255 WP_003409301.1.12550 WP_003409301.1.12551 WP_003409301.1.12563 WP_003409301.1.12611 WP_003409301.1.12669 WP_003409301.1.1267 WP_003409301.1.12672 WP_003409301.1.12692 WP_003409301.1.1271 WP_003409301.1.12768 WP_003409301.1.1279 WP_003409301.1.12794 WP_003409301.1.12804 WP_003409301.1.12821 WP_003409301.1.12841 WP_003409301.1.12854 WP_003409301.1.12871 WP_003409301.1.12901 WP_003409301.1.12941 WP_003409301.1.12947 WP_003409301.1.12957 WP_003409301.1.12972 WP_003409301.1.13028 WP_003409301.1.13043 WP_003409301.1.13090 WP_003409301.1.13096 WP_003409301.1.13163 WP_003409301.1.13175 WP_003409301.1.13183 WP_003409301.1.132 WP_003409301.1.13249 WP_003409301.1.13282 WP_003409301.1.13284 WP_003409301.1.13296 WP_003409301.1.13298 WP_003409301.1.13306 WP_003409301.1.13312 WP_003409301.1.13313 WP_003409301.1.13321 WP_003409301.1.13345 WP_003409301.1.13358 WP_003409301.1.13370 WP_003409301.1.13375 WP_003409301.1.1338 WP_003409301.1.13420 WP_003409301.1.13433 WP_003409301.1.13435 WP_003409301.1.13438 WP_003409301.1.13461 WP_003409301.1.13466 WP_003409301.1.13489 WP_003409301.1.13551 WP_003409301.1.13561 WP_003409301.1.13564 WP_003409301.1.13579 WP_003409301.1.13647 WP_003409301.1.13687 WP_003409301.1.13697 WP_003409301.1.13719 WP_003409301.1.13763 WP_003409301.1.1377 WP_003409301.1.13774 WP_003409301.1.13786 WP_003409301.1.13793 WP_003409301.1.13794 WP_003409301.1.13817 WP_003409301.1.13834 WP_003409301.1.13866 WP_003409301.1.13880 WP_003409301.1.13899 WP_003409301.1.13909 WP_003409301.1.13910 WP_003409301.1.13919 WP_003409301.1.13920 WP_003409301.1.13952 WP_003409301.1.13953 WP_003409301.1.13962 WP_003409301.1.1398 WP_003409301.1.13988 WP_003409301.1.14027 WP_003409301.1.14046 WP_003409301.1.14115 WP_003409301.1.1415 WP_003409301.1.14158 WP_003409301.1.14162 WP_003409301.1.14175 WP_003409301.1.14178 WP_003409301.1.14194 WP_003409301.1.14195 WP_003409301.1.14208 WP_003409301.1.14238 WP_003409301.1.14266 WP_003409301.1.14273 WP_003409301.1.14303 WP_003409301.1.14306 WP_003409301.1.14307 WP_003409301.1.14310 WP_003409301.1.14382 WP_003409301.1.14416 WP_003409301.1.14428 WP_003409301.1.14441 WP_003409301.1.14469 WP_003409301.1.14477 WP_003409301.1.14504 WP_003409301.1.14514 WP_003409301.1.1452 WP_003409301.1.14527 WP_003409301.1.1454 WP_003409301.1.14544 WP_003409301.1.14548 WP_003409301.1.14551 WP_003409301.1.14561 WP_003409301.1.14573 WP_003409301.1.1462 WP_003409301.1.14667 WP_003409301.1.14668 WP_003409301.1.14675 WP_003409301.1.14694 WP_003409301.1.14695 WP_003409301.1.14709 WP_003409301.1.14766 WP_003409301.1.14783 WP_003409301.1.14865 WP_003409301.1.14905 WP_003409301.1.14926 WP_003409301.1.14951 WP_003409301.1.14955 WP_003409301.1.15003 WP_003409301.1.15009 WP_003409301.1.15028 WP_003409301.1.15040 WP_003409301.1.15052 WP_003409301.1.15065 WP_003409301.1.15072 WP_003409301.1.15089 WP_003409301.1.1509 WP_003409301.1.15126 WP_003409301.1.15131 WP_003409301.1.15168 WP_003409301.1.15172 WP_003409301.1.15174 WP_003409301.1.15187 WP_003409301.1.15196 WP_003409301.1.15210 WP_003409301.1.15216 WP_003409301.1.15217 WP_003409301.1.1523 WP_003409301.1.15232 WP_003409301.1.15238 WP_003409301.1.15240 WP_003409301.1.15253 WP_003409301.1.1527 WP_003409301.1.15292 WP_003409301.1.15299 WP_003409301.1.15302 WP_003409301.1.15322 WP_003409301.1.1534 WP_003409301.1.15365 WP_003409301.1.15386 WP_003409301.1.15387 WP_003409301.1.15442 WP_003409301.1.15447 WP_003409301.1.15449 WP_003409301.1.15477 WP_003409301.1.15481 WP_003409301.1.15492 WP_003409301.1.15511 WP_003409301.1.15512 WP_003409301.1.15558 WP_003409301.1.15559 WP_003409301.1.15566 WP_003409301.1.15599 WP_003409301.1.1560 WP_003409301.1.15611 WP_003409301.1.1563 WP_003409301.1.15633 WP_003409301.1.15643 WP_003409301.1.15688 WP_003409301.1.15755 WP_003409301.1.15763 WP_003409301.1.15774 WP_003409301.1.1578 WP_003409301.1.15827 WP_003409301.1.15834 WP_003409301.1.15842 WP_003409301.1.15853 WP_003409301.1.15870 WP_003409301.1.15877 WP_003409301.1.15893 WP_003409301.1.15926 WP_003409301.1.15933 WP_003409301.1.15946 WP_003409301.1.15958 WP_003409301.1.15973 WP_003409301.1.15987 WP_003409301.1.15993 WP_003409301.1.16009 WP_003409301.1.16025 WP_003409301.1.16043 WP_003409301.1.16066 WP_003409301.1.16069 WP_003409301.1.16077 WP_003409301.1.16106 WP_003409301.1.16108 WP_003409301.1.16130 WP_003409301.1.16136 WP_003409301.1.16139 WP_003409301.1.16141 WP_003409301.1.16143 WP_003409301.1.1630 WP_003409301.1.16318 WP_003409301.1.1632 WP_003409301.1.16327 WP_003409301.1.16334 WP_003409301.1.16341 WP_003409301.1.16345 WP_003409301.1.16374 WP_003409301.1.16384 WP_003409301.1.16386 WP_003409301.1.164 WP_003409301.1.1642 WP_003409301.1.16421 WP_003409301.1.16424 WP_003409301.1.16431 WP_003409301.1.16438 WP_003409301.1.1644 WP_003409301.1.16442 WP_003409301.1.16448 WP_003409301.1.16451 WP_003409301.1.16476 WP_003409301.1.16480 WP_003409301.1.16494 WP_003409301.1.1652 WP_003409301.1.16549 WP_003409301.1.16560 WP_003409301.1.16598 WP_003409301.1.16609 WP_003409301.1.16619 WP_003409301.1.16620 WP_003409301.1.16622 WP_003409301.1.16637 WP_003409301.1.1669 WP_003409301.1.16707 WP_003409301.1.16724 WP_003409301.1.16731 WP_003409301.1.16743 WP_003409301.1.1683 WP_003409301.1.16837 WP_003409301.1.16852 WP_003409301.1.16937 WP_003409301.1.16940 WP_003409301.1.16950 WP_003409301.1.16959 WP_003409301.1.16968 WP_003409301.1.1697 WP_003409301.1.16977 WP_003409301.1.16987 WP_003409301.1.17005 WP_003409301.1.17006 WP_003409301.1.17010 WP_003409301.1.17015 WP_003409301.1.17019 WP_003409301.1.17041 WP_003409301.1.17052 WP_003409301.1.17057 WP_003409301.1.17062 WP_003409301.1.1707 WP_003409301.1.17094 WP_003409301.1.17130 WP_003409301.1.17138 WP_003409301.1.17147 WP_003409301.1.17224 WP_003409301.1.17251 WP_003409301.1.17288 WP_003409301.1.17304 WP_003409301.1.17345 WP_003409301.1.17381 WP_003409301.1.17391 WP_003409301.1.17412 WP_003409301.1.1743 WP_003409301.1.17440 WP_003409301.1.17466 WP_003409301.1.17477 WP_003409301.1.17483 WP_003409301.1.17505 WP_003409301.1.17527 WP_003409301.1.17535 WP_003409301.1.17540 WP_003409301.1.17553 WP_003409301.1.17558 WP_003409301.1.17599 WP_003409301.1.17635 WP_003409301.1.17655 WP_003409301.1.17679 WP_003409301.1.17687 WP_003409301.1.17700 WP_003409301.1.17710 WP_003409301.1.17713 WP_003409301.1.17722 WP_003409301.1.17746 WP_003409301.1.17788 WP_003409301.1.17798 WP_003409301.1.17803 WP_003409301.1.17816 WP_003409301.1.17821 WP_003409301.1.17830 WP_003409301.1.17868 WP_003409301.1.17878 WP_003409301.1.17923 WP_003409301.1.1795 WP_003409301.1.17973 WP_003409301.1.18009 WP_003409301.1.18033 WP_003409301.1.18065 WP_003409301.1.18070 WP_003409301.1.18116 WP_003409301.1.18120 WP_003409301.1.1817 WP_003409301.1.18170 WP_003409301.1.18206 WP_003409301.1.18216 WP_003409301.1.18240 WP_003409301.1.18257 WP_003409301.1.18297 WP_003409301.1.18306 WP_003409301.1.18364 WP_003409301.1.18399 WP_003409301.1.18411 WP_003409301.1.18444 WP_003409301.1.18448 WP_003409301.1.18467 WP_003409301.1.18476 WP_003409301.1.18522 WP_003409301.1.18580 WP_003409301.1.18582 WP_003409301.1.18587 WP_003409301.1.186 WP_003409301.1.18601 WP_003409301.1.18639 WP_003409301.1.18646 WP_003409301.1.18647 WP_003409301.1.1868 WP_003409301.1.18694 WP_003409301.1.18710 WP_003409301.1.18751 WP_003409301.1.18781 WP_003409301.1.18793 WP_003409301.1.18804 WP_003409301.1.18816 WP_003409301.1.18823 WP_003409301.1.18827 WP_003409301.1.18838 WP_003409301.1.18849 WP_003409301.1.18856 WP_003409301.1.18945 WP_003409301.1.1898 WP_003409301.1.19005 WP_003409301.1.19056 WP_003409301.1.19066 WP_003409301.1.19071 WP_003409301.1.19094 WP_003409301.1.19144 WP_003409301.1.19159 WP_003409301.1.19193 WP_003409301.1.19231 WP_003409301.1.19243 WP_003409301.1.19264 WP_003409301.1.19295 WP_003409301.1.19307 WP_003409301.1.19326 WP_003409301.1.19364 WP_003409301.1.19382 WP_003409301.1.19400 WP_003409301.1.19426 WP_003409301.1.19429 WP_003409301.1.19464 WP_003409301.1.19480 WP_003409301.1.19553 WP_003409301.1.19562 WP_003409301.1.19564 WP_003409301.1.19568 WP_003409301.1.19572 WP_003409301.1.19595 WP_003409301.1.19596 WP_003409301.1.19600 WP_003409301.1.19630 WP_003409301.1.1967 WP_003409301.1.19694 WP_003409301.1.1970 WP_003409301.1.19707 WP_003409301.1.19742 WP_003409301.1.19785 WP_003409301.1.19820 WP_003409301.1.19868 WP_003409301.1.19874 WP_003409301.1.19890 WP_003409301.1.19900 WP_003409301.1.19922 WP_003409301.1.19936 WP_003409301.1.19946 WP_003409301.1.19949 WP_003409301.1.19960 WP_003409301.1.19964 WP_003409301.1.20007 WP_003409301.1.20016 WP_003409301.1.20037 WP_003409301.1.20039 WP_003409301.1.20082 WP_003409301.1.20085 WP_003409301.1.20097 WP_003409301.1.20116 WP_003409301.1.20130 WP_003409301.1.20140 WP_003409301.1.20141 WP_003409301.1.20142 WP_003409301.1.20158 WP_003409301.1.20239 WP_003409301.1.20243 WP_003409301.1.20259 WP_003409301.1.20262 WP_003409301.1.20272 WP_003409301.1.20280 WP_003409301.1.20294 WP_003409301.1.20300 WP_003409301.1.20309 WP_003409301.1.20322 WP_003409301.1.20372 WP_003409301.1.20381 WP_003409301.1.204 WP_003409301.1.20427 WP_003409301.1.20457 WP_003409301.1.20459 WP_003409301.1.20460 WP_003409301.1.20542 WP_003409301.1.20578 WP_003409301.1.20608 WP_003409301.1.20624 WP_003409301.1.20628 WP_003409301.1.2066 WP_003409301.1.20707 WP_003409301.1.20722 WP_003409301.1.20729 WP_003409301.1.20742 WP_003409301.1.20751 WP_003409301.1.20776 WP_003409301.1.20843 WP_003409301.1.20850 WP_003409301.1.2086 WP_003409301.1.20868 WP_003409301.1.20876 WP_003409301.1.20897 WP_003409301.1.20898 WP_003409301.1.2090 WP_003409301.1.20911 WP_003409301.1.20921 WP_003409301.1.20926 WP_003409301.1.20927 WP_003409301.1.20951 WP_003409301.1.20970 WP_003409301.1.2104 WP_003409301.1.21070 WP_003409301.1.21127 WP_003409301.1.21135 WP_003409301.1.21173 WP_003409301.1.21187 WP_003409301.1.212 WP_003409301.1.2120 WP_003409301.1.21218 WP_003409301.1.21219 WP_003409301.1.2123 WP_003409301.1.21231 WP_003409301.1.21234 WP_003409301.1.2126 WP_003409301.1.21292 WP_003409301.1.21307 WP_003409301.1.2131 WP_003409301.1.21311 WP_003409301.1.21321 WP_003409301.1.21365 WP_003409301.1.21392 WP_003409301.1.21403 WP_003409301.1.21415 WP_003409301.1.21430 WP_003409301.1.21434 WP_003409301.1.21444 WP_003409301.1.21468 WP_003409301.1.21498 WP_003409301.1.21509 WP_003409301.1.21513 WP_003409301.1.21560 WP_003409301.1.21565 WP_003409301.1.21586 WP_003409301.1.21591 WP_003409301.1.21594 WP_003409301.1.21602 WP_003409301.1.21615 WP_003409301.1.21638 WP_003409301.1.21639 WP_003409301.1.21655 WP_003409301.1.21658 WP_003409301.1.2168 WP_003409301.1.2174 WP_003409301.1.21741 WP_003409301.1.21777 WP_003409301.1.21786 WP_003409301.1.21795 WP_003409301.1.218 WP_003409301.1.21826 WP_003409301.1.21829 WP_003409301.1.21840 WP_003409301.1.21843 WP_003409301.1.21872 WP_003409301.1.21873 WP_003409301.1.2188 WP_003409301.1.21882 WP_003409301.1.21906 WP_003409301.1.21912 WP_003409301.1.2194 WP_003409301.1.21941 WP_003409301.1.21956 WP_003409301.1.21958 WP_003409301.1.21960 WP_003409301.1.21971 WP_003409301.1.21973 WP_003409301.1.21983 WP_003409301.1.22003 WP_003409301.1.22013 WP_003409301.1.22036 WP_003409301.1.22075 WP_003409301.1.22092 WP_003409301.1.2212 WP_003409301.1.22127 WP_003409301.1.22140 WP_003409301.1.22233 WP_003409301.1.22255 WP_003409301.1.22277 WP_003409301.1.22348 WP_003409301.1.22366 WP_003409301.1.2238 WP_003409301.1.22380 WP_003409301.1.22437 WP_003409301.1.22438 WP_003409301.1.22511 WP_003409301.1.22524 WP_003409301.1.2253 WP_003409301.1.22585 WP_003409301.1.22606 WP_003409301.1.22608 WP_003409301.1.22609 WP_003409301.1.22618 WP_003409301.1.2262 WP_003409301.1.22624 WP_003409301.1.22629 WP_003409301.1.22647 WP_003409301.1.22664 WP_003409301.1.22665 WP_003409301.1.22670 WP_003409301.1.22725 WP_003409301.1.22728 WP_003409301.1.22733 WP_003409301.1.22737 WP_003409301.1.2275 WP_003409301.1.22754 WP_003409301.1.22797 WP_003409301.1.22800 WP_003409301.1.22804 WP_003409301.1.22829 WP_003409301.1.22840 WP_003409301.1.22844 WP_003409301.1.22970 WP_003409301.1.22996 WP_003409301.1.22997 WP_003409301.1.22999 WP_003409301.1.23015 WP_003409301.1.23032 WP_003409301.1.231 WP_003409301.1.23101 WP_003409301.1.2312 WP_003409301.1.23153 WP_003409301.1.23171 WP_003409301.1.23199 WP_003409301.1.2320 WP_003409301.1.23204 WP_003409301.1.23216 WP_003409301.1.23229 WP_003409301.1.23233 WP_003409301.1.2326 WP_003409301.1.23261 WP_003409301.1.23272 WP_003409301.1.23289 WP_003409301.1.2329 WP_003409301.1.23308 WP_003409301.1.23316 WP_003409301.1.23321 WP_003409301.1.23325 WP_003409301.1.2339 WP_003409301.1.23406 WP_003409301.1.23438 WP_003409301.1.23445 WP_003409301.1.23447 WP_003409301.1.23452 WP_003409301.1.23461 WP_003409301.1.2349 WP_003409301.1.23496 WP_003409301.1.23506 WP_003409301.1.23530 WP_003409301.1.23539 WP_003409301.1.23546 WP_003409301.1.23551 WP_003409301.1.23573 WP_003409301.1.23583 WP_003409301.1.23588 WP_003409301.1.23628 WP_003409301.1.23677 WP_003409301.1.23683 WP_003409301.1.23692 WP_003409301.1.23694 WP_003409301.1.23699 WP_003409301.1.2371 WP_003409301.1.23803 WP_003409301.1.23807 WP_003409301.1.23825 WP_003409301.1.23832 WP_003409301.1.2384 WP_003409301.1.23843 WP_003409301.1.23863 WP_003409301.1.2387 WP_003409301.1.23894 WP_003409301.1.23993 WP_003409301.1.2400 WP_003409301.1.24008 WP_003409301.1.24046 WP_003409301.1.24057 WP_003409301.1.24113 WP_003409301.1.24119 WP_003409301.1.24140 WP_003409301.1.24176 WP_003409301.1.24190 WP_003409301.1.24202 WP_003409301.1.24244 WP_003409301.1.24261 WP_003409301.1.24284 WP_003409301.1.24294 WP_003409301.1.24357 WP_003409301.1.24396 WP_003409301.1.24423 WP_003409301.1.2443 WP_003409301.1.24446 WP_003409301.1.24461 WP_003409301.1.24500 WP_003409301.1.24507 WP_003409301.1.24509 WP_003409301.1.24529 WP_003409301.1.24553 WP_003409301.1.24599 WP_003409301.1.24648 WP_003409301.1.2466 WP_003409301.1.24767 WP_003409301.1.24824 WP_003409301.1.24831 WP_003409301.1.24840 WP_003409301.1.24848 WP_003409301.1.24857 WP_003409301.1.2487 WP_003409301.1.24893 WP_003409301.1.24933 WP_003409301.1.24956 WP_003409301.1.24958 WP_003409301.1.24985 WP_003409301.1.2499 WP_003409301.1.25004 WP_003409301.1.2505 WP_003409301.1.25051 WP_003409301.1.2507 WP_003409301.1.25096 WP_003409301.1.25103 WP_003409301.1.25129 WP_003409301.1.25171 WP_003409301.1.25247 WP_003409301.1.25278 WP_003409301.1.25309 WP_003409301.1.25313 WP_003409301.1.25338 WP_003409301.1.25342 WP_003409301.1.25343 WP_003409301.1.25367 WP_003409301.1.25393 WP_003409301.1.25406 WP_003409301.1.25435 WP_003409301.1.25437 WP_003409301.1.25445 WP_003409301.1.25455 WP_003409301.1.25473 WP_003409301.1.25504 WP_003409301.1.25513 WP_003409301.1.25542 WP_003409301.1.25579 WP_003409301.1.25594 WP_003409301.1.25606 WP_003409301.1.25645 WP_003409301.1.2566 WP_003409301.1.25673 WP_003409301.1.25674 WP_003409301.1.25693 WP_003409301.1.25699 WP_003409301.1.25727 WP_003409301.1.25736 WP_003409301.1.25738 WP_003409301.1.25759 WP_003409301.1.2580 WP_003409301.1.25813 WP_003409301.1.25854 WP_003409301.1.25874 WP_003409301.1.25885 WP_003409301.1.25892 WP_003409301.1.25906 WP_003409301.1.25914 WP_003409301.1.25916 WP_003409301.1.2594 WP_003409301.1.25954 WP_003409301.1.25972 WP_003409301.1.26017 WP_003409301.1.26032 WP_003409301.1.26038 WP_003409301.1.26072 WP_003409301.1.26089 WP_003409301.1.26097 WP_003409301.1.26098 WP_003409301.1.26108 WP_003409301.1.26109 WP_003409301.1.26118 WP_003409301.1.26126 WP_003409301.1.2614 WP_003409301.1.26168 WP_003409301.1.26182 WP_003409301.1.26190 WP_003409301.1.2620 WP_003409301.1.26243 WP_003409301.1.26267 WP_003409301.1.26292 WP_003409301.1.26310 WP_003409301.1.26328 WP_003409301.1.26349 WP_003409301.1.26366 WP_003409301.1.26374 WP_003409301.1.26407 WP_003409301.1.26454 WP_003409301.1.26464 WP_003409301.1.2653 WP_003409301.1.26560 WP_003409301.1.26571 WP_003409301.1.2659 WP_003409301.1.26597 WP_003409301.1.26603 WP_003409301.1.26629 WP_003409301.1.26651 WP_003409301.1.26702 WP_003409301.1.26707 WP_003409301.1.26710 WP_003409301.1.26719 WP_003409301.1.26737 WP_003409301.1.26738 WP_003409301.1.26745 WP_003409301.1.26756 WP_003409301.1.2676 WP_003409301.1.2677 WP_003409301.1.26779 WP_003409301.1.26780 WP_003409301.1.26868 WP_003409301.1.26888 WP_003409301.1.26914 WP_003409301.1.26945 WP_003409301.1.26959 WP_003409301.1.26969 WP_003409301.1.26984 WP_003409301.1.26992 WP_003409301.1.27017 WP_003409301.1.27045 WP_003409301.1.27074 WP_003409301.1.27128 WP_003409301.1.27139 WP_003409301.1.27152 WP_003409301.1.27162 WP_003409301.1.27164 WP_003409301.1.27193 WP_003409301.1.27235 WP_003409301.1.27278 WP_003409301.1.27343 WP_003409301.1.27352 WP_003409301.1.27369 WP_003409301.1.27391 WP_003409301.1.27398 WP_003409301.1.27402 WP_003409301.1.27410 WP_003409301.1.27411 WP_003409301.1.27449 WP_003409301.1.27460 WP_003409301.1.27463 WP_003409301.1.2749 WP_003409301.1.27492 WP_003409301.1.27528 WP_003409301.1.27541 WP_003409301.1.27576 WP_003409301.1.27582 WP_003409301.1.27596 WP_003409301.1.27607 WP_003409301.1.2766 WP_003409301.1.277 WP_003409301.1.27724 WP_003409301.1.27730 WP_003409301.1.27736 WP_003409301.1.27743 WP_003409301.1.27750 WP_003409301.1.27771 WP_003409301.1.27779 WP_003409301.1.27795 WP_003409301.1.27819 WP_003409301.1.27835 WP_003409301.1.27915 WP_003409301.1.27935 WP_003409301.1.27962 WP_003409301.1.28053 WP_003409301.1.28092 WP_003409301.1.28106 WP_003409301.1.28131 WP_003409301.1.28142 WP_003409301.1.28159 WP_003409301.1.2816 WP_003409301.1.28161 WP_003409301.1.28192 WP_003409301.1.28202 WP_003409301.1.28241 WP_003409301.1.28242 WP_003409301.1.28251 WP_003409301.1.28255 WP_003409301.1.28269 WP_003409301.1.28276 WP_003409301.1.28293 WP_003409301.1.28331 WP_003409301.1.28367 WP_003409301.1.28378 WP_003409301.1.28391 WP_003409301.1.2842 WP_003409301.1.28448 WP_003409301.1.2847 WP_003409301.1.28471 WP_003409301.1.28473 WP_003409301.1.28493 WP_003409301.1.28497 WP_003409301.1.28530 WP_003409301.1.28545 WP_003409301.1.28561 WP_003409301.1.28567 WP_003409301.1.28585 WP_003409301.1.286 WP_003409301.1.28610 WP_003409301.1.28617 WP_003409301.1.28634 WP_003409301.1.28642 WP_003409301.1.28671 WP_003409301.1.28698 WP_003409301.1.28703 WP_003409301.1.28739 WP_003409301.1.28781 WP_003409301.1.28787 WP_003409301.1.28827 WP_003409301.1.28839 WP_003409301.1.28847 WP_003409301.1.28850 WP_003409301.1.28851 WP_003409301.1.28865 WP_003409301.1.28897 WP_003409301.1.28914 WP_003409301.1.28935 WP_003409301.1.28936 WP_003409301.1.28939 WP_003409301.1.28943 WP_003409301.1.28952 WP_003409301.1.28975 WP_003409301.1.2899 WP_003409301.1.28993 WP_003409301.1.29000 WP_003409301.1.2901 WP_003409301.1.29028 WP_003409301.1.29033 WP_003409301.1.29058 WP_003409301.1.29115 WP_003409301.1.2916 WP_003409301.1.29217 WP_003409301.1.29234 WP_003409301.1.29264 WP_003409301.1.29275 WP_003409301.1.29306 WP_003409301.1.29339 WP_003409301.1.29348 WP_003409301.1.29364 WP_003409301.1.29367 WP_003409301.1.2938 WP_003409301.1.2944 WP_003409301.1.29449 WP_003409301.1.29450 WP_003409301.1.29510 WP_003409301.1.29515 WP_003409301.1.29525 WP_003409301.1.2953 WP_003409301.1.29587 WP_003409301.1.2959 WP_003409301.1.29592 WP_003409301.1.29599 WP_003409301.1.29611 WP_003409301.1.29632 WP_003409301.1.29649 WP_003409301.1.2965 WP_003409301.1.29659 WP_003409301.1.2969 WP_003409301.1.29696 WP_003409301.1.29698 WP_003409301.1.29718 WP_003409301.1.29745 WP_003409301.1.29747 WP_003409301.1.29825 WP_003409301.1.29847 WP_003409301.1.29861 WP_003409301.1.29869 WP_003409301.1.29883 WP_003409301.1.29890 WP_003409301.1.299 WP_003409301.1.29931 WP_003409301.1.29960 WP_003409301.1.30014 WP_003409301.1.3004 WP_003409301.1.30040 WP_003409301.1.30043 WP_003409301.1.30074 WP_003409301.1.30097 WP_003409301.1.30106 WP_003409301.1.30114 WP_003409301.1.30126 WP_003409301.1.30131 WP_003409301.1.30138 WP_003409301.1.30139 WP_003409301.1.30145 WP_003409301.1.30211 WP_003409301.1.30235 WP_003409301.1.30237 WP_003409301.1.3027 WP_003409301.1.30279 WP_003409301.1.30282 WP_003409301.1.30283 WP_003409301.1.30288 WP_003409301.1.30291 WP_003409301.1.30363 WP_003409301.1.30374 WP_003409301.1.30404 WP_003409301.1.30433 WP_003409301.1.30438 WP_003409301.1.30462 WP_003409301.1.30464 WP_003409301.1.30468 WP_003409301.1.30500 WP_003409301.1.3057 WP_003409301.1.30574 WP_003409301.1.30628 WP_003409301.1.30641 WP_003409301.1.30642 WP_003409301.1.30661 WP_003409301.1.30683 WP_003409301.1.30699 WP_003409301.1.30709 WP_003409301.1.30713 WP_003409301.1.30716 WP_003409301.1.30719 WP_003409301.1.30730 WP_003409301.1.30736 WP_003409301.1.30760 WP_003409301.1.30791 WP_003409301.1.308 WP_003409301.1.30807 WP_003409301.1.30818 WP_003409301.1.30824 WP_003409301.1.30848 WP_003409301.1.30877 WP_003409301.1.30888 WP_003409301.1.30901 WP_003409301.1.30903 WP_003409301.1.30912 WP_003409301.1.30913 WP_003409301.1.30914 WP_003409301.1.30919 WP_003409301.1.30977 WP_003409301.1.3100 WP_003409301.1.31002 WP_003409301.1.3101 WP_003409301.1.31034 WP_003409301.1.31047 WP_003409301.1.31070 WP_003409301.1.31074 WP_003409301.1.31102 WP_003409301.1.31127 WP_003409301.1.31184 WP_003409301.1.31199 WP_003409301.1.31226 WP_003409301.1.31230 WP_003409301.1.31233 WP_003409301.1.31263 WP_003409301.1.31264 WP_003409301.1.31270 WP_003409301.1.31287 WP_003409301.1.31290 WP_003409301.1.31304 WP_003409301.1.31346 WP_003409301.1.31348 WP_003409301.1.31354 WP_003409301.1.31390 WP_003409301.1.31414 WP_003409301.1.31417 WP_003409301.1.31428 WP_003409301.1.3143 WP_003409301.1.31458 WP_003409301.1.31483 WP_003409301.1.3149 WP_003409301.1.31498 WP_003409301.1.31507 WP_003409301.1.31537 WP_003409301.1.31548 WP_003409301.1.31569 WP_003409301.1.31573 WP_003409301.1.316 WP_003409301.1.31629 WP_003409301.1.31666 WP_003409301.1.31693 WP_003409301.1.31703 WP_003409301.1.31744 WP_003409301.1.31745 WP_003409301.1.31770 WP_003409301.1.31776 WP_003409301.1.3184 WP_003409301.1.31840 WP_003409301.1.31880 WP_003409301.1.31911 WP_003409301.1.31930 WP_003409301.1.31932 WP_003409301.1.31955 WP_003409301.1.31985 WP_003409301.1.31991 WP_003409301.1.31995 WP_003409301.1.32004 WP_003409301.1.32039 WP_003409301.1.3204 WP_003409301.1.32045 WP_003409301.1.32071 WP_003409301.1.32098 WP_003409301.1.32132 WP_003409301.1.32157 WP_003409301.1.32164 WP_003409301.1.32179 WP_003409301.1.32198 WP_003409301.1.32297 WP_003409301.1.32317 WP_003409301.1.32383 WP_003409301.1.32400 WP_003409301.1.32403 WP_003409301.1.32416 WP_003409301.1.32421 WP_003409301.1.32433 WP_003409301.1.32461 WP_003409301.1.32482 WP_003409301.1.32556 WP_003409301.1.32562 WP_003409301.1.32569 WP_003409301.1.32592 WP_003409301.1.32620 WP_003409301.1.32647 WP_003409301.1.32653 WP_003409301.1.32654 WP_003409301.1.3268 WP_003409301.1.32695 WP_003409301.1.32706 WP_003409301.1.32716 WP_003409301.1.32738 WP_003409301.1.32752 WP_003409301.1.32780 WP_003409301.1.32793 WP_003409301.1.32799 WP_003409301.1.32833 WP_003409301.1.32862 WP_003409301.1.32880 WP_003409301.1.32897 WP_003409301.1.32909 WP_003409301.1.32935 WP_003409301.1.32974 WP_003409301.1.33007 WP_003409301.1.3302 WP_003409301.1.33028 WP_003409301.1.33044 WP_003409301.1.33054 WP_003409301.1.33082 WP_003409301.1.33141 WP_003409301.1.33148 WP_003409301.1.33155 WP_003409301.1.3321 WP_003409301.1.33215 WP_003409301.1.3325 WP_003409301.1.3327 WP_003409301.1.33278 WP_003409301.1.33288 WP_003409301.1.33305 WP_003409301.1.3331 WP_003409301.1.33319 WP_003409301.1.3333 WP_003409301.1.33393 WP_003409301.1.33403 WP_003409301.1.33452 WP_003409301.1.33467 WP_003409301.1.33477 WP_003409301.1.3349 WP_003409301.1.33519 WP_003409301.1.33542 WP_003409301.1.33601 WP_003409301.1.33602 WP_003409301.1.33633 WP_003409301.1.33646 WP_003409301.1.33673 WP_003409301.1.3369 WP_003409301.1.33705 WP_003409301.1.33762 WP_003409301.1.33783 WP_003409301.1.33789 WP_003409301.1.3383 WP_003409301.1.33832 WP_003409301.1.33839 WP_003409301.1.33848 WP_003409301.1.3387 WP_003409301.1.33886 WP_003409301.1.33895 WP_003409301.1.33912 WP_003409301.1.33954 WP_003409301.1.34042 WP_003409301.1.3405 WP_003409301.1.34055 WP_003409301.1.34056 WP_003409301.1.34065 WP_003409301.1.3408 WP_003409301.1.34090 WP_003409301.1.34109 WP_003409301.1.34152 WP_003409301.1.34163 WP_003409301.1.34181 WP_003409301.1.34197 WP_003409301.1.34198 WP_003409301.1.34215 WP_003409301.1.34219 WP_003409301.1.34255 WP_003409301.1.34260 WP_003409301.1.34275 WP_003409301.1.343 WP_003409301.1.34347 WP_003409301.1.34392 WP_003409301.1.344 WP_003409301.1.34428 WP_003409301.1.3443 WP_003409301.1.34435 WP_003409301.1.34446 WP_003409301.1.34499 WP_003409301.1.34505 WP_003409301.1.34516 WP_003409301.1.34529 WP_003409301.1.34551 WP_003409301.1.34563 WP_003409301.1.34576 WP_003409301.1.34581 WP_003409301.1.34588 WP_003409301.1.34596 WP_003409301.1.34599 WP_003409301.1.34639 WP_003409301.1.34673 WP_003409301.1.34724 WP_003409301.1.34740 WP_003409301.1.34755 WP_003409301.1.34777 WP_003409301.1.34783 WP_003409301.1.34841 WP_003409301.1.34908 WP_003409301.1.34919 WP_003409301.1.3492 WP_003409301.1.34933 WP_003409301.1.34945 WP_003409301.1.34946 WP_003409301.1.34954 WP_003409301.1.34960 WP_003409301.1.34961 WP_003409301.1.34963 WP_003409301.1.34965 WP_003409301.1.34968 WP_003409301.1.35069 WP_003409301.1.35072 WP_003409301.1.35078 WP_003409301.1.35100 WP_003409301.1.35156 WP_003409301.1.35160 WP_003409301.1.35162 WP_003409301.1.35176 WP_003409301.1.3520 WP_003409301.1.35213 WP_003409301.1.35221 WP_003409301.1.35246 WP_003409301.1.35278 WP_003409301.1.35301 WP_003409301.1.35311 WP_003409301.1.35312 WP_003409301.1.35317 WP_003409301.1.35319 WP_003409301.1.35347 WP_003409301.1.35363 WP_003409301.1.35382 WP_003409301.1.35385 WP_003409301.1.35396 WP_003409301.1.35397 WP_003409301.1.35426 WP_003409301.1.35439 WP_003409301.1.35455 WP_003409301.1.3548 WP_003409301.1.35484 WP_003409301.1.35492 WP_003409301.1.3553 WP_003409301.1.35553 WP_003409301.1.35555 WP_003409301.1.35561 WP_003409301.1.35602 WP_003409301.1.35610 WP_003409301.1.35635 WP_003409301.1.35657 WP_003409301.1.35687 WP_003409301.1.35689 WP_003409301.1.35707 WP_003409301.1.35732 WP_003409301.1.35754 WP_003409301.1.35767 WP_003409301.1.35770 WP_003409301.1.35771 WP_003409301.1.35780 WP_003409301.1.35805 WP_003409301.1.35821 WP_003409301.1.35848 WP_003409301.1.35864 WP_003409301.1.35874 WP_003409301.1.35876 WP_003409301.1.35899 WP_003409301.1.35954 WP_003409301.1.36005 WP_003409301.1.36014 WP_003409301.1.36051 WP_003409301.1.36053 WP_003409301.1.36075 WP_003409301.1.36089 WP_003409301.1.36097 WP_003409301.1.36098 WP_003409301.1.36116 WP_003409301.1.36145 WP_003409301.1.36205 WP_003409301.1.36228 WP_003409301.1.36252 WP_003409301.1.36260 WP_003409301.1.36271 WP_003409301.1.36303 WP_003409301.1.36309 WP_003409301.1.36315 WP_003409301.1.36319 WP_003409301.1.36321 WP_003409301.1.36326 WP_003409301.1.3634 WP_003409301.1.36356 WP_003409301.1.36357 WP_003409301.1.3636 WP_003409301.1.36385 WP_003409301.1.36399 WP_003409301.1.36436 WP_003409301.1.36465 WP_003409301.1.36469 WP_003409301.1.36473 WP_003409301.1.36508 WP_003409301.1.36540 WP_003409301.1.36561 WP_003409301.1.36571 WP_003409301.1.36573 WP_003409301.1.36578 WP_003409301.1.36585 WP_003409301.1.36597 WP_003409301.1.36614 WP_003409301.1.36674 WP_003409301.1.36720 WP_003409301.1.36727 WP_003409301.1.36733 WP_003409301.1.36785 WP_003409301.1.36810 WP_003409301.1.36862 WP_003409301.1.36893 WP_003409301.1.36901 WP_003409301.1.36921 WP_003409301.1.36935 WP_003409301.1.36941 WP_003409301.1.3695 WP_003409301.1.36968 WP_003409301.1.3700 WP_003409301.1.37004 WP_003409301.1.37012 WP_003409301.1.37071 WP_003409301.1.37088 WP_003409301.1.37131 WP_003409301.1.37157 WP_003409301.1.37175 WP_003409301.1.37188 WP_003409301.1.37229 WP_003409301.1.3724 WP_003409301.1.37277 WP_003409301.1.37305 WP_003409301.1.37330 WP_003409301.1.37389 WP_003409301.1.37400 WP_003409301.1.37440 WP_003409301.1.37459 WP_003409301.1.37475 WP_003409301.1.37484 WP_003409301.1.37601 WP_003409301.1.37612 WP_003409301.1.37632 WP_003409301.1.37643 WP_003409301.1.37655 WP_003409301.1.37660 WP_003409301.1.37674 WP_003409301.1.37700 WP_003409301.1.37701 WP_003409301.1.37709 WP_003409301.1.37711 WP_003409301.1.37721 WP_003409301.1.37722 WP_003409301.1.37747 WP_003409301.1.37765 WP_003409301.1.37772 WP_003409301.1.37804 WP_003409301.1.37809 WP_003409301.1.37859 WP_003409301.1.37877 WP_003409301.1.37912 WP_003409301.1.37913 WP_003409301.1.37943 WP_003409301.1.37950 WP_003409301.1.37973 WP_003409301.1.37975 WP_003409301.1.37983 WP_003409301.1.38 WP_003409301.1.38002 WP_003409301.1.3802 WP_003409301.1.38039 WP_003409301.1.38040 WP_003409301.1.38067 WP_003409301.1.38068 WP_003409301.1.38138 WP_003409301.1.38144 WP_003409301.1.38158 WP_003409301.1.38159 WP_003409301.1.38210 WP_003409301.1.38233 WP_003409301.1.38240 WP_003409301.1.38299 WP_003409301.1.38332 WP_003409301.1.38347 WP_003409301.1.38354 WP_003409301.1.38389 WP_003409301.1.38398 WP_003409301.1.38402 WP_003409301.1.38418 WP_003409301.1.38421 WP_003409301.1.38466 WP_003409301.1.38477 WP_003409301.1.38483 WP_003409301.1.3849 WP_003409301.1.385 WP_003409301.1.38530 WP_003409301.1.38594 WP_003409301.1.38611 WP_003409301.1.38638 WP_003409301.1.38639 WP_003409301.1.38646 WP_003409301.1.38648 WP_003409301.1.38654 WP_003409301.1.38660 WP_003409301.1.38666 WP_003409301.1.38671 WP_003409301.1.38672 WP_003409301.1.38677 WP_003409301.1.38750 WP_003409301.1.38772 WP_003409301.1.38812 WP_003409301.1.38821 WP_003409301.1.38844 WP_003409301.1.38863 WP_003409301.1.38873 WP_003409301.1.3889 WP_003409301.1.38894 WP_003409301.1.38939 WP_003409301.1.38974 WP_003409301.1.38975 WP_003409301.1.38991 WP_003409301.1.39025 WP_003409301.1.39070 WP_003409301.1.39072 WP_003409301.1.39095 WP_003409301.1.39106 WP_003409301.1.39165 WP_003409301.1.39174 WP_003409301.1.39176 WP_003409301.1.39178 WP_003409301.1.39190 WP_003409301.1.39201 WP_003409301.1.39207 WP_003409301.1.39236 WP_003409301.1.39239 WP_003409301.1.39252 WP_003409301.1.39288 WP_003409301.1.39295 WP_003409301.1.39306 WP_003409301.1.39364 WP_003409301.1.39400 WP_003409301.1.39447 WP_003409301.1.3945 WP_003409301.1.39450 WP_003409301.1.39455 WP_003409301.1.3949 WP_003409301.1.39521 WP_003409301.1.39560 WP_003409301.1.39592 WP_003409301.1.39593 WP_003409301.1.396 WP_003409301.1.3960 WP_003409301.1.39616 WP_003409301.1.39654 WP_003409301.1.39657 WP_003409301.1.39661 WP_003409301.1.39674 WP_003409301.1.39678 WP_003409301.1.3968 WP_003409301.1.39694 WP_003409301.1.3971 WP_003409301.1.39718 WP_003409301.1.39728 WP_003409301.1.39739 WP_003409301.1.39748 WP_003409301.1.39751 WP_003409301.1.39759 WP_003409301.1.39801 WP_003409301.1.39804 WP_003409301.1.39848 WP_003409301.1.39877 WP_003409301.1.39925 WP_003409301.1.3994 WP_003409301.1.39959 WP_003409301.1.3996 WP_003409301.1.39960 WP_003409301.1.3997 WP_003409301.1.39980 WP_003409301.1.40000 WP_003409301.1.40028 WP_003409301.1.4003 WP_003409301.1.40094 WP_003409301.1.40096 WP_003409301.1.40150 WP_003409301.1.40156 WP_003409301.1.40174 WP_003409301.1.40186 WP_003409301.1.40276 WP_003409301.1.40277 WP_003409301.1.40323 WP_003409301.1.40336 WP_003409301.1.40353 WP_003409301.1.4036 WP_003409301.1.40372 WP_003409301.1.40402 WP_003409301.1.40413 WP_003409301.1.40440 WP_003409301.1.40446 WP_003409301.1.40451 WP_003409301.1.40455 WP_003409301.1.40523 WP_003409301.1.40543 WP_003409301.1.40641 WP_003409301.1.40646 WP_003409301.1.40651 WP_003409301.1.40653 WP_003409301.1.4067 WP_003409301.1.40705 WP_003409301.1.40723 WP_003409301.1.40731 WP_003409301.1.40735 WP_003409301.1.40795 WP_003409301.1.40799 WP_003409301.1.40876 WP_003409301.1.40881 WP_003409301.1.40922 WP_003409301.1.4095 WP_003409301.1.40956 WP_003409301.1.40957 WP_003409301.1.40964 WP_003409301.1.4097 WP_003409301.1.410 WP_003409301.1.41000 WP_003409301.1.41055 WP_003409301.1.41108 WP_003409301.1.41123 WP_003409301.1.41177 WP_003409301.1.41202 WP_003409301.1.41219 WP_003409301.1.41231 WP_003409301.1.41249 WP_003409301.1.4127 WP_003409301.1.41355 WP_003409301.1.41376 WP_003409301.1.41430 WP_003409301.1.41447 WP_003409301.1.41469 WP_003409301.1.41504 WP_003409301.1.41553 WP_003409301.1.41564 WP_003409301.1.41632 WP_003409301.1.41635 WP_003409301.1.41636 WP_003409301.1.41648 WP_003409301.1.41660 WP_003409301.1.41685 WP_003409301.1.41695 WP_003409301.1.41704 WP_003409301.1.4171 WP_003409301.1.41719 WP_003409301.1.41733 WP_003409301.1.41744 WP_003409301.1.41774 WP_003409301.1.41791 WP_003409301.1.41803 WP_003409301.1.41820 WP_003409301.1.41828 WP_003409301.1.41829 WP_003409301.1.41860 WP_003409301.1.41912 WP_003409301.1.41921 WP_003409301.1.41933 WP_003409301.1.41944 WP_003409301.1.42043 WP_003409301.1.42078 WP_003409301.1.42094 WP_003409301.1.42112 WP_003409301.1.4212 WP_003409301.1.42122 WP_003409301.1.42134 WP_003409301.1.42183 WP_003409301.1.42188 WP_003409301.1.42208 WP_003409301.1.42247 WP_003409301.1.42255 WP_003409301.1.42273 WP_003409301.1.42278 WP_003409301.1.42304 WP_003409301.1.42309 WP_003409301.1.42370 WP_003409301.1.42385 WP_003409301.1.42400 WP_003409301.1.42409 WP_003409301.1.42414 WP_003409301.1.42430 WP_003409301.1.42461 WP_003409301.1.42465 WP_003409301.1.42467 WP_003409301.1.42473 WP_003409301.1.42474 WP_003409301.1.4248 WP_003409301.1.42494 WP_003409301.1.42519 WP_003409301.1.42524 WP_003409301.1.42534 WP_003409301.1.4255 WP_003409301.1.42562 WP_003409301.1.42568 WP_003409301.1.42570 WP_003409301.1.42618 WP_003409301.1.42660 WP_003409301.1.42695 WP_003409301.1.42704 WP_003409301.1.42705 WP_003409301.1.42722 WP_003409301.1.42777 WP_003409301.1.42782 WP_003409301.1.42835 WP_003409301.1.42839 WP_003409301.1.42842 WP_003409301.1.42905 WP_003409301.1.42916 WP_003409301.1.42930 WP_003409301.1.42971 WP_003409301.1.43005 WP_003409301.1.43009 WP_003409301.1.43053 WP_003409301.1.43082 WP_003409301.1.43087 WP_003409301.1.43098 WP_003409301.1.43208 WP_003409301.1.43236 WP_003409301.1.43246 WP_003409301.1.43255 WP_003409301.1.43266 WP_003409301.1.43269 WP_003409301.1.43273 WP_003409301.1.43296 WP_003409301.1.43306 WP_003409301.1.4335 WP_003409301.1.43368 WP_003409301.1.43395 WP_003409301.1.43457 WP_003409301.1.43462 WP_003409301.1.43475 WP_003409301.1.43478 WP_003409301.1.43484 WP_003409301.1.43557 WP_003409301.1.43578 WP_003409301.1.43588 WP_003409301.1.43643 WP_003409301.1.43664 WP_003409301.1.43684 WP_003409301.1.43686 WP_003409301.1.43706 WP_003409301.1.43716 WP_003409301.1.4377 WP_003409301.1.43781 WP_003409301.1.43794 WP_003409301.1.43815 WP_003409301.1.43846 WP_003409301.1.43861 WP_003409301.1.43863 WP_003409301.1.43866 WP_003409301.1.43872 WP_003409301.1.43885 WP_003409301.1.43897 WP_003409301.1.4390 WP_003409301.1.43902 WP_003409301.1.43921 WP_003409301.1.43936 WP_003409301.1.43937 WP_003409301.1.43960 WP_003409301.1.43965 WP_003409301.1.4399 WP_003409301.1.43993 WP_003409301.1.43996 WP_003409301.1.44 WP_003409301.1.44001 WP_003409301.1.44008 WP_003409301.1.44033 WP_003409301.1.44037 WP_003409301.1.44070 WP_003409301.1.44071 WP_003409301.1.44076 WP_003409301.1.44104 WP_003409301.1.44111 WP_003409301.1.44124 WP_003409301.1.44169 WP_003409301.1.44219 WP_003409301.1.44237 WP_003409301.1.44277 WP_003409301.1.44279 WP_003409301.1.44355 WP_003409301.1.44358 WP_003409301.1.4438 WP_003409301.1.44390 WP_003409301.1.44392 WP_003409301.1.4441 WP_003409301.1.44415 WP_003409301.1.44466 WP_003409301.1.44489 WP_003409301.1.44492 WP_003409301.1.44494 WP_003409301.1.44500 WP_003409301.1.44532 WP_003409301.1.44534 WP_003409301.1.44562 WP_003409301.1.44597 WP_003409301.1.44600 WP_003409301.1.44602 WP_003409301.1.44615 WP_003409301.1.4464 WP_003409301.1.44651 WP_003409301.1.44659 WP_003409301.1.44665 WP_003409301.1.44694 WP_003409301.1.44700 WP_003409301.1.44713 WP_003409301.1.44735 WP_003409301.1.44740 WP_003409301.1.44757 WP_003409301.1.4476 WP_003409301.1.44761 WP_003409301.1.44776 WP_003409301.1.44779 WP_003409301.1.44786 WP_003409301.1.44808 WP_003409301.1.44908 WP_003409301.1.44913 WP_003409301.1.4492 WP_003409301.1.44939 WP_003409301.1.44979 WP_003409301.1.44981 WP_003409301.1.45002 WP_003409301.1.45011 WP_003409301.1.4504 WP_003409301.1.45062 WP_003409301.1.45081 WP_003409301.1.45113 WP_003409301.1.45129 WP_003409301.1.45135 WP_003409301.1.45147 WP_003409301.1.45168 WP_003409301.1.4517 WP_003409301.1.45181 WP_003409301.1.45185 WP_003409301.1.45192 WP_003409301.1.45200 WP_003409301.1.45205 WP_003409301.1.45211 WP_003409301.1.45249 WP_003409301.1.4526 WP_003409301.1.45286 WP_003409301.1.45326 WP_003409301.1.45347 WP_003409301.1.45374 WP_003409301.1.45390 WP_003409301.1.454 WP_003409301.1.45407 WP_003409301.1.45451 WP_003409301.1.45453 WP_003409301.1.45460 WP_003409301.1.45463 WP_003409301.1.45470 WP_003409301.1.45474 WP_003409301.1.45491 WP_003409301.1.45510 WP_003409301.1.45563 WP_003409301.1.45584 WP_003409301.1.45590 WP_003409301.1.45619 WP_003409301.1.45626 WP_003409301.1.45631 WP_003409301.1.45666 WP_003409301.1.45697 WP_003409301.1.4571 WP_003409301.1.45731 WP_003409301.1.45743 WP_003409301.1.45765 WP_003409301.1.45776 WP_003409301.1.45805 WP_003409301.1.45815 WP_003409301.1.45849 WP_003409301.1.45867 WP_003409301.1.45923 WP_003409301.1.45926 WP_003409301.1.45963 WP_003409301.1.45989 WP_003409301.1.45992 WP_003409301.1.46025 WP_003409301.1.46083 WP_003409301.1.46090 WP_003409301.1.46092 WP_003409301.1.46100 WP_003409301.1.46101 WP_003409301.1.46103 WP_003409301.1.46107 WP_003409301.1.46127 WP_003409301.1.46128 WP_003409301.1.46129 WP_003409301.1.46141 WP_003409301.1.46150 WP_003409301.1.46201 WP_003409301.1.46226 WP_003409301.1.4624 WP_003409301.1.46253 WP_003409301.1.46268 WP_003409301.1.46285 WP_003409301.1.46300 WP_003409301.1.46313 WP_003409301.1.46336 WP_003409301.1.46365 WP_003409301.1.46370 WP_003409301.1.46381 WP_003409301.1.46411 WP_003409301.1.4644 WP_003409301.1.46442 WP_003409301.1.46453 WP_003409301.1.46478 WP_003409301.1.46492 WP_003409301.1.46521 WP_003409301.1.4653 WP_003409301.1.46532 WP_003409301.1.46539 WP_003409301.1.46568 WP_003409301.1.46585 WP_003409301.1.46609 WP_003409301.1.46613 WP_003409301.1.46625 WP_003409301.1.46642 WP_003409301.1.46647 WP_003409301.1.46724 WP_003409301.1.46758 WP_003409301.1.46773 WP_003409301.1.46777 WP_003409301.1.46786 WP_003409301.1.46792 WP_003409301.1.46847 WP_003409301.1.46851 WP_003409301.1.4687 WP_003409301.1.46936 WP_003409301.1.46980 WP_003409301.1.47011 WP_003409301.1.47066 WP_003409301.1.47077 WP_003409301.1.47083 WP_003409301.1.47106 WP_003409301.1.47142 WP_003409301.1.47147 WP_003409301.1.47166 WP_003409301.1.47178 WP_003409301.1.47179 WP_003409301.1.47194 WP_003409301.1.47207 WP_003409301.1.47210 WP_003409301.1.47261 WP_003409301.1.47262 WP_003409301.1.47402 WP_003409301.1.47423 WP_003409301.1.47467 WP_003409301.1.47502 WP_003409301.1.4751 WP_003409301.1.47511 WP_003409301.1.47537 WP_003409301.1.47540 WP_003409301.1.47568 WP_003409301.1.47572 WP_003409301.1.47588 WP_003409301.1.47636 WP_003409301.1.4764 WP_003409301.1.47653 WP_003409301.1.47679 WP_003409301.1.47681 WP_003409301.1.47690 WP_003409301.1.4771 WP_003409301.1.47743 WP_003409301.1.47754 WP_003409301.1.47773 WP_003409301.1.47776 WP_003409301.1.47780 WP_003409301.1.47805 WP_003409301.1.47832 WP_003409301.1.47847 WP_003409301.1.47858 WP_003409301.1.47861 WP_003409301.1.47868 WP_003409301.1.47899 WP_003409301.1.479 WP_003409301.1.47912 WP_003409301.1.47913 WP_003409301.1.47926 WP_003409301.1.4794 WP_003409301.1.47943 WP_003409301.1.47944 WP_003409301.1.47959 WP_003409301.1.47974 WP_003409301.1.47993 WP_003409301.1.48004 WP_003409301.1.48050 WP_003409301.1.48084 WP_003409301.1.48097 WP_003409301.1.48101 WP_003409301.1.4813 WP_003409301.1.48130 WP_003409301.1.48135 WP_003409301.1.48143 WP_003409301.1.48152 WP_003409301.1.48155 WP_003409301.1.48170 WP_003409301.1.48173 WP_003409301.1.48177 WP_003409301.1.48185 WP_003409301.1.48204 WP_003409301.1.48219 WP_003409301.1.4823 WP_003409301.1.48240 WP_003409301.1.48256 WP_003409301.1.48264 WP_003409301.1.48287 WP_003409301.1.48333 WP_003409301.1.48348 WP_003409301.1.48354 WP_003409301.1.48372 WP_003409301.1.48383 WP_003409301.1.48388 WP_003409301.1.48419 WP_003409301.1.48423 WP_003409301.1.48443 WP_003409301.1.48462 WP_003409301.1.48543 WP_003409301.1.48550 WP_003409301.1.48605 WP_003409301.1.48618 WP_003409301.1.4863 WP_003409301.1.48648 WP_003409301.1.48658 WP_003409301.1.48666 WP_003409301.1.48687 WP_003409301.1.48779 WP_003409301.1.4878 WP_003409301.1.48798 WP_003409301.1.48802 WP_003409301.1.48826 WP_003409301.1.48831 WP_003409301.1.48843 WP_003409301.1.48857 WP_003409301.1.4890 WP_003409301.1.48946 WP_003409301.1.48979 WP_003409301.1.49017 WP_003409301.1.49048 WP_003409301.1.49059 WP_003409301.1.4906 WP_003409301.1.4907 WP_003409301.1.49103 WP_003409301.1.49110 WP_003409301.1.49112 WP_003409301.1.4919 WP_003409301.1.49251 WP_003409301.1.49254 WP_003409301.1.49263 WP_003409301.1.49291 WP_003409301.1.49296 WP_003409301.1.49335 WP_003409301.1.49337 WP_003409301.1.49419 WP_003409301.1.49426 WP_003409301.1.49437 WP_003409301.1.49439 WP_003409301.1.49474 WP_003409301.1.49506 WP_003409301.1.49523 WP_003409301.1.49526 WP_003409301.1.49532 WP_003409301.1.4959 WP_003409301.1.49678 WP_003409301.1.49687 WP_003409301.1.49699 WP_003409301.1.49709 WP_003409301.1.4972 WP_003409301.1.49736 WP_003409301.1.49746 WP_003409301.1.49764 WP_003409301.1.49773 WP_003409301.1.49796 WP_003409301.1.49814 WP_003409301.1.49815 WP_003409301.1.49816 WP_003409301.1.49839 WP_003409301.1.49857 WP_003409301.1.49878 WP_003409301.1.49880 WP_003409301.1.49944 WP_003409301.1.4999 WP_003409301.1.49990 WP_003409301.1.50068 WP_003409301.1.50077 WP_003409301.1.5008 WP_003409301.1.50081 WP_003409301.1.50122 WP_003409301.1.50126 WP_003409301.1.50149 WP_003409301.1.50162 WP_003409301.1.5018 WP_003409301.1.50194 WP_003409301.1.50218 WP_003409301.1.50235 WP_003409301.1.50249 WP_003409301.1.50265 WP_003409301.1.50271 WP_003409301.1.50324 WP_003409301.1.50347 WP_003409301.1.50372 WP_003409301.1.50398 WP_003409301.1.50407 WP_003409301.1.50444 WP_003409301.1.50466 WP_003409301.1.50472 WP_003409301.1.5048 WP_003409301.1.50498 WP_003409301.1.5050 WP_003409301.1.50540 WP_003409301.1.50554 WP_003409301.1.50557 WP_003409301.1.50601 WP_003409301.1.50610 WP_003409301.1.50632 WP_003409301.1.50633 WP_003409301.1.50655 WP_003409301.1.50659 WP_003409301.1.50683 WP_003409301.1.50689 WP_003409301.1.50692 WP_003409301.1.50714 WP_003409301.1.50729 WP_003409301.1.50756 WP_003409301.1.50784 WP_003409301.1.50794 WP_003409301.1.50841 WP_003409301.1.50877 WP_003409301.1.5096 WP_003409301.1.50981 WP_003409301.1.50987 WP_003409301.1.51003 WP_003409301.1.51009 WP_003409301.1.51037 WP_003409301.1.51074 WP_003409301.1.51082 WP_003409301.1.51101 WP_003409301.1.51116 WP_003409301.1.51149 WP_003409301.1.51156 WP_003409301.1.51157 WP_003409301.1.51213 WP_003409301.1.51232 WP_003409301.1.51239 WP_003409301.1.51247 WP_003409301.1.51266 WP_003409301.1.51279 WP_003409301.1.51291 WP_003409301.1.51294 WP_003409301.1.51301 WP_003409301.1.51329 WP_003409301.1.51391 WP_003409301.1.51422 WP_003409301.1.51445 WP_003409301.1.51455 WP_003409301.1.51466 WP_003409301.1.51468 WP_003409301.1.51478 WP_003409301.1.51497 WP_003409301.1.51520 WP_003409301.1.51593 WP_003409301.1.51628 WP_003409301.1.5164 WP_003409301.1.51647 WP_003409301.1.51660 WP_003409301.1.51696 WP_003409301.1.51721 WP_003409301.1.51788 WP_003409301.1.51795 WP_003409301.1.51801 WP_003409301.1.51817 WP_003409301.1.51819 WP_003409301.1.51854 WP_003409301.1.51923 WP_003409301.1.51942 WP_003409301.1.51948 WP_003409301.1.51963 WP_003409301.1.51969 WP_003409301.1.52000 WP_003409301.1.52001 WP_003409301.1.52003 WP_003409301.1.52006 WP_003409301.1.52036 WP_003409301.1.52046 WP_003409301.1.52059 WP_003409301.1.52069 WP_003409301.1.52082 WP_003409301.1.52102 WP_003409301.1.52106 WP_003409301.1.52166 WP_003409301.1.52173 WP_003409301.1.52178 WP_003409301.1.52206 WP_003409301.1.52216 WP_003409301.1.52238 WP_003409301.1.52241 WP_003409301.1.52280 WP_003409301.1.52314 WP_003409301.1.52385 WP_003409301.1.52390 WP_003409301.1.524 WP_003409301.1.52460 WP_003409301.1.52485 WP_003409301.1.52486 WP_003409301.1.52504 WP_003409301.1.52522 WP_003409301.1.52531 WP_003409301.1.52533 WP_003409301.1.52545 WP_003409301.1.52553 WP_003409301.1.52563 WP_003409301.1.52564 WP_003409301.1.52574 WP_003409301.1.52641 WP_003409301.1.52673 WP_003409301.1.52674 WP_003409301.1.52708 WP_003409301.1.52713 WP_003409301.1.52761 WP_003409301.1.52778 WP_003409301.1.52797 WP_003409301.1.52818 WP_003409301.1.52872 WP_003409301.1.52873 WP_003409301.1.52891 WP_003409301.1.52892 WP_003409301.1.52909 WP_003409301.1.52970 WP_003409301.1.52998 WP_003409301.1.53053 WP_003409301.1.53056 WP_003409301.1.5306 WP_003409301.1.53088 WP_003409301.1.5309 WP_003409301.1.531 WP_003409301.1.53117 WP_003409301.1.53118 WP_003409301.1.53142 WP_003409301.1.53143 WP_003409301.1.53157 WP_003409301.1.53167 WP_003409301.1.53200 WP_003409301.1.53213 WP_003409301.1.53217 WP_003409301.1.53226 WP_003409301.1.53229 WP_003409301.1.53230 WP_003409301.1.53237 WP_003409301.1.53254 WP_003409301.1.53257 WP_003409301.1.5327 WP_003409301.1.53276 WP_003409301.1.53278 WP_003409301.1.533 WP_003409301.1.53306 WP_003409301.1.5334 WP_003409301.1.5335 WP_003409301.1.53353 WP_003409301.1.53381 WP_003409301.1.53413 WP_003409301.1.53458 WP_003409301.1.53460 WP_003409301.1.53480 WP_003409301.1.53517 WP_003409301.1.53522 WP_003409301.1.53525 WP_003409301.1.53526 WP_003409301.1.53553 WP_003409301.1.53606 WP_003409301.1.53609 WP_003409301.1.53628 WP_003409301.1.53643 WP_003409301.1.53667 WP_003409301.1.53679 WP_003409301.1.53715 WP_003409301.1.53730 WP_003409301.1.53742 WP_003409301.1.53743 WP_003409301.1.53754 WP_003409301.1.53775 WP_003409301.1.53787 WP_003409301.1.53803 WP_003409301.1.53818 WP_003409301.1.53853 WP_003409301.1.53865 WP_003409301.1.53888 WP_003409301.1.53900 WP_003409301.1.53912 WP_003409301.1.53914 WP_003409301.1.53952 WP_003409301.1.5398 WP_003409301.1.5408 WP_003409301.1.54089 WP_003409301.1.54093 WP_003409301.1.54099 WP_003409301.1.54112 WP_003409301.1.54125 WP_003409301.1.54141 WP_003409301.1.54162 WP_003409301.1.54179 WP_003409301.1.54206 WP_003409301.1.54218 WP_003409301.1.54225 WP_003409301.1.54227 WP_003409301.1.54232 WP_003409301.1.54241 WP_003409301.1.54245 WP_003409301.1.54247 WP_003409301.1.54260 WP_003409301.1.54275 WP_003409301.1.54280 WP_003409301.1.5429 WP_003409301.1.54294 WP_003409301.1.54314 WP_003409301.1.54351 WP_003409301.1.54370 WP_003409301.1.54428 WP_003409301.1.54449 WP_003409301.1.54494 WP_003409301.1.54514 WP_003409301.1.54519 WP_003409301.1.5452 WP_003409301.1.54531 WP_003409301.1.54537 WP_003409301.1.54553 WP_003409301.1.54555 WP_003409301.1.54575 WP_003409301.1.54633 WP_003409301.1.54686 WP_003409301.1.54687 WP_003409301.1.54705 WP_003409301.1.54730 WP_003409301.1.54732 WP_003409301.1.5475 WP_003409301.1.54797 WP_003409301.1.54807 WP_003409301.1.54836 WP_003409301.1.54838 WP_003409301.1.54860 WP_003409301.1.54897 WP_003409301.1.54905 WP_003409301.1.54909 WP_003409301.1.54937 WP_003409301.1.54939 WP_003409301.1.54944 WP_003409301.1.54945 WP_003409301.1.54953 WP_003409301.1.54964 WP_003409301.1.55022 WP_003409301.1.55023 WP_003409301.1.55051 WP_003409301.1.55072 WP_003409301.1.55088 WP_003409301.1.55106 WP_003409301.1.55126 WP_003409301.1.55128 WP_003409301.1.55140 WP_003409301.1.55150 WP_003409301.1.55210 WP_003409301.1.55227 WP_003409301.1.55248 WP_003409301.1.55257 WP_003409301.1.55258 WP_003409301.1.55267 WP_003409301.1.55279 WP_003409301.1.55307 WP_003409301.1.55326 WP_003409301.1.55328 WP_003409301.1.5533 WP_003409301.1.55345 WP_003409301.1.55396 WP_003409301.1.55398 WP_003409301.1.55441 WP_003409301.1.55459 WP_003409301.1.55501 WP_003409301.1.55578 WP_003409301.1.55626 WP_003409301.1.55641 WP_003409301.1.55723 WP_003409301.1.55735 WP_003409301.1.5574 WP_003409301.1.55772 WP_003409301.1.55802 WP_003409301.1.55819 WP_003409301.1.55821 WP_003409301.1.5583 WP_003409301.1.55849 WP_003409301.1.55856 WP_003409301.1.55860 WP_003409301.1.55882 WP_003409301.1.55883 WP_003409301.1.55894 WP_003409301.1.55902 WP_003409301.1.55908 WP_003409301.1.55909 WP_003409301.1.5591 WP_003409301.1.55961 WP_003409301.1.55977 WP_003409301.1.55983 WP_003409301.1.56028 WP_003409301.1.56057 WP_003409301.1.56060 WP_003409301.1.56107 WP_003409301.1.56132 WP_003409301.1.56163 WP_003409301.1.56167 WP_003409301.1.56178 WP_003409301.1.56287 WP_003409301.1.56292 WP_003409301.1.56327 WP_003409301.1.56341 WP_003409301.1.56359 WP_003409301.1.56365 WP_003409301.1.56394 WP_003409301.1.56443 WP_003409301.1.56473 WP_003409301.1.56478 WP_003409301.1.56500 WP_003409301.1.56517 WP_003409301.1.5656 WP_003409301.1.56577 WP_003409301.1.56593 WP_003409301.1.56625 WP_003409301.1.56637 WP_003409301.1.56670 WP_003409301.1.56697 WP_003409301.1.567 WP_003409301.1.56701 WP_003409301.1.56743 WP_003409301.1.56755 WP_003409301.1.56764 WP_003409301.1.56769 WP_003409301.1.56770 WP_003409301.1.56795 WP_003409301.1.5681 WP_003409301.1.56827 WP_003409301.1.56839 WP_003409301.1.56863 WP_003409301.1.56868 WP_003409301.1.56869 WP_003409301.1.56915 WP_003409301.1.56926 WP_003409301.1.56961 WP_003409301.1.56971 WP_003409301.1.56972 WP_003409301.1.57023 WP_003409301.1.57035 WP_003409301.1.57077 WP_003409301.1.57087 WP_003409301.1.57094 WP_003409301.1.57134 WP_003409301.1.57169 WP_003409301.1.57208 WP_003409301.1.57212 WP_003409301.1.57230 WP_003409301.1.5724 WP_003409301.1.5725 WP_003409301.1.5727 WP_003409301.1.57273 WP_003409301.1.573 WP_003409301.1.57326 WP_003409301.1.57328 WP_003409301.1.57331 WP_003409301.1.57340 WP_003409301.1.57351 WP_003409301.1.57380 WP_003409301.1.57430 WP_003409301.1.5744 WP_003409301.1.57440 WP_003409301.1.5745 WP_003409301.1.57461 WP_003409301.1.57469 WP_003409301.1.57489 WP_003409301.1.575 WP_003409301.1.57509 WP_003409301.1.57519 WP_003409301.1.57525 WP_003409301.1.57551 WP_003409301.1.57596 WP_003409301.1.57619 WP_003409301.1.57627 WP_003409301.1.57642 WP_003409301.1.57658 WP_003409301.1.57667 WP_003409301.1.57675 WP_003409301.1.57689 WP_003409301.1.57708 WP_003409301.1.57794 WP_003409301.1.57821 WP_003409301.1.57825 WP_003409301.1.57843 WP_003409301.1.57906 WP_003409301.1.57924 WP_003409301.1.57926 WP_003409301.1.57957 WP_003409301.1.57960 WP_003409301.1.57964 WP_003409301.1.57991 WP_003409301.1.58086 WP_003409301.1.58103 WP_003409301.1.58108 WP_003409301.1.5811 WP_003409301.1.58121 WP_003409301.1.58145 WP_003409301.1.58164 WP_003409301.1.58174 WP_003409301.1.582 WP_003409301.1.58209 WP_003409301.1.58215 WP_003409301.1.5824 WP_003409301.1.58250 WP_003409301.1.58259 WP_003409301.1.58283 WP_003409301.1.58288 WP_003409301.1.5830 WP_003409301.1.58303 WP_003409301.1.58311 WP_003409301.1.58330 WP_003409301.1.58359 WP_003409301.1.58386 WP_003409301.1.58393 WP_003409301.1.58431 WP_003409301.1.5844 WP_003409301.1.58457 WP_003409301.1.58488 WP_003409301.1.58518 WP_003409301.1.58534 WP_003409301.1.58559 WP_003409301.1.58567 WP_003409301.1.58573 WP_003409301.1.58602 WP_003409301.1.58612 WP_003409301.1.58619 WP_003409301.1.58630 WP_003409301.1.5865 WP_003409301.1.58671 WP_003409301.1.58690 WP_003409301.1.58702 WP_003409301.1.58743 WP_003409301.1.58754 WP_003409301.1.5879 WP_003409301.1.5881 WP_003409301.1.58824 WP_003409301.1.58848 WP_003409301.1.58857 WP_003409301.1.58891 WP_003409301.1.58892 WP_003409301.1.5890 WP_003409301.1.58904 WP_003409301.1.58921 WP_003409301.1.58930 WP_003409301.1.58953 WP_003409301.1.58961 WP_003409301.1.5898 WP_003409301.1.59025 WP_003409301.1.59029 WP_003409301.1.59044 WP_003409301.1.59085 WP_003409301.1.59088 WP_003409301.1.59112 WP_003409301.1.59130 WP_003409301.1.5914 WP_003409301.1.59147 WP_003409301.1.59166 WP_003409301.1.59205 WP_003409301.1.59237 WP_003409301.1.59240 WP_003409301.1.59253 WP_003409301.1.59254 WP_003409301.1.59262 WP_003409301.1.59270 WP_003409301.1.5928 WP_003409301.1.59304 WP_003409301.1.59305 WP_003409301.1.59309 WP_003409301.1.59326 WP_003409301.1.59328 WP_003409301.1.59333 WP_003409301.1.59338 WP_003409301.1.59388 WP_003409301.1.59428 WP_003409301.1.59487 WP_003409301.1.59537 WP_003409301.1.59561 WP_003409301.1.59677 WP_003409301.1.59722 WP_003409301.1.59727 WP_003409301.1.59732 WP_003409301.1.59738 WP_003409301.1.59750 WP_003409301.1.59757 WP_003409301.1.59761 WP_003409301.1.59808 WP_003409301.1.59850 WP_003409301.1.59860 WP_003409301.1.59861 WP_003409301.1.5987 WP_003409301.1.59878 WP_003409301.1.59888 WP_003409301.1.59952 WP_003409301.1.5996 WP_003409301.1.59961 WP_003409301.1.59974 WP_003409301.1.6000 WP_003409301.1.6003 WP_003409301.1.60047 WP_003409301.1.6007 WP_003409301.1.60121 WP_003409301.1.60125 WP_003409301.1.60135 WP_003409301.1.60139 WP_003409301.1.60152 WP_003409301.1.60171 WP_003409301.1.60197 WP_003409301.1.6020 WP_003409301.1.60205 WP_003409301.1.60207 WP_003409301.1.60215 WP_003409301.1.60217 WP_003409301.1.60267 WP_003409301.1.60288 WP_003409301.1.60301 WP_003409301.1.60305 WP_003409301.1.60312 WP_003409301.1.60313 WP_003409301.1.60314 WP_003409301.1.60367 WP_003409301.1.60376 WP_003409301.1.60403 WP_003409301.1.60413 WP_003409301.1.60421 WP_003409301.1.60451 WP_003409301.1.60460 WP_003409301.1.60487 WP_003409301.1.60512 WP_003409301.1.60573 WP_003409301.1.60583 WP_003409301.1.60632 WP_003409301.1.60657 WP_003409301.1.60687 WP_003409301.1.60689 WP_003409301.1.60727 WP_003409301.1.60738 WP_003409301.1.60763 WP_003409301.1.6077 WP_003409301.1.60791 WP_003409301.1.60834 WP_003409301.1.60878 WP_003409301.1.60879 WP_003409301.1.60913 WP_003409301.1.60978 WP_003409301.1.61000 WP_003409301.1.61001 WP_003409301.1.61012 WP_003409301.1.61014 WP_003409301.1.61015 WP_003409301.1.61037 WP_003409301.1.61052 WP_003409301.1.61065 WP_003409301.1.61100 WP_003409301.1.61101 WP_003409301.1.61138 WP_003409301.1.61142 WP_003409301.1.61198 WP_003409301.1.612 WP_003409301.1.61234 WP_003409301.1.61281 WP_003409301.1.61314 WP_003409301.1.61321 WP_003409301.1.61326 WP_003409301.1.61328 WP_003409301.1.61368 WP_003409301.1.61391 WP_003409301.1.61406 WP_003409301.1.61409 WP_003409301.1.61420 WP_003409301.1.61422 WP_003409301.1.61425 WP_003409301.1.61428 WP_003409301.1.61469 WP_003409301.1.61522 WP_003409301.1.61552 WP_003409301.1.61557 WP_003409301.1.61567 WP_003409301.1.61571 WP_003409301.1.61573 WP_003409301.1.61584 WP_003409301.1.61586 WP_003409301.1.6159 WP_003409301.1.61592 WP_003409301.1.6160 WP_003409301.1.61614 WP_003409301.1.6163 WP_003409301.1.61655 WP_003409301.1.61665 WP_003409301.1.61669 WP_003409301.1.61682 WP_003409301.1.61692 WP_003409301.1.61719 WP_003409301.1.61728 WP_003409301.1.61750 WP_003409301.1.61754 WP_003409301.1.61755 WP_003409301.1.61757 WP_003409301.1.6179 WP_003409301.1.61793 WP_003409301.1.61842 WP_003409301.1.61850 WP_003409301.1.61862 WP_003409301.1.61865 WP_003409301.1.61868 WP_003409301.1.61911 WP_003409301.1.61925 WP_003409301.1.61941 WP_003409301.1.61953 WP_003409301.1.61986 WP_003409301.1.61987 WP_003409301.1.61998 WP_003409301.1.62021 WP_003409301.1.62087 WP_003409301.1.62089 WP_003409301.1.62101 WP_003409301.1.62104 WP_003409301.1.6211 WP_003409301.1.62132 WP_003409301.1.62162 WP_003409301.1.62225 WP_003409301.1.62230 WP_003409301.1.62238 WP_003409301.1.62249 WP_003409301.1.62281 WP_003409301.1.62307 WP_003409301.1.6231 WP_003409301.1.62359 WP_003409301.1.62371 WP_003409301.1.62379 WP_003409301.1.62395 WP_003409301.1.62468 WP_003409301.1.6248 WP_003409301.1.62508 WP_003409301.1.62565 WP_003409301.1.62594 WP_003409301.1.62606 WP_003409301.1.62616 WP_003409301.1.62666 WP_003409301.1.62687 WP_003409301.1.62715 WP_003409301.1.62730 WP_003409301.1.62738 WP_003409301.1.62761 WP_003409301.1.62766 WP_003409301.1.62813 WP_003409301.1.62839 WP_003409301.1.62841 WP_003409301.1.62909 WP_003409301.1.62936 WP_003409301.1.6294 WP_003409301.1.6295 WP_003409301.1.62962 WP_003409301.1.63007 WP_003409301.1.63019 WP_003409301.1.63032 WP_003409301.1.63037 WP_003409301.1.63064 WP_003409301.1.63066 WP_003409301.1.63072 WP_003409301.1.6308 WP_003409301.1.63081 WP_003409301.1.63096 WP_003409301.1.63106 WP_003409301.1.63144 WP_003409301.1.63160 WP_003409301.1.63161 WP_003409301.1.63175 WP_003409301.1.63194 WP_003409301.1.63222 WP_003409301.1.6328 WP_003409301.1.63291 WP_003409301.1.63312 WP_003409301.1.63317 WP_003409301.1.63331 WP_003409301.1.63373 WP_003409301.1.63384 WP_003409301.1.63403 WP_003409301.1.63424 WP_003409301.1.63428 WP_003409301.1.6345 WP_003409301.1.63464 WP_003409301.1.63483 WP_003409301.1.63502 WP_003409301.1.63504 WP_003409301.1.63522 WP_003409301.1.63530 WP_003409301.1.63538 WP_003409301.1.63564 WP_003409301.1.63567 WP_003409301.1.63596 WP_003409301.1.63600 WP_003409301.1.63623 WP_003409301.1.63624 WP_003409301.1.63625 WP_003409301.1.63627 WP_003409301.1.63654 WP_003409301.1.63662 WP_003409301.1.63711 WP_003409301.1.63734 WP_003409301.1.63807 WP_003409301.1.63819 WP_003409301.1.63844 WP_003409301.1.63888 WP_003409301.1.63913 WP_003409301.1.63915 WP_003409301.1.63918 WP_003409301.1.63961 WP_003409301.1.63970 WP_003409301.1.64000 WP_003409301.1.64027 WP_003409301.1.64058 WP_003409301.1.64065 WP_003409301.1.6407 WP_003409301.1.64082 WP_003409301.1.64091 WP_003409301.1.64102 WP_003409301.1.64104 WP_003409301.1.64169 WP_003409301.1.64219 WP_003409301.1.6422 WP_003409301.1.64222 WP_003409301.1.64228 WP_003409301.1.64235 WP_003409301.1.64249 WP_003409301.1.6427 WP_003409301.1.64278 WP_003409301.1.64287 WP_003409301.1.64414 WP_003409301.1.64419 WP_003409301.1.6443 WP_003409301.1.64463 WP_003409301.1.64480 WP_003409301.1.64497 WP_003409301.1.64506 WP_003409301.1.64511 WP_003409301.1.64513 WP_003409301.1.64515 WP_003409301.1.64522 WP_003409301.1.64526 WP_003409301.1.6456 WP_003409301.1.64567 WP_003409301.1.64588 WP_003409301.1.64589 WP_003409301.1.64594 WP_003409301.1.64595 WP_003409301.1.64608 WP_003409301.1.64619 WP_003409301.1.64629 WP_003409301.1.6464 WP_003409301.1.64664 WP_003409301.1.64669 WP_003409301.1.64672 WP_003409301.1.64680 WP_003409301.1.64682 WP_003409301.1.64727 WP_003409301.1.64729 WP_003409301.1.64774 WP_003409301.1.64776 WP_003409301.1.64832 WP_003409301.1.6486 WP_003409301.1.64870 WP_003409301.1.64898 WP_003409301.1.64922 WP_003409301.1.64924 WP_003409301.1.6493 WP_003409301.1.64941 WP_003409301.1.64973 WP_003409301.1.65001 WP_003409301.1.65026 WP_003409301.1.65053 WP_003409301.1.65070 WP_003409301.1.65079 WP_003409301.1.65102 WP_003409301.1.65157 WP_003409301.1.65181 WP_003409301.1.65212 WP_003409301.1.6523 WP_003409301.1.65253 WP_003409301.1.65289 WP_003409301.1.65291 WP_003409301.1.65315 WP_003409301.1.65329 WP_003409301.1.65359 WP_003409301.1.6536 WP_003409301.1.65374 WP_003409301.1.65386 WP_003409301.1.65414 WP_003409301.1.65416 WP_003409301.1.65433 WP_003409301.1.65455 WP_003409301.1.65467 WP_003409301.1.65488 WP_003409301.1.65529 WP_003409301.1.65539 WP_003409301.1.65612 WP_003409301.1.65623 WP_003409301.1.65635 WP_003409301.1.65637 WP_003409301.1.65648 WP_003409301.1.65683 WP_003409301.1.65686 WP_003409301.1.65688 WP_003409301.1.65707 WP_003409301.1.65733 WP_003409301.1.65746 WP_003409301.1.65747 WP_003409301.1.65759 WP_003409301.1.65816 WP_003409301.1.65830 WP_003409301.1.65858 WP_003409301.1.65862 WP_003409301.1.65869 WP_003409301.1.65893 WP_003409301.1.65929 WP_003409301.1.65932 WP_003409301.1.65958 WP_003409301.1.65974 WP_003409301.1.66004 WP_003409301.1.6606 WP_003409301.1.66089 WP_003409301.1.66149 WP_003409301.1.66151 WP_003409301.1.66276 WP_003409301.1.66293 WP_003409301.1.66297 WP_003409301.1.66323 WP_003409301.1.66325 WP_003409301.1.6633 WP_003409301.1.66334 WP_003409301.1.66355 WP_003409301.1.66367 WP_003409301.1.66394 WP_003409301.1.66396 WP_003409301.1.66451 WP_003409301.1.66455 WP_003409301.1.66457 WP_003409301.1.66464 WP_003409301.1.66466 WP_003409301.1.66487 WP_003409301.1.66504 WP_003409301.1.66544 WP_003409301.1.66558 WP_003409301.1.66580 WP_003409301.1.66582 WP_003409301.1.66612 WP_003409301.1.66617 WP_003409301.1.66635 WP_003409301.1.66656 WP_003409301.1.66663 WP_003409301.1.66675 WP_003409301.1.66715 WP_003409301.1.66718 WP_003409301.1.66762 WP_003409301.1.66776 WP_003409301.1.66808 WP_003409301.1.66817 WP_003409301.1.66819 WP_003409301.1.66826 WP_003409301.1.66830 WP_003409301.1.66842 WP_003409301.1.66868 WP_003409301.1.66878 WP_003409301.1.66880 WP_003409301.1.66893 WP_003409301.1.66961 WP_003409301.1.67005 WP_003409301.1.6704 WP_003409301.1.67044 WP_003409301.1.67061 WP_003409301.1.67089 WP_003409301.1.67098 WP_003409301.1.67146 WP_003409301.1.67197 WP_003409301.1.67198 WP_003409301.1.6720 WP_003409301.1.67207 WP_003409301.1.67218 WP_003409301.1.67220 WP_003409301.1.67225 WP_003409301.1.67231 WP_003409301.1.6724 WP_003409301.1.67257 WP_003409301.1.67298 WP_003409301.1.67307 WP_003409301.1.67324 WP_003409301.1.67332 WP_003409301.1.67346 WP_003409301.1.67360 WP_003409301.1.67381 WP_003409301.1.67396 WP_003409301.1.67417 WP_003409301.1.67453 WP_003409301.1.67459 WP_003409301.1.6746 WP_003409301.1.67473 WP_003409301.1.67482 WP_003409301.1.67496 WP_003409301.1.67499 WP_003409301.1.67523 WP_003409301.1.67536 WP_003409301.1.67575 WP_003409301.1.67587 WP_003409301.1.67598 WP_003409301.1.67600 WP_003409301.1.67602 WP_003409301.1.67630 WP_003409301.1.67679 WP_003409301.1.67692 WP_003409301.1.67744 WP_003409301.1.6775 WP_003409301.1.6777 WP_003409301.1.67809 WP_003409301.1.67816 WP_003409301.1.67844 WP_003409301.1.67848 WP_003409301.1.67870 WP_003409301.1.67888 WP_003409301.1.67915 WP_003409301.1.67945 WP_003409301.1.67949 WP_003409301.1.67980 WP_003409301.1.67982 WP_003409301.1.68022 WP_003409301.1.68029 WP_003409301.1.68037 WP_003409301.1.68038 WP_003409301.1.68045 WP_003409301.1.68057 WP_003409301.1.68083 WP_003409301.1.68088 WP_003409301.1.68106 WP_003409301.1.68110 WP_003409301.1.68153 WP_003409301.1.68169 WP_003409301.1.68193 WP_003409301.1.68212 WP_003409301.1.68227 WP_003409301.1.68243 WP_003409301.1.6825 WP_003409301.1.68297 WP_003409301.1.68309 WP_003409301.1.68325 WP_003409301.1.68329 WP_003409301.1.68340 WP_003409301.1.68388 WP_003409301.1.68429 WP_003409301.1.6843 WP_003409301.1.68433 WP_003409301.1.68444 WP_003409301.1.68465 WP_003409301.1.68518 WP_003409301.1.68569 WP_003409301.1.68576 WP_003409301.1.68580 WP_003409301.1.68586 WP_003409301.1.68623 WP_003409301.1.68637 WP_003409301.1.68646 WP_003409301.1.68667 WP_003409301.1.68669 WP_003409301.1.68672 WP_003409301.1.68684 WP_003409301.1.68704 WP_003409301.1.68708 WP_003409301.1.6872 WP_003409301.1.68730 WP_003409301.1.68734 WP_003409301.1.68748 WP_003409301.1.68754 WP_003409301.1.6876 WP_003409301.1.68761 WP_003409301.1.68763 WP_003409301.1.68766 WP_003409301.1.68774 WP_003409301.1.68796 WP_003409301.1.68824 WP_003409301.1.68832 WP_003409301.1.68859 WP_003409301.1.68876 WP_003409301.1.68906 WP_003409301.1.68916 WP_003409301.1.68923 WP_003409301.1.68945 WP_003409301.1.6896 WP_003409301.1.68981 WP_003409301.1.68984 WP_003409301.1.68997 WP_003409301.1.69076 WP_003409301.1.69079 WP_003409301.1.6908 WP_003409301.1.69082 WP_003409301.1.69178 WP_003409301.1.69208 WP_003409301.1.69231 WP_003409301.1.69256 WP_003409301.1.69311 WP_003409301.1.69315 WP_003409301.1.69322 WP_003409301.1.69342 WP_003409301.1.6935 WP_003409301.1.6936 WP_003409301.1.69369 WP_003409301.1.69374 WP_003409301.1.69398 WP_003409301.1.69401 WP_003409301.1.69426 WP_003409301.1.69427 WP_003409301.1.69429 WP_003409301.1.6949 WP_003409301.1.6951 WP_003409301.1.69511 WP_003409301.1.69526 WP_003409301.1.69528 WP_003409301.1.69547 WP_003409301.1.69573 WP_003409301.1.69581 WP_003409301.1.6960 WP_003409301.1.69617 WP_003409301.1.69634 WP_003409301.1.69647 WP_003409301.1.69659 WP_003409301.1.69673 WP_003409301.1.69682 WP_003409301.1.69684 WP_003409301.1.69686 WP_003409301.1.69707 WP_003409301.1.69709 WP_003409301.1.69723 WP_003409301.1.69736 WP_003409301.1.69778 WP_003409301.1.69800 WP_003409301.1.69802 WP_003409301.1.69845 WP_003409301.1.69870 WP_003409301.1.69873 WP_003409301.1.69898 WP_003409301.1.69913 WP_003409301.1.69931 WP_003409301.1.69938 WP_003409301.1.69955 WP_003409301.1.69957 WP_003409301.1.69990 WP_003409301.1.70 WP_003409301.1.70000 WP_003409301.1.70017 WP_003409301.1.70032 WP_003409301.1.70055 WP_003409301.1.70062 WP_003409301.1.70072 WP_003409301.1.70131 WP_003409301.1.70132 WP_003409301.1.7022 WP_003409301.1.70227 WP_003409301.1.70255 WP_003409301.1.70271 WP_003409301.1.70274 WP_003409301.1.7029 WP_003409301.1.70325 WP_003409301.1.70328 WP_003409301.1.70356 WP_003409301.1.70364 WP_003409301.1.70368 WP_003409301.1.70369 WP_003409301.1.70418 WP_003409301.1.70422 WP_003409301.1.70435 WP_003409301.1.70444 WP_003409301.1.70463 WP_003409301.1.70471 WP_003409301.1.70480 WP_003409301.1.70494 WP_003409301.1.70498 WP_003409301.1.70525 WP_003409301.1.70573 WP_003409301.1.70577 WP_003409301.1.70610 WP_003409301.1.70615 WP_003409301.1.70618 WP_003409301.1.70622 WP_003409301.1.70626 WP_003409301.1.70668 WP_003409301.1.70699 WP_003409301.1.70704 WP_003409301.1.70729 WP_003409301.1.70757 WP_003409301.1.70782 WP_003409301.1.70796 WP_003409301.1.70834 WP_003409301.1.7084 WP_003409301.1.70840 WP_003409301.1.70864 WP_003409301.1.70871 WP_003409301.1.70915 WP_003409301.1.70958 WP_003409301.1.70964 WP_003409301.1.70976 WP_003409301.1.71015 WP_003409301.1.71063 WP_003409301.1.71076 WP_003409301.1.71083 WP_003409301.1.7111 WP_003409301.1.71118 WP_003409301.1.71128 WP_003409301.1.7113 WP_003409301.1.71187 WP_003409301.1.71191 WP_003409301.1.71255 WP_003409301.1.71258 WP_003409301.1.71259 WP_003409301.1.71289 WP_003409301.1.71326 WP_003409301.1.71329 WP_003409301.1.71331 WP_003409301.1.71344 WP_003409301.1.71390 WP_003409301.1.71399 WP_003409301.1.71414 WP_003409301.1.71440 WP_003409301.1.71457 WP_003409301.1.7146 WP_003409301.1.71464 WP_003409301.1.71490 WP_003409301.1.71492 WP_003409301.1.71509 WP_003409301.1.71516 WP_003409301.1.71517 WP_003409301.1.71527 WP_003409301.1.71532 WP_003409301.1.71545 WP_003409301.1.71546 WP_003409301.1.71569 WP_003409301.1.71604 WP_003409301.1.71630 WP_003409301.1.71638 WP_003409301.1.71654 WP_003409301.1.71664 WP_003409301.1.71665 WP_003409301.1.71683 WP_003409301.1.71701 WP_003409301.1.71718 WP_003409301.1.71731 WP_003409301.1.71778 WP_003409301.1.71781 WP_003409301.1.71803 WP_003409301.1.71847 WP_003409301.1.7185 WP_003409301.1.71851 WP_003409301.1.71871 WP_003409301.1.71909 WP_003409301.1.71957 WP_003409301.1.71970 WP_003409301.1.72047 WP_003409301.1.72061 WP_003409301.1.72062 WP_003409301.1.72072 WP_003409301.1.72111 WP_003409301.1.72122 WP_003409301.1.72143 WP_003409301.1.72168 WP_003409301.1.72179 WP_003409301.1.72209 WP_003409301.1.72227 WP_003409301.1.7224 WP_003409301.1.72268 WP_003409301.1.72332 WP_003409301.1.72380 WP_003409301.1.72401 WP_003409301.1.72405 WP_003409301.1.72420 WP_003409301.1.72441 WP_003409301.1.72451 WP_003409301.1.72452 WP_003409301.1.72457 WP_003409301.1.72459 WP_003409301.1.72460 WP_003409301.1.72466 WP_003409301.1.72487 WP_003409301.1.72488 WP_003409301.1.72492 WP_003409301.1.72543 WP_003409301.1.7256 WP_003409301.1.72576 WP_003409301.1.72578 WP_003409301.1.72585 WP_003409301.1.72591 WP_003409301.1.72592 WP_003409301.1.72640 WP_003409301.1.72661 WP_003409301.1.72739 WP_003409301.1.72744 WP_003409301.1.72755 WP_003409301.1.72759 WP_003409301.1.72784 WP_003409301.1.72792 WP_003409301.1.72826 WP_003409301.1.72831 WP_003409301.1.72852 WP_003409301.1.72853 WP_003409301.1.72879 WP_003409301.1.72880 WP_003409301.1.72938 WP_003409301.1.72954 WP_003409301.1.72957 WP_003409301.1.72959 WP_003409301.1.72982 WP_003409301.1.72988 WP_003409301.1.72993 WP_003409301.1.73006 WP_003409301.1.73013 WP_003409301.1.73025 WP_003409301.1.73028 WP_003409301.1.73042 WP_003409301.1.73045 WP_003409301.1.73092 WP_003409301.1.7312 WP_003409301.1.73127 WP_003409301.1.73134 WP_003409301.1.73154 WP_003409301.1.73163 WP_003409301.1.73182 WP_003409301.1.73205 WP_003409301.1.7321 WP_003409301.1.73310 WP_003409301.1.73365 WP_003409301.1.73391 WP_003409301.1.73404 WP_003409301.1.73436 WP_003409301.1.73445 WP_003409301.1.73453 WP_003409301.1.73465 WP_003409301.1.73466 WP_003409301.1.73470 WP_003409301.1.73471 WP_003409301.1.73478 WP_003409301.1.73482 WP_003409301.1.73532 WP_003409301.1.73550 WP_003409301.1.73564 WP_003409301.1.73623 WP_003409301.1.73629 WP_003409301.1.73644 WP_003409301.1.7366 WP_003409301.1.73661 WP_003409301.1.7368 WP_003409301.1.73688 WP_003409301.1.73723 WP_003409301.1.73744 WP_003409301.1.73750 WP_003409301.1.73760 WP_003409301.1.73774 WP_003409301.1.7379 WP_003409301.1.73813 WP_003409301.1.73840 WP_003409301.1.73876 WP_003409301.1.7389 WP_003409301.1.74016 WP_003409301.1.74039 WP_003409301.1.74083 WP_003409301.1.74101 WP_003409301.1.74107 WP_003409301.1.74129 WP_003409301.1.74144 WP_003409301.1.7417 WP_003409301.1.74190 WP_003409301.1.74210 WP_003409301.1.7423 WP_003409301.1.74259 WP_003409301.1.74262 WP_003409301.1.74269 WP_003409301.1.74282 WP_003409301.1.74291 WP_003409301.1.74296 WP_003409301.1.74304 WP_003409301.1.7432 WP_003409301.1.74347 WP_003409301.1.7436 WP_003409301.1.74378 WP_003409301.1.74382 WP_003409301.1.74395 WP_003409301.1.74400 WP_003409301.1.74432 WP_003409301.1.74442 WP_003409301.1.74487 WP_003409301.1.74499 WP_003409301.1.74504 WP_003409301.1.74511 WP_003409301.1.74523 WP_003409301.1.74525 WP_003409301.1.74551 WP_003409301.1.74555 WP_003409301.1.74628 WP_003409301.1.74641 WP_003409301.1.74653 WP_003409301.1.74660 WP_003409301.1.74683 WP_003409301.1.7469 WP_003409301.1.74725 WP_003409301.1.74760 WP_003409301.1.74809 WP_003409301.1.74820 WP_003409301.1.74870 WP_003409301.1.74881 WP_003409301.1.74952 WP_003409301.1.7496 WP_003409301.1.74988 WP_003409301.1.75043 WP_003409301.1.75045 WP_003409301.1.75055 WP_003409301.1.75078 WP_003409301.1.75081 WP_003409301.1.75120 WP_003409301.1.75188 WP_003409301.1.75202 WP_003409301.1.75234 WP_003409301.1.75239 WP_003409301.1.75263 WP_003409301.1.75342 WP_003409301.1.7535 WP_003409301.1.75376 WP_003409301.1.75391 WP_003409301.1.75395 WP_003409301.1.75441 WP_003409301.1.75510 WP_003409301.1.75581 WP_003409301.1.75598 WP_003409301.1.75635 WP_003409301.1.75665 WP_003409301.1.75671 WP_003409301.1.75741 WP_003409301.1.75749 WP_003409301.1.75772 WP_003409301.1.75774 WP_003409301.1.75833 WP_003409301.1.7585 WP_003409301.1.75864 WP_003409301.1.75868 WP_003409301.1.75878 WP_003409301.1.75927 WP_003409301.1.75946 WP_003409301.1.75968 WP_003409301.1.75974 WP_003409301.1.76016 WP_003409301.1.76032 WP_003409301.1.76037 WP_003409301.1.7604 WP_003409301.1.76045 WP_003409301.1.76052 WP_003409301.1.76058 WP_003409301.1.76064 WP_003409301.1.76110 WP_003409301.1.76126 WP_003409301.1.76133 WP_003409301.1.76138 WP_003409301.1.76157 WP_003409301.1.76172 WP_003409301.1.76177 WP_003409301.1.76183 WP_003409301.1.76209 WP_003409301.1.76239 WP_003409301.1.76272 WP_003409301.1.76277 WP_003409301.1.76281 WP_003409301.1.76291 WP_003409301.1.76297 WP_003409301.1.76360 WP_003409301.1.76379 WP_003409301.1.76403 WP_003409301.1.76413 WP_003409301.1.76414 WP_003409301.1.76427 WP_003409301.1.76436 WP_003409301.1.76442 WP_003409301.1.76443 WP_003409301.1.76456 WP_003409301.1.76533 WP_003409301.1.76616 WP_003409301.1.76625 WP_003409301.1.76629 WP_003409301.1.76635 WP_003409301.1.76638 WP_003409301.1.76640 WP_003409301.1.76644 WP_003409301.1.76677 WP_003409301.1.76678 WP_003409301.1.76679 WP_003409301.1.76734 WP_003409301.1.76744 WP_003409301.1.76750 WP_003409301.1.76754 WP_003409301.1.76757 WP_003409301.1.76781 WP_003409301.1.76824 WP_003409301.1.76835 WP_003409301.1.76873 WP_003409301.1.76888 WP_003409301.1.76900 WP_003409301.1.7691 WP_003409301.1.76947 WP_003409301.1.76954 WP_003409301.1.76963 WP_003409301.1.770 WP_003409301.1.77000 WP_003409301.1.77008 WP_003409301.1.77021 WP_003409301.1.77056 WP_003409301.1.77065 WP_003409301.1.77075 WP_003409301.1.77107 WP_003409301.1.77115 WP_003409301.1.77118 WP_003409301.1.77125 WP_003409301.1.77141 WP_003409301.1.77142 WP_003409301.1.77250 WP_003409301.1.77260 WP_003409301.1.77266 WP_003409301.1.77285 WP_003409301.1.77348 WP_003409301.1.77351 WP_003409301.1.77352 WP_003409301.1.77361 WP_003409301.1.774 WP_003409301.1.77404 WP_003409301.1.77425 WP_003409301.1.77463 WP_003409301.1.77474 WP_003409301.1.7748 WP_003409301.1.77484 WP_003409301.1.77491 WP_003409301.1.77499 WP_003409301.1.77510 WP_003409301.1.77530 WP_003409301.1.77554 WP_003409301.1.77559 WP_003409301.1.77599 WP_003409301.1.7762 WP_003409301.1.77627 WP_003409301.1.77649 WP_003409301.1.77654 WP_003409301.1.7766 WP_003409301.1.77667 WP_003409301.1.77704 WP_003409301.1.77706 WP_003409301.1.77774 WP_003409301.1.7778 WP_003409301.1.77790 WP_003409301.1.77820 WP_003409301.1.77843 WP_003409301.1.77855 WP_003409301.1.77865 WP_003409301.1.77868 WP_003409301.1.77890 WP_003409301.1.77911 WP_003409301.1.77931 WP_003409301.1.77984 WP_003409301.1.78020 WP_003409301.1.78024 WP_003409301.1.78075 WP_003409301.1.78086 WP_003409301.1.7809 WP_003409301.1.78098 WP_003409301.1.78105 WP_003409301.1.78113 WP_003409301.1.78136 WP_003409301.1.78162 WP_003409301.1.7817 WP_003409301.1.78200 WP_003409301.1.78216 WP_003409301.1.78236 WP_003409301.1.78238 WP_003409301.1.78322 WP_003409301.1.78338 WP_003409301.1.7836 WP_003409301.1.78360 WP_003409301.1.78386 WP_003409301.1.78435 WP_003409301.1.7844 WP_003409301.1.78459 WP_003409301.1.78488 WP_003409301.1.7849 WP_003409301.1.78499 WP_003409301.1.785 WP_003409301.1.78516 WP_003409301.1.78524 WP_003409301.1.78526 WP_003409301.1.78545 WP_003409301.1.78547 WP_003409301.1.78574 WP_003409301.1.78580 WP_003409301.1.7860 WP_003409301.1.78620 WP_003409301.1.78646 WP_003409301.1.78648 WP_003409301.1.78649 WP_003409301.1.78655 WP_003409301.1.78657 WP_003409301.1.78659 WP_003409301.1.7869 WP_003409301.1.78692 WP_003409301.1.78760 WP_003409301.1.78766 WP_003409301.1.78776 WP_003409301.1.78778 WP_003409301.1.78788 WP_003409301.1.78790 WP_003409301.1.78860 WP_003409301.1.7887 WP_003409301.1.78884 WP_003409301.1.78932 WP_003409301.1.78969 WP_003409301.1.78977 WP_003409301.1.78980 WP_003409301.1.79005 WP_003409301.1.79016 WP_003409301.1.79033 WP_003409301.1.79064 WP_003409301.1.79066 WP_003409301.1.79068 WP_003409301.1.79095 WP_003409301.1.79112 WP_003409301.1.79122 WP_003409301.1.79145 WP_003409301.1.79152 WP_003409301.1.79163 WP_003409301.1.79182 WP_003409301.1.79213 WP_003409301.1.79218 WP_003409301.1.79268 WP_003409301.1.79278 WP_003409301.1.79290 WP_003409301.1.79319 WP_003409301.1.79325 WP_003409301.1.79326 WP_003409301.1.7933 WP_003409301.1.79330 WP_003409301.1.79339 WP_003409301.1.79394 WP_003409301.1.79399 WP_003409301.1.79413 WP_003409301.1.79422 WP_003409301.1.79445 WP_003409301.1.79447 WP_003409301.1.79455 WP_003409301.1.79471 WP_003409301.1.79480 WP_003409301.1.79482 WP_003409301.1.79488 WP_003409301.1.79500 WP_003409301.1.79502 WP_003409301.1.79508 WP_003409301.1.79514 WP_003409301.1.79561 WP_003409301.1.79565 WP_003409301.1.79578 WP_003409301.1.79588 WP_003409301.1.79598 WP_003409301.1.79615 WP_003409301.1.79684 WP_003409301.1.79698 WP_003409301.1.797 WP_003409301.1.79744 WP_003409301.1.79784 WP_003409301.1.79806 WP_003409301.1.79819 WP_003409301.1.79826 WP_003409301.1.79828 WP_003409301.1.79851 WP_003409301.1.79853 WP_003409301.1.79863 WP_003409301.1.79881 WP_003409301.1.79885 WP_003409301.1.79898 WP_003409301.1.7990 WP_003409301.1.79900 WP_003409301.1.79913 WP_003409301.1.79918 WP_003409301.1.79947 WP_003409301.1.79948 WP_003409301.1.7995 WP_003409301.1.7997 WP_003409301.1.80004 WP_003409301.1.80022 WP_003409301.1.80030 WP_003409301.1.80054 WP_003409301.1.80084 WP_003409301.1.80099 WP_003409301.1.80129 WP_003409301.1.80177 WP_003409301.1.80234 WP_003409301.1.8026 WP_003409301.1.80275 WP_003409301.1.8029 WP_003409301.1.80299 WP_003409301.1.80304 WP_003409301.1.80326 WP_003409301.1.8037 WP_003409301.1.80370 WP_003409301.1.80387 WP_003409301.1.8044 WP_003409301.1.80451 WP_003409301.1.80458 WP_003409301.1.80461 WP_003409301.1.80490 WP_003409301.1.80503 WP_003409301.1.80507 WP_003409301.1.80552 WP_003409301.1.80576 WP_003409301.1.80588 WP_003409301.1.80599 WP_003409301.1.8060 WP_003409301.1.80624 WP_003409301.1.80636 WP_003409301.1.80673 WP_003409301.1.80711 WP_003409301.1.80714 WP_003409301.1.80743 WP_003409301.1.80784 WP_003409301.1.80815 WP_003409301.1.80853 WP_003409301.1.80918 WP_003409301.1.8093 WP_003409301.1.80967 WP_003409301.1.8097 WP_003409301.1.80988 WP_003409301.1.81007 WP_003409301.1.81013 WP_003409301.1.8105 WP_003409301.1.81059 WP_003409301.1.81063 WP_003409301.1.81066 WP_003409301.1.81075 WP_003409301.1.81091 WP_003409301.1.81119 WP_003409301.1.81125 WP_003409301.1.81136 WP_003409301.1.8114 WP_003409301.1.81189 WP_003409301.1.81192 WP_003409301.1.812 WP_003409301.1.81230 WP_003409301.1.81249 WP_003409301.1.81250 WP_003409301.1.81264 WP_003409301.1.81287 WP_003409301.1.81297 WP_003409301.1.8138 WP_003409301.1.81407 WP_003409301.1.8143 WP_003409301.1.81439 WP_003409301.1.81465 WP_003409301.1.81529 WP_003409301.1.81538 WP_003409301.1.81541 WP_003409301.1.81560 WP_003409301.1.81561 WP_003409301.1.81567 WP_003409301.1.81583 WP_003409301.1.81686 WP_003409301.1.81712 WP_003409301.1.81720 WP_003409301.1.81731 WP_003409301.1.81774 WP_003409301.1.81788 WP_003409301.1.81820 WP_003409301.1.81850 WP_003409301.1.81883 WP_003409301.1.81891 WP_003409301.1.81911 WP_003409301.1.81918 WP_003409301.1.82011 WP_003409301.1.82048 WP_003409301.1.82069 WP_003409301.1.82071 WP_003409301.1.82108 WP_003409301.1.82136 WP_003409301.1.82142 WP_003409301.1.8215 WP_003409301.1.82158 WP_003409301.1.82209 WP_003409301.1.82210 WP_003409301.1.82228 WP_003409301.1.82236 WP_003409301.1.82251 WP_003409301.1.82271 WP_003409301.1.82305 WP_003409301.1.82307 WP_003409301.1.82309 WP_003409301.1.82317 WP_003409301.1.8232 WP_003409301.1.82346 WP_003409301.1.82374 WP_003409301.1.82385 WP_003409301.1.82429 WP_003409301.1.82460 WP_003409301.1.82483 WP_003409301.1.82494 WP_003409301.1.82531 WP_003409301.1.82546 WP_003409301.1.82547 WP_003409301.1.82549 WP_003409301.1.82577 WP_003409301.1.82592 WP_003409301.1.82597 WP_003409301.1.82598 WP_003409301.1.82625 WP_003409301.1.82642 WP_003409301.1.82651 WP_003409301.1.82653 WP_003409301.1.82681 WP_003409301.1.82685 WP_003409301.1.8271 WP_003409301.1.82712 WP_003409301.1.8273 WP_003409301.1.82743 WP_003409301.1.82757 WP_003409301.1.82774 WP_003409301.1.82803 WP_003409301.1.82836 WP_003409301.1.82860 WP_003409301.1.82871 WP_003409301.1.82892 WP_003409301.1.82935 WP_003409301.1.82957 WP_003409301.1.82981 WP_003409301.1.82983 WP_003409301.1.83004 WP_003409301.1.83009 WP_003409301.1.83044 WP_003409301.1.83065 WP_003409301.1.83074 WP_003409301.1.83146 WP_003409301.1.83149 WP_003409301.1.83159 WP_003409301.1.8317 WP_003409301.1.83173 WP_003409301.1.83181 WP_003409301.1.83182 WP_003409301.1.83191 WP_003409301.1.83197 WP_003409301.1.83212 WP_003409301.1.8326 WP_003409301.1.83262 WP_003409301.1.83273 WP_003409301.1.83309 WP_003409301.1.83332 WP_003409301.1.83334 WP_003409301.1.83341 WP_003409301.1.83349 WP_003409301.1.8335 WP_003409301.1.83353 WP_003409301.1.83367 WP_003409301.1.83380 WP_003409301.1.83381 WP_003409301.1.83389 WP_003409301.1.83408 WP_003409301.1.83409 WP_003409301.1.83435 WP_003409301.1.83470 WP_003409301.1.83524 WP_003409301.1.83526 WP_003409301.1.83589 WP_003409301.1.83601 WP_003409301.1.83611 WP_003409301.1.83638 WP_003409301.1.83656 WP_003409301.1.83667 WP_003409301.1.83689 WP_003409301.1.83692 WP_003409301.1.83705 WP_003409301.1.83766 WP_003409301.1.83793 WP_003409301.1.83794 WP_003409301.1.83802 WP_003409301.1.83805 WP_003409301.1.83839 WP_003409301.1.83850 WP_003409301.1.83861 WP_003409301.1.83884 WP_003409301.1.83920 WP_003409301.1.83929 WP_003409301.1.83930 WP_003409301.1.83975 WP_003409301.1.83991 WP_003409301.1.8400 WP_003409301.1.84027 WP_003409301.1.8404 WP_003409301.1.84057 WP_003409301.1.84070 WP_003409301.1.8409 WP_003409301.1.84112 WP_003409301.1.84146 WP_003409301.1.8415 WP_003409301.1.84176 WP_003409301.1.84192 WP_003409301.1.84228 WP_003409301.1.8424 WP_003409301.1.84244 WP_003409301.1.84259 WP_003409301.1.8426 WP_003409301.1.84277 WP_003409301.1.84287 WP_003409301.1.8434 WP_003409301.1.84388 WP_003409301.1.84409 WP_003409301.1.84438 WP_003409301.1.84460 WP_003409301.1.84488 WP_003409301.1.84504 WP_003409301.1.84525 WP_003409301.1.84620 WP_003409301.1.84641 WP_003409301.1.84655 WP_003409301.1.84666 WP_003409301.1.84670 WP_003409301.1.84739 WP_003409301.1.84748 WP_003409301.1.84766 WP_003409301.1.84772 WP_003409301.1.84774 WP_003409301.1.848 WP_003409301.1.84812 WP_003409301.1.84836 WP_003409301.1.84839 WP_003409301.1.84846 WP_003409301.1.84873 WP_003409301.1.84938 WP_003409301.1.84973 WP_003409301.1.84981 WP_003409301.1.84985 WP_003409301.1.8503 WP_003409301.1.85038 WP_003409301.1.85043 WP_003409301.1.8505 WP_003409301.1.85074 WP_003409301.1.8509 WP_003409301.1.8512 WP_003409301.1.85148 WP_003409301.1.8518 WP_003409301.1.8522 WP_003409301.1.85242 WP_003409301.1.85276 WP_003409301.1.85281 WP_003409301.1.85284 WP_003409301.1.85314 WP_003409301.1.85319 WP_003409301.1.85330 WP_003409301.1.85341 WP_003409301.1.8535 WP_003409301.1.85363 WP_003409301.1.85371 WP_003409301.1.85377 WP_003409301.1.85387 WP_003409301.1.85399 WP_003409301.1.85458 WP_003409301.1.8546 WP_003409301.1.85478 WP_003409301.1.85480 WP_003409301.1.85488 WP_003409301.1.85495 WP_003409301.1.85551 WP_003409301.1.85557 WP_003409301.1.85577 WP_003409301.1.85599 WP_003409301.1.85610 WP_003409301.1.8563 WP_003409301.1.85648 WP_003409301.1.85679 WP_003409301.1.85704 WP_003409301.1.85717 WP_003409301.1.85727 WP_003409301.1.85737 WP_003409301.1.85763 WP_003409301.1.85808 WP_003409301.1.85819 WP_003409301.1.85820 WP_003409301.1.85823 WP_003409301.1.85832 WP_003409301.1.8586 WP_003409301.1.85872 WP_003409301.1.85894 WP_003409301.1.85909 WP_003409301.1.85913 WP_003409301.1.85953 WP_003409301.1.85986 WP_003409301.1.86000 WP_003409301.1.86025 WP_003409301.1.86032 WP_003409301.1.86048 WP_003409301.1.86052 WP_003409301.1.86067 WP_003409301.1.86103 WP_003409301.1.86122 WP_003409301.1.86124 WP_003409301.1.86160 WP_003409301.1.86164 WP_003409301.1.86168 WP_003409301.1.86190 WP_003409301.1.86204 WP_003409301.1.86208 WP_003409301.1.86235 WP_003409301.1.86249 WP_003409301.1.86260 WP_003409301.1.86290 WP_003409301.1.863 WP_003409301.1.86327 WP_003409301.1.86334 WP_003409301.1.86337 WP_003409301.1.86368 WP_003409301.1.86377 WP_003409301.1.86425 WP_003409301.1.86459 WP_003409301.1.8649 WP_003409301.1.86499 WP_003409301.1.86561 WP_003409301.1.86568 WP_003409301.1.86575 WP_003409301.1.86584 WP_003409301.1.86605 WP_003409301.1.86648 WP_003409301.1.86684 WP_003409301.1.86696 WP_003409301.1.86705 WP_003409301.1.86718 WP_003409301.1.86725 WP_003409301.1.86757 WP_003409301.1.86766 WP_003409301.1.86801 WP_003409301.1.86814 WP_003409301.1.86820 WP_003409301.1.86825 WP_003409301.1.86834 WP_003409301.1.8685 WP_003409301.1.86851 WP_003409301.1.86855 WP_003409301.1.86867 WP_003409301.1.86877 WP_003409301.1.86883 WP_003409301.1.8689 WP_003409301.1.86892 WP_003409301.1.86933 WP_003409301.1.86941 WP_003409301.1.86950 WP_003409301.1.86962 WP_003409301.1.86963 WP_003409301.1.86979 WP_003409301.1.8700 WP_003409301.1.87002 WP_003409301.1.87031 WP_003409301.1.87116 WP_003409301.1.87117 WP_003409301.1.8714 WP_003409301.1.87162 WP_003409301.1.87178 WP_003409301.1.87191 WP_003409301.1.87201 WP_003409301.1.87209 WP_003409301.1.87240 WP_003409301.1.87266 WP_003409301.1.87273 WP_003409301.1.87275 WP_003409301.1.8733 WP_003409301.1.87345 WP_003409301.1.8737 WP_003409301.1.87401 WP_003409301.1.87409 WP_003409301.1.87444 WP_003409301.1.87446 WP_003409301.1.87459 WP_003409301.1.87472 WP_003409301.1.87489 WP_003409301.1.87494 WP_003409301.1.87496 WP_003409301.1.87582 WP_003409301.1.87588 WP_003409301.1.87619 WP_003409301.1.87620 WP_003409301.1.87634 WP_003409301.1.87643 WP_003409301.1.8765 WP_003409301.1.87650 WP_003409301.1.87654 WP_003409301.1.87658 WP_003409301.1.87665 WP_003409301.1.87676 WP_003409301.1.87677 WP_003409301.1.87684 WP_003409301.1.87692 WP_003409301.1.87707 WP_003409301.1.87732 WP_003409301.1.87784 WP_003409301.1.87796 WP_003409301.1.87809 WP_003409301.1.87827 WP_003409301.1.87831 WP_003409301.1.87835 WP_003409301.1.87837 WP_003409301.1.87866 WP_003409301.1.8789 WP_003409301.1.87911 WP_003409301.1.87924 WP_003409301.1.87951 WP_003409301.1.87956 WP_003409301.1.87991 WP_003409301.1.88 WP_003409301.1.88002 WP_003409301.1.88037 WP_003409301.1.88039 WP_003409301.1.88077 WP_003409301.1.88121 WP_003409301.1.88191 WP_003409301.1.88205 WP_003409301.1.88217 WP_003409301.1.88219 WP_003409301.1.88245 WP_003409301.1.88253 WP_003409301.1.88294 WP_003409301.1.88315 WP_003409301.1.88316 WP_003409301.1.88320 WP_003409301.1.88338 WP_003409301.1.8840 WP_003409301.1.88437 WP_003409301.1.88453 WP_003409301.1.88469 WP_003409301.1.88489 WP_003409301.1.88507 WP_003409301.1.88530 WP_003409301.1.88537 WP_003409301.1.88541 WP_003409301.1.88592 WP_003409301.1.88616 WP_003409301.1.88618 WP_003409301.1.8862 WP_003409301.1.88625 WP_003409301.1.88632 WP_003409301.1.88634 WP_003409301.1.88649 WP_003409301.1.8870 WP_003409301.1.88737 WP_003409301.1.88756 WP_003409301.1.888 WP_003409301.1.88824 WP_003409301.1.88886 WP_003409301.1.88965 WP_003409301.1.88985 WP_003409301.1.8902 WP_003409301.1.89025 WP_003409301.1.89041 WP_003409301.1.89046 WP_003409301.1.89082 WP_003409301.1.89162 WP_003409301.1.89168 WP_003409301.1.8917 WP_003409301.1.89205 WP_003409301.1.89207 WP_003409301.1.89225 WP_003409301.1.8925 WP_003409301.1.89277 WP_003409301.1.89286 WP_003409301.1.89293 WP_003409301.1.89320 WP_003409301.1.8935 WP_003409301.1.89371 WP_003409301.1.89378 WP_003409301.1.89392 WP_003409301.1.89406 WP_003409301.1.89451 WP_003409301.1.89453 WP_003409301.1.89473 WP_003409301.1.89475 WP_003409301.1.895 WP_003409301.1.89513 WP_003409301.1.89517 WP_003409301.1.89522 WP_003409301.1.8954 WP_003409301.1.89543 WP_003409301.1.8957 WP_003409301.1.89572 WP_003409301.1.89589 WP_003409301.1.89607 WP_003409301.1.89613 WP_003409301.1.89625 WP_003409301.1.89648 WP_003409301.1.8967 WP_003409301.1.89670 WP_003409301.1.89676 WP_003409301.1.89729 WP_003409301.1.89762 WP_003409301.1.8977 WP_003409301.1.89808 WP_003409301.1.8982 WP_003409301.1.89829 WP_003409301.1.89831 WP_003409301.1.89844 WP_003409301.1.89849 WP_003409301.1.8989 WP_003409301.1.89901 WP_003409301.1.89903 WP_003409301.1.89909 WP_003409301.1.89922 WP_003409301.1.89926 WP_003409301.1.89963 WP_003409301.1.89971 WP_003409301.1.8998 WP_003409301.1.89987 WP_003409301.1.900 WP_003409301.1.90048 WP_003409301.1.9007 WP_003409301.1.90080 WP_003409301.1.90130 WP_003409301.1.90134 WP_003409301.1.90137 WP_003409301.1.90157 WP_003409301.1.90184 WP_003409301.1.90199 WP_003409301.1.90231 WP_003409301.1.90245 WP_003409301.1.90308 WP_003409301.1.90322 WP_003409301.1.90328 WP_003409301.1.90372 WP_003409301.1.90481 WP_003409301.1.90499 WP_003409301.1.9050 WP_003409301.1.90527 WP_003409301.1.90560 WP_003409301.1.90612 WP_003409301.1.90640 WP_003409301.1.90672 WP_003409301.1.90687 WP_003409301.1.90691 WP_003409301.1.90711 WP_003409301.1.90722 WP_003409301.1.90744 WP_003409301.1.9075 WP_003409301.1.90756 WP_003409301.1.90767 WP_003409301.1.90771 WP_003409301.1.90785 WP_003409301.1.90788 WP_003409301.1.90800 WP_003409301.1.90810 WP_003409301.1.90816 WP_003409301.1.90819 WP_003409301.1.9082 WP_003409301.1.90831 WP_003409301.1.90884 WP_003409301.1.90899 WP_003409301.1.90906 WP_003409301.1.90958 WP_003409301.1.90976 WP_003409301.1.90977 WP_003409301.1.90987 WP_003409301.1.9102 WP_003409301.1.91026 WP_003409301.1.91032 WP_003409301.1.91053 WP_003409301.1.91082 WP_003409301.1.91106 WP_003409301.1.91112 WP_003409301.1.91144 WP_003409301.1.91151 WP_003409301.1.91157 WP_003409301.1.91167 WP_003409301.1.91169 WP_003409301.1.91192 WP_003409301.1.91201 WP_003409301.1.91207 WP_003409301.1.91208 WP_003409301.1.91211 WP_003409301.1.91214 WP_003409301.1.91230 WP_003409301.1.91244 WP_003409301.1.91251 WP_003409301.1.91260 WP_003409301.1.91284 WP_003409301.1.91303 WP_003409301.1.91322 WP_003409301.1.91386 WP_003409301.1.9139 WP_003409301.1.91398 WP_003409301.1.91430 WP_003409301.1.91436 WP_003409301.1.91483 WP_003409301.1.91496 WP_003409301.1.91507 WP_003409301.1.91576 WP_003409301.1.91589 WP_003409301.1.91694 WP_003409301.1.91695 WP_003409301.1.91716 WP_003409301.1.91717 WP_003409301.1.91728 WP_003409301.1.91743 WP_003409301.1.91759 WP_003409301.1.91784 WP_003409301.1.91785 WP_003409301.1.91786 WP_003409301.1.91802 WP_003409301.1.91822 WP_003409301.1.91828 WP_003409301.1.9189 WP_003409301.1.91896 WP_003409301.1.9190 WP_003409301.1.91915 WP_003409301.1.91931 WP_003409301.1.91937 WP_003409301.1.91944 WP_003409301.1.91953 WP_003409301.1.91957 WP_003409301.1.91976 WP_003409301.1.92083 WP_003409301.1.92127 WP_003409301.1.92144 WP_003409301.1.92150 WP_003409301.1.92153 WP_003409301.1.92190 WP_003409301.1.92192 WP_003409301.1.92200 WP_003409301.1.92220 WP_003409301.1.92221 WP_003409301.1.92222 WP_003409301.1.92273 WP_003409301.1.92289 WP_003409301.1.9229 WP_003409301.1.92294 WP_003409301.1.92300 WP_003409301.1.92317 WP_003409301.1.92334 WP_003409301.1.92345 WP_003409301.1.92356 WP_003409301.1.92364 WP_003409301.1.92380 WP_003409301.1.92416 WP_003409301.1.92428 WP_003409301.1.92447 WP_003409301.1.92456 WP_003409301.1.92467 WP_003409301.1.92471 WP_003409301.1.92490 WP_003409301.1.92508 WP_003409301.1.9251 WP_003409301.1.92511 WP_003409301.1.92523 WP_003409301.1.92527 WP_003409301.1.92536 WP_003409301.1.92592 WP_003409301.1.92597 WP_003409301.1.92603 WP_003409301.1.92606 WP_003409301.1.92610 WP_003409301.1.92613 WP_003409301.1.9263 WP_003409301.1.9265 WP_003409301.1.92650 WP_003409301.1.92660 WP_003409301.1.92677 WP_003409301.1.92685 WP_003409301.1.92689 WP_003409301.1.92690 WP_003409301.1.92706 WP_003409301.1.92714 WP_003409301.1.92736 WP_003409301.1.9274 WP_003409301.1.92752 WP_003409301.1.92760 WP_003409301.1.92777 WP_003409301.1.92803 WP_003409301.1.92833 WP_003409301.1.92856 WP_003409301.1.92881 WP_003409301.1.92892 WP_003409301.1.92907 WP_003409301.1.92908 WP_003409301.1.92917 WP_003409301.1.92996 WP_003409301.1.93006 WP_003409301.1.93009 WP_003409301.1.93015 WP_003409301.1.93043 WP_003409301.1.9307 WP_003409301.1.93083 WP_003409301.1.93097 WP_003409301.1.93137 WP_003409301.1.93192 WP_003409301.1.93199 WP_003409301.1.93212 WP_003409301.1.93234 WP_003409301.1.93245 WP_003409301.1.93257 WP_003409301.1.93265 WP_003409301.1.93297 WP_003409301.1.93320 WP_003409301.1.93328 WP_003409301.1.93337 WP_003409301.1.93343 WP_003409301.1.93349 WP_003409301.1.93363 WP_003409301.1.93377 WP_003409301.1.9338 WP_003409301.1.93407 WP_003409301.1.93417 WP_003409301.1.93419 WP_003409301.1.93426 WP_003409301.1.9344 WP_003409301.1.93443 WP_003409301.1.93447 WP_003409301.1.93470 WP_003409301.1.93487 WP_003409301.1.93495 WP_003409301.1.93499 WP_003409301.1.93516 WP_003409301.1.93536 WP_003409301.1.93544 WP_003409301.1.93555 WP_003409301.1.93560 WP_003409301.1.93564 WP_003409301.1.9357 WP_003409301.1.93573 WP_003409301.1.93576 WP_003409301.1.93588 WP_003409301.1.9363 WP_003409301.1.93645 WP_003409301.1.93649 WP_003409301.1.93659 WP_003409301.1.93677 WP_003409301.1.9368 WP_003409301.1.93689 WP_003409301.1.93693 WP_003409301.1.93698 WP_003409301.1.93706 WP_003409301.1.9371 WP_003409301.1.93792 WP_003409301.1.93823 WP_003409301.1.93871 WP_003409301.1.9388 WP_003409301.1.93894 WP_003409301.1.93903 WP_003409301.1.93907 WP_003409301.1.93913 WP_003409301.1.93946 WP_003409301.1.93953 WP_003409301.1.93954 WP_003409301.1.93988 WP_003409301.1.9407 WP_003409301.1.94143 WP_003409301.1.94154 WP_003409301.1.94184 WP_003409301.1.94204 WP_003409301.1.94205 WP_003409301.1.94226 WP_003409301.1.94231 WP_003409301.1.94256 WP_003409301.1.94261 WP_003409301.1.94281 WP_003409301.1.94292 WP_003409301.1.94297 WP_003409301.1.9431 WP_003409301.1.94326 WP_003409301.1.94339 WP_003409301.1.94392 WP_003409301.1.94416 WP_003409301.1.94421 WP_003409301.1.94456 WP_003409301.1.94470 WP_003409301.1.94480 WP_003409301.1.94495 WP_003409301.1.94511 WP_003409301.1.94512 WP_003409301.1.94525 WP_003409301.1.94528 WP_003409301.1.94564 WP_003409301.1.946 WP_003409301.1.94623 WP_003409301.1.94629 WP_003409301.1.9465 WP_003409301.1.94673 WP_003409301.1.94714 WP_003409301.1.94730 WP_003409301.1.94736 WP_003409301.1.94776 WP_003409301.1.9478 WP_003409301.1.94834 WP_003409301.1.94852 WP_003409301.1.94872 WP_003409301.1.9488 WP_003409301.1.94902 WP_003409301.1.94979 WP_003409301.1.94994 WP_003409301.1.94996 WP_003409301.1.94998 WP_003409301.1.95007 WP_003409301.1.95010 WP_003409301.1.95015 WP_003409301.1.95034 WP_003409301.1.95068 WP_003409301.1.95081 WP_003409301.1.95082 WP_003409301.1.9509 WP_003409301.1.95096 WP_003409301.1.95112 WP_003409301.1.95138 WP_003409301.1.9514 WP_003409301.1.95179 WP_003409301.1.95188 WP_003409301.1.95190 WP_003409301.1.95234 WP_003409301.1.95241 WP_003409301.1.95245 WP_003409301.1.95257 WP_003409301.1.95279 WP_003409301.1.9531 WP_003409301.1.95335 WP_003409301.1.95344 WP_003409301.1.9535 WP_003409301.1.95370 WP_003409301.1.95392 WP_003409301.1.95416 WP_003409301.1.95417 WP_003409301.1.95454 WP_003409301.1.95455 WP_003409301.1.95491 WP_003409301.1.95497 WP_003409301.1.95508 WP_003409301.1.95509 WP_003409301.1.95529 WP_003409301.1.95556 WP_003409301.1.95557 WP_003409301.1.95565 WP_003409301.1.95578 WP_003409301.1.95580 WP_003409301.1.95643 WP_003409301.1.95679 WP_003409301.1.95685 WP_003409301.1.957 WP_003409301.1.95724 WP_003409301.1.95727 WP_003409301.1.95730 WP_003409301.1.95735 WP_003409301.1.95758 WP_003409301.1.95772 WP_003409301.1.95797 WP_003409301.1.95839 WP_003409301.1.9585 WP_003409301.1.9590 WP_003409301.1.95902 WP_003409301.1.95926 WP_003409301.1.95953 WP_003409301.1.95958 WP_003409301.1.95964 WP_003409301.1.95973 WP_003409301.1.96006 WP_003409301.1.9602 WP_003409301.1.96036 WP_003409301.1.96062 WP_003409301.1.96065 WP_003409301.1.96098 WP_003409301.1.96146 WP_003409301.1.96171 WP_003409301.1.96182 WP_003409301.1.96230 WP_003409301.1.96242 WP_003409301.1.96245 WP_003409301.1.96254 WP_003409301.1.96259 WP_003409301.1.96286 WP_003409301.1.96313 WP_003409301.1.96318 WP_003409301.1.96345 WP_003409301.1.96360 WP_003409301.1.96373 WP_003409301.1.96456 WP_003409301.1.96486 WP_003409301.1.96560 WP_003409301.1.96569 WP_003409301.1.96573 WP_003409301.1.96576 WP_003409301.1.96611 WP_003409301.1.96621 WP_003409301.1.9667 WP_003409301.1.96681 WP_003409301.1.96726 WP_003409301.1.96733 WP_003409301.1.96742 WP_003409301.1.96754 WP_003409301.1.9678 WP_003409301.1.96832 WP_003409301.1.9685 WP_003409301.1.97008 WP_003409301.1.97009 WP_003409301.1.97056 WP_003409301.1.97084 WP_003409301.1.97087 WP_003409301.1.97094 WP_003409301.1.97096 WP_003409301.1.97099 WP_003409301.1.97108 WP_003409301.1.97113 WP_003409301.1.97122 WP_003409301.1.97129 WP_003409301.1.97136 WP_003409301.1.9716 WP_003409301.1.97176 WP_003409301.1.97222 WP_003409301.1.97237 WP_003409301.1.97242 WP_003409301.1.97270 WP_003409301.1.97283 WP_003409301.1.97296 WP_003409301.1.97321 WP_003409301.1.97325 WP_003409301.1.97366 WP_003409301.1.97376 WP_003409301.1.97380 WP_003409301.1.97462 WP_003409301.1.97517 WP_003409301.1.97519 WP_003409301.1.97535 WP_003409301.1.97540 WP_003409301.1.97545 WP_003409301.1.97546 WP_003409301.1.97550 WP_003409301.1.97577 WP_003409301.1.97584 WP_003409301.1.9759 WP_003409301.1.97591 WP_003409301.1.97609 WP_003409301.1.97618 WP_003409301.1.9763 WP_003409301.1.97669 WP_003409301.1.97673 WP_003409301.1.97700 WP_003409301.1.97701 WP_003409301.1.9773 WP_003409301.1.97730 WP_003409301.1.97740 WP_003409301.1.97751 WP_003409301.1.97754 WP_003409301.1.97797 WP_003409301.1.9782 WP_003409301.1.9784 WP_003409301.1.97888 WP_003409301.1.9790 WP_003409301.1.9795 WP_003409301.1.97951 WP_003409301.1.97966 WP_003409301.1.97977 WP_003409301.1.97979 WP_003409301.1.97995 WP_003409301.1.98018 WP_003409301.1.98034 WP_003409301.1.98052 WP_003409301.1.98071 WP_003409301.1.98072 WP_003409301.1.98113 WP_003409301.1.98114 WP_003409301.1.98128 WP_003409301.1.98188 WP_003409301.1.98189 WP_003409301.1.98213 WP_003409301.1.98225 WP_003409301.1.98291 WP_003409301.1.98335 WP_003409301.1.98350 WP_003409301.1.98395 WP_003409301.1.98412 WP_003409301.1.98441 WP_003409301.1.98443 WP_003409301.1.98462 WP_003409301.1.9848 WP_003409301.1.98482 WP_003409301.1.98486 WP_003409301.1.98488 WP_003409301.1.98503 WP_003409301.1.98516 WP_003409301.1.98536 WP_003409301.1.98541 WP_003409301.1.98566 WP_003409301.1.98576 WP_003409301.1.98590 WP_003409301.1.98594 WP_003409301.1.98599 WP_003409301.1.98629 WP_003409301.1.98645 WP_003409301.1.98646 WP_003409301.1.98649 WP_003409301.1.98656 WP_003409301.1.9867 WP_003409301.1.98674 WP_003409301.1.98697 WP_003409301.1.98701 WP_003409301.1.98739 WP_003409301.1.98749 WP_003409301.1.98770 WP_003409301.1.98777 WP_003409301.1.98778 WP_003409301.1.98906 WP_003409301.1.98935 WP_003409301.1.98948 WP_003409301.1.98953 WP_003409301.1.98984 WP_003409301.1.99000 WP_003409301.1.99023 WP_003409301.1.99030 WP_003409301.1.99055 WP_003409301.1.99062 WP_003409301.1.99086 WP_003409301.1.99115 WP_003409301.1.99161 WP_003409301.1.99176 WP_003409301.1.99211 WP_003409301.1.99216 WP_003409301.1.99222 WP_003409301.1.99251 WP_003409301.1.99294 WP_003409301.1.99312 WP_003409301.1.99315 WP_003409301.1.99316 WP_003409301.1.99322 WP_003409301.1.99328 WP_003409301.1.99365 WP_003409301.1.99368 WP_003409301.1.99379 WP_003409301.1.99396 WP_003409301.1.99402 WP_003409301.1.99419 WP_003409301.1.99438 WP_003409301.1.99460 WP_003409301.1.99468 WP_003409301.1.99473 WP_003409301.1.99513 WP_003409301.1.99529 WP_003409301.1.99548 WP_003409301.1.99572 WP_003409301.1.99575 WP_003409301.1.99605 WP_003409301.1.99609 WP_003409301.1.99617 WP_003409301.1.99635 WP_003409301.1.99650 WP_003409301.1.99672 WP_003409301.1.99701 WP_003409301.1.99711 WP_003409301.1.99740 WP_003409301.1.99745 WP_003409301.1.99749 WP_003409301.1.9976 WP_003409301.1.99798 WP_003409301.1.99817 WP_003409301.1.99847 WP_003409301.1.99852 WP_003409301.1.99886 WP_003409301.1.99897 WP_003409301.1.99899 WP_003409301.1.99915 WP_003409301.1.99991 gi|479314760|ref|YP_007854812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]