SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740547|ref|YP_002161861.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740547|ref|YP_002161861.1|
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-32
Family FUR-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197740547|ref|YP_002161861.1|
Sequence length 150
Comment ferric uptake regulation protein FurA [Mycobacterium tuberculosis str. Haarlem]
Sequence
MSSVSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVY
DVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASD
HNGFLLDEAEVIYWGLCPDCSISDTSRSHP
Download sequence
Identical sequences A0A109SNK6 A0A120J1C9 A0A243R1Q5 A5U3S8 F8MA52 G0TLH3 M8CMF6 Q4TUX5 R4MIT5
gi|525674569|ref|YP_008226012.1| gi|383307728|ref|YP_005360539.1| gi|392386565|ref|YP_005308194.1| gi|197740547|ref|YP_002161861.1| gi|479055867|ref|YP_007351673.1| Rv1909c gi|253799044|ref|YP_003032045.1| gi|433627005|ref|YP_007260634.1| gi|494696280|ref|YP_007961783.1| gi|375296294|ref|YP_005100561.1| gi|386004859|ref|YP_005923138.1| 233413.Mb1944c 336982.TBFG_11938 419947.MRA_1920 478434.TBMG_02083 83331.MT1960 83332.Rv1909c gi|479314824|ref|YP_007854876.1| WP_003409564.1.100000 WP_003409564.1.100021 WP_003409564.1.100069 WP_003409564.1.100087 WP_003409564.1.10015 WP_003409564.1.100208 WP_003409564.1.100216 WP_003409564.1.10022 WP_003409564.1.100255 WP_003409564.1.100260 WP_003409564.1.100270 WP_003409564.1.100279 WP_003409564.1.100286 WP_003409564.1.100308 WP_003409564.1.100309 WP_003409564.1.100318 WP_003409564.1.100337 WP_003409564.1.100338 WP_003409564.1.10037 WP_003409564.1.100383 WP_003409564.1.100395 WP_003409564.1.100396 WP_003409564.1.1004 WP_003409564.1.100401 WP_003409564.1.100459 WP_003409564.1.100460 WP_003409564.1.100552 WP_003409564.1.100581 WP_003409564.1.100600 WP_003409564.1.100625 WP_003409564.1.10064 WP_003409564.1.100666 WP_003409564.1.100671 WP_003409564.1.100677 WP_003409564.1.100682 WP_003409564.1.100697 WP_003409564.1.100703 WP_003409564.1.100716 WP_003409564.1.100722 WP_003409564.1.100754 WP_003409564.1.100757 WP_003409564.1.100772 WP_003409564.1.1008 WP_003409564.1.100812 WP_003409564.1.100845 WP_003409564.1.100866 WP_003409564.1.10088 WP_003409564.1.100889 WP_003409564.1.10090 WP_003409564.1.100910 WP_003409564.1.100915 WP_003409564.1.100918 WP_003409564.1.100935 WP_003409564.1.100984 WP_003409564.1.100992 WP_003409564.1.100998 WP_003409564.1.101 WP_003409564.1.101025 WP_003409564.1.101028 WP_003409564.1.10104 WP_003409564.1.101048 WP_003409564.1.101054 WP_003409564.1.101075 WP_003409564.1.101143 WP_003409564.1.101146 WP_003409564.1.10116 WP_003409564.1.10117 WP_003409564.1.101209 WP_003409564.1.10125 WP_003409564.1.101290 WP_003409564.1.101323 WP_003409564.1.101324 WP_003409564.1.101350 WP_003409564.1.101367 WP_003409564.1.101398 WP_003409564.1.101403 WP_003409564.1.101421 WP_003409564.1.10144 WP_003409564.1.101442 WP_003409564.1.10145 WP_003409564.1.101456 WP_003409564.1.101481 WP_003409564.1.101493 WP_003409564.1.101496 WP_003409564.1.101533 WP_003409564.1.101535 WP_003409564.1.101553 WP_003409564.1.101558 WP_003409564.1.10156 WP_003409564.1.101573 WP_003409564.1.101576 WP_003409564.1.10159 WP_003409564.1.101592 WP_003409564.1.101604 WP_003409564.1.101607 WP_003409564.1.101622 WP_003409564.1.101644 WP_003409564.1.101659 WP_003409564.1.101671 WP_003409564.1.101687 WP_003409564.1.101698 WP_003409564.1.10170 WP_003409564.1.101713 WP_003409564.1.101722 WP_003409564.1.101733 WP_003409564.1.101743 WP_003409564.1.101753 WP_003409564.1.101754 WP_003409564.1.101764 WP_003409564.1.101773 WP_003409564.1.101795 WP_003409564.1.101797 WP_003409564.1.101798 WP_003409564.1.101802 WP_003409564.1.101826 WP_003409564.1.101836 WP_003409564.1.101858 WP_003409564.1.101859 WP_003409564.1.101862 WP_003409564.1.101888 WP_003409564.1.101894 WP_003409564.1.101899 WP_003409564.1.1019 WP_003409564.1.101923 WP_003409564.1.101925 WP_003409564.1.10193 WP_003409564.1.101996 WP_003409564.1.102 WP_003409564.1.102008 WP_003409564.1.102017 WP_003409564.1.102053 WP_003409564.1.102055 WP_003409564.1.102063 WP_003409564.1.102099 WP_003409564.1.1021 WP_003409564.1.10211 WP_003409564.1.102119 WP_003409564.1.102121 WP_003409564.1.102143 WP_003409564.1.10224 WP_003409564.1.10253 WP_003409564.1.10262 WP_003409564.1.10272 WP_003409564.1.10277 WP_003409564.1.1033 WP_003409564.1.10350 WP_003409564.1.10362 WP_003409564.1.10366 WP_003409564.1.10376 WP_003409564.1.10396 WP_003409564.1.10410 WP_003409564.1.10414 WP_003409564.1.10421 WP_003409564.1.10430 WP_003409564.1.1044 WP_003409564.1.10440 WP_003409564.1.10445 WP_003409564.1.10471 WP_003409564.1.10472 WP_003409564.1.10489 WP_003409564.1.105 WP_003409564.1.10518 WP_003409564.1.10523 WP_003409564.1.10545 WP_003409564.1.1057 WP_003409564.1.10594 WP_003409564.1.10603 WP_003409564.1.10606 WP_003409564.1.10615 WP_003409564.1.10623 WP_003409564.1.10635 WP_003409564.1.10643 WP_003409564.1.10648 WP_003409564.1.10662 WP_003409564.1.10709 WP_003409564.1.10735 WP_003409564.1.10740 WP_003409564.1.10756 WP_003409564.1.1078 WP_003409564.1.10791 WP_003409564.1.10799 WP_003409564.1.10825 WP_003409564.1.10848 WP_003409564.1.10863 WP_003409564.1.10879 WP_003409564.1.10912 WP_003409564.1.10916 WP_003409564.1.10923 WP_003409564.1.10927 WP_003409564.1.1095 WP_003409564.1.10956 WP_003409564.1.10958 WP_003409564.1.10962 WP_003409564.1.10980 WP_003409564.1.10981 WP_003409564.1.10993 WP_003409564.1.1100 WP_003409564.1.11040 WP_003409564.1.11061 WP_003409564.1.11070 WP_003409564.1.11171 WP_003409564.1.11175 WP_003409564.1.11176 WP_003409564.1.11222 WP_003409564.1.11236 WP_003409564.1.11329 WP_003409564.1.1133 WP_003409564.1.11342 WP_003409564.1.11373 WP_003409564.1.11390 WP_003409564.1.11402 WP_003409564.1.11481 WP_003409564.1.11487 WP_003409564.1.11489 WP_003409564.1.11491 WP_003409564.1.11514 WP_003409564.1.11589 WP_003409564.1.11596 WP_003409564.1.11604 WP_003409564.1.11610 WP_003409564.1.11697 WP_003409564.1.11707 WP_003409564.1.11752 WP_003409564.1.11758 WP_003409564.1.11761 WP_003409564.1.11775 WP_003409564.1.11804 WP_003409564.1.11822 WP_003409564.1.11826 WP_003409564.1.11856 WP_003409564.1.11898 WP_003409564.1.11906 WP_003409564.1.11939 WP_003409564.1.11960 WP_003409564.1.11961 WP_003409564.1.11972 WP_003409564.1.11984 WP_003409564.1.120 WP_003409564.1.12001 WP_003409564.1.12049 WP_003409564.1.12052 WP_003409564.1.12100 WP_003409564.1.12116 WP_003409564.1.12130 WP_003409564.1.12133 WP_003409564.1.12161 WP_003409564.1.12165 WP_003409564.1.12184 WP_003409564.1.12190 WP_003409564.1.12216 WP_003409564.1.12265 WP_003409564.1.12275 WP_003409564.1.12293 WP_003409564.1.12294 WP_003409564.1.123 WP_003409564.1.1231 WP_003409564.1.12314 WP_003409564.1.12327 WP_003409564.1.12338 WP_003409564.1.1236 WP_003409564.1.12371 WP_003409564.1.12372 WP_003409564.1.12389 WP_003409564.1.12406 WP_003409564.1.1241 WP_003409564.1.12421 WP_003409564.1.12424 WP_003409564.1.12446 WP_003409564.1.12464 WP_003409564.1.12479 WP_003409564.1.12519 WP_003409564.1.12523 WP_003409564.1.12526 WP_003409564.1.1255 WP_003409564.1.12550 WP_003409564.1.12551 WP_003409564.1.12563 WP_003409564.1.12611 WP_003409564.1.12669 WP_003409564.1.1267 WP_003409564.1.12672 WP_003409564.1.12692 WP_003409564.1.1271 WP_003409564.1.12710 WP_003409564.1.12768 WP_003409564.1.1279 WP_003409564.1.12794 WP_003409564.1.12801 WP_003409564.1.12804 WP_003409564.1.12821 WP_003409564.1.12841 WP_003409564.1.12854 WP_003409564.1.12871 WP_003409564.1.12901 WP_003409564.1.12941 WP_003409564.1.12947 WP_003409564.1.12957 WP_003409564.1.12972 WP_003409564.1.13028 WP_003409564.1.13043 WP_003409564.1.13086 WP_003409564.1.13087 WP_003409564.1.13090 WP_003409564.1.13096 WP_003409564.1.13163 WP_003409564.1.13175 WP_003409564.1.13183 WP_003409564.1.132 WP_003409564.1.13249 WP_003409564.1.13282 WP_003409564.1.13284 WP_003409564.1.13296 WP_003409564.1.13298 WP_003409564.1.13302 WP_003409564.1.13306 WP_003409564.1.13312 WP_003409564.1.13313 WP_003409564.1.13321 WP_003409564.1.13345 WP_003409564.1.13358 WP_003409564.1.13370 WP_003409564.1.13375 WP_003409564.1.1338 WP_003409564.1.13420 WP_003409564.1.13433 WP_003409564.1.13435 WP_003409564.1.13438 WP_003409564.1.13461 WP_003409564.1.13466 WP_003409564.1.13489 WP_003409564.1.13526 WP_003409564.1.13551 WP_003409564.1.13561 WP_003409564.1.13564 WP_003409564.1.13579 WP_003409564.1.13667 WP_003409564.1.13687 WP_003409564.1.13697 WP_003409564.1.13719 WP_003409564.1.13763 WP_003409564.1.1377 WP_003409564.1.13774 WP_003409564.1.13786 WP_003409564.1.13793 WP_003409564.1.13794 WP_003409564.1.13817 WP_003409564.1.13834 WP_003409564.1.13866 WP_003409564.1.13880 WP_003409564.1.13899 WP_003409564.1.13909 WP_003409564.1.13910 WP_003409564.1.13919 WP_003409564.1.13920 WP_003409564.1.13952 WP_003409564.1.13953 WP_003409564.1.13962 WP_003409564.1.1398 WP_003409564.1.13988 WP_003409564.1.14027 WP_003409564.1.14046 WP_003409564.1.14115 WP_003409564.1.1415 WP_003409564.1.14152 WP_003409564.1.14158 WP_003409564.1.14162 WP_003409564.1.14175 WP_003409564.1.14178 WP_003409564.1.14194 WP_003409564.1.14195 WP_003409564.1.14208 WP_003409564.1.14238 WP_003409564.1.14266 WP_003409564.1.14273 WP_003409564.1.14303 WP_003409564.1.14306 WP_003409564.1.14307 WP_003409564.1.14310 WP_003409564.1.14341 WP_003409564.1.14382 WP_003409564.1.14416 WP_003409564.1.14428 WP_003409564.1.14441 WP_003409564.1.14469 WP_003409564.1.14477 WP_003409564.1.14504 WP_003409564.1.14514 WP_003409564.1.1452 WP_003409564.1.14527 WP_003409564.1.1454 WP_003409564.1.14544 WP_003409564.1.14548 WP_003409564.1.14551 WP_003409564.1.14561 WP_003409564.1.14573 WP_003409564.1.1462 WP_003409564.1.14667 WP_003409564.1.14668 WP_003409564.1.14675 WP_003409564.1.14694 WP_003409564.1.14695 WP_003409564.1.14709 WP_003409564.1.14766 WP_003409564.1.14783 WP_003409564.1.14865 WP_003409564.1.14872 WP_003409564.1.14926 WP_003409564.1.14951 WP_003409564.1.14955 WP_003409564.1.15003 WP_003409564.1.15009 WP_003409564.1.15028 WP_003409564.1.15040 WP_003409564.1.15052 WP_003409564.1.15065 WP_003409564.1.15072 WP_003409564.1.15089 WP_003409564.1.1509 WP_003409564.1.15126 WP_003409564.1.15131 WP_003409564.1.15168 WP_003409564.1.15172 WP_003409564.1.15174 WP_003409564.1.15187 WP_003409564.1.15210 WP_003409564.1.15216 WP_003409564.1.15217 WP_003409564.1.1523 WP_003409564.1.15232 WP_003409564.1.15238 WP_003409564.1.15240 WP_003409564.1.15253 WP_003409564.1.15267 WP_003409564.1.1527 WP_003409564.1.15292 WP_003409564.1.15299 WP_003409564.1.15302 WP_003409564.1.15322 WP_003409564.1.1534 WP_003409564.1.15345 WP_003409564.1.15365 WP_003409564.1.15372 WP_003409564.1.15386 WP_003409564.1.15387 WP_003409564.1.15442 WP_003409564.1.15447 WP_003409564.1.15449 WP_003409564.1.15477 WP_003409564.1.15481 WP_003409564.1.15492 WP_003409564.1.15511 WP_003409564.1.15512 WP_003409564.1.15558 WP_003409564.1.15559 WP_003409564.1.15566 WP_003409564.1.15599 WP_003409564.1.1560 WP_003409564.1.15611 WP_003409564.1.1563 WP_003409564.1.15633 WP_003409564.1.15643 WP_003409564.1.15688 WP_003409564.1.15755 WP_003409564.1.15763 WP_003409564.1.15774 WP_003409564.1.1578 WP_003409564.1.15780 WP_003409564.1.15827 WP_003409564.1.15834 WP_003409564.1.15842 WP_003409564.1.15848 WP_003409564.1.15853 WP_003409564.1.15870 WP_003409564.1.15877 WP_003409564.1.15893 WP_003409564.1.15896 WP_003409564.1.15926 WP_003409564.1.15933 WP_003409564.1.15946 WP_003409564.1.15958 WP_003409564.1.15973 WP_003409564.1.15987 WP_003409564.1.15993 WP_003409564.1.16009 WP_003409564.1.16025 WP_003409564.1.16043 WP_003409564.1.16055 WP_003409564.1.16066 WP_003409564.1.16069 WP_003409564.1.16077 WP_003409564.1.16106 WP_003409564.1.16108 WP_003409564.1.16110 WP_003409564.1.16130 WP_003409564.1.16136 WP_003409564.1.16139 WP_003409564.1.16141 WP_003409564.1.16143 WP_003409564.1.1630 WP_003409564.1.16318 WP_003409564.1.1632 WP_003409564.1.16327 WP_003409564.1.16334 WP_003409564.1.16341 WP_003409564.1.16345 WP_003409564.1.16374 WP_003409564.1.16384 WP_003409564.1.16386 WP_003409564.1.164 WP_003409564.1.1642 WP_003409564.1.16421 WP_003409564.1.16424 WP_003409564.1.16426 WP_003409564.1.16431 WP_003409564.1.1644 WP_003409564.1.16442 WP_003409564.1.16451 WP_003409564.1.16476 WP_003409564.1.16480 WP_003409564.1.16494 WP_003409564.1.1652 WP_003409564.1.16549 WP_003409564.1.16560 WP_003409564.1.16598 WP_003409564.1.16609 WP_003409564.1.16619 WP_003409564.1.16620 WP_003409564.1.16622 WP_003409564.1.16637 WP_003409564.1.1669 WP_003409564.1.16707 WP_003409564.1.16724 WP_003409564.1.16731 WP_003409564.1.16743 WP_003409564.1.1683 WP_003409564.1.16837 WP_003409564.1.16852 WP_003409564.1.16937 WP_003409564.1.16940 WP_003409564.1.16950 WP_003409564.1.16959 WP_003409564.1.16968 WP_003409564.1.1697 WP_003409564.1.16977 WP_003409564.1.16987 WP_003409564.1.17005 WP_003409564.1.17006 WP_003409564.1.17010 WP_003409564.1.17015 WP_003409564.1.17019 WP_003409564.1.17039 WP_003409564.1.17041 WP_003409564.1.17052 WP_003409564.1.17057 WP_003409564.1.17062 WP_003409564.1.1707 WP_003409564.1.17094 WP_003409564.1.17130 WP_003409564.1.17138 WP_003409564.1.17147 WP_003409564.1.17167 WP_003409564.1.17224 WP_003409564.1.17251 WP_003409564.1.17288 WP_003409564.1.17304 WP_003409564.1.17314 WP_003409564.1.17345 WP_003409564.1.17381 WP_003409564.1.17391 WP_003409564.1.17412 WP_003409564.1.1743 WP_003409564.1.17440 WP_003409564.1.17466 WP_003409564.1.17477 WP_003409564.1.17483 WP_003409564.1.17505 WP_003409564.1.17527 WP_003409564.1.17535 WP_003409564.1.17540 WP_003409564.1.17553 WP_003409564.1.17558 WP_003409564.1.17599 WP_003409564.1.17635 WP_003409564.1.17655 WP_003409564.1.17679 WP_003409564.1.1768 WP_003409564.1.17687 WP_003409564.1.17700 WP_003409564.1.17710 WP_003409564.1.17713 WP_003409564.1.17722 WP_003409564.1.17746 WP_003409564.1.17788 WP_003409564.1.17798 WP_003409564.1.17803 WP_003409564.1.17816 WP_003409564.1.17821 WP_003409564.1.17830 WP_003409564.1.17868 WP_003409564.1.17878 WP_003409564.1.1792 WP_003409564.1.17923 WP_003409564.1.1795 WP_003409564.1.17955 WP_003409564.1.17973 WP_003409564.1.18009 WP_003409564.1.18013 WP_003409564.1.18033 WP_003409564.1.18057 WP_003409564.1.18065 WP_003409564.1.18070 WP_003409564.1.18116 WP_003409564.1.18120 WP_003409564.1.18126 WP_003409564.1.1817 WP_003409564.1.18170 WP_003409564.1.18206 WP_003409564.1.18216 WP_003409564.1.18240 WP_003409564.1.18257 WP_003409564.1.18297 WP_003409564.1.18306 WP_003409564.1.18364 WP_003409564.1.18399 WP_003409564.1.18411 WP_003409564.1.18444 WP_003409564.1.18448 WP_003409564.1.18467 WP_003409564.1.18476 WP_003409564.1.18522 WP_003409564.1.18580 WP_003409564.1.18582 WP_003409564.1.18587 WP_003409564.1.186 WP_003409564.1.18601 WP_003409564.1.18639 WP_003409564.1.18646 WP_003409564.1.18647 WP_003409564.1.1868 WP_003409564.1.18694 WP_003409564.1.18710 WP_003409564.1.18751 WP_003409564.1.18781 WP_003409564.1.18793 WP_003409564.1.18804 WP_003409564.1.18816 WP_003409564.1.18823 WP_003409564.1.18827 WP_003409564.1.18838 WP_003409564.1.18849 WP_003409564.1.18856 WP_003409564.1.18945 WP_003409564.1.1898 WP_003409564.1.19005 WP_003409564.1.19056 WP_003409564.1.19063 WP_003409564.1.19066 WP_003409564.1.19071 WP_003409564.1.19085 WP_003409564.1.19094 WP_003409564.1.19144 WP_003409564.1.19159 WP_003409564.1.19193 WP_003409564.1.19231 WP_003409564.1.19243 WP_003409564.1.19264 WP_003409564.1.19295 WP_003409564.1.19307 WP_003409564.1.19326 WP_003409564.1.1933 WP_003409564.1.19382 WP_003409564.1.19400 WP_003409564.1.19426 WP_003409564.1.19429 WP_003409564.1.19464 WP_003409564.1.19480 WP_003409564.1.19553 WP_003409564.1.19562 WP_003409564.1.19564 WP_003409564.1.19568 WP_003409564.1.19572 WP_003409564.1.19595 WP_003409564.1.19596 WP_003409564.1.19600 WP_003409564.1.19630 WP_003409564.1.1967 WP_003409564.1.19694 WP_003409564.1.1970 WP_003409564.1.19707 WP_003409564.1.19742 WP_003409564.1.19785 WP_003409564.1.19820 WP_003409564.1.19868 WP_003409564.1.19874 WP_003409564.1.19890 WP_003409564.1.19900 WP_003409564.1.19922 WP_003409564.1.19936 WP_003409564.1.19946 WP_003409564.1.19949 WP_003409564.1.19960 WP_003409564.1.19964 WP_003409564.1.20007 WP_003409564.1.20016 WP_003409564.1.2003 WP_003409564.1.20037 WP_003409564.1.20039 WP_003409564.1.20082 WP_003409564.1.20085 WP_003409564.1.20097 WP_003409564.1.20116 WP_003409564.1.20130 WP_003409564.1.20140 WP_003409564.1.20141 WP_003409564.1.20142 WP_003409564.1.20158 WP_003409564.1.20239 WP_003409564.1.20243 WP_003409564.1.20259 WP_003409564.1.20262 WP_003409564.1.20268 WP_003409564.1.20272 WP_003409564.1.20273 WP_003409564.1.20280 WP_003409564.1.20294 WP_003409564.1.20300 WP_003409564.1.20309 WP_003409564.1.20322 WP_003409564.1.2037 WP_003409564.1.20372 WP_003409564.1.20381 WP_003409564.1.204 WP_003409564.1.20427 WP_003409564.1.20432 WP_003409564.1.20457 WP_003409564.1.20459 WP_003409564.1.20460 WP_003409564.1.20542 WP_003409564.1.20578 WP_003409564.1.20608 WP_003409564.1.20624 WP_003409564.1.20628 WP_003409564.1.2066 WP_003409564.1.20707 WP_003409564.1.20722 WP_003409564.1.20729 WP_003409564.1.20742 WP_003409564.1.20751 WP_003409564.1.20776 WP_003409564.1.20843 WP_003409564.1.20850 WP_003409564.1.2086 WP_003409564.1.20868 WP_003409564.1.20897 WP_003409564.1.20898 WP_003409564.1.2090 WP_003409564.1.20911 WP_003409564.1.20916 WP_003409564.1.20921 WP_003409564.1.20926 WP_003409564.1.20927 WP_003409564.1.20951 WP_003409564.1.20970 WP_003409564.1.2104 WP_003409564.1.21070 WP_003409564.1.21127 WP_003409564.1.21135 WP_003409564.1.21173 WP_003409564.1.21187 WP_003409564.1.212 WP_003409564.1.2120 WP_003409564.1.21218 WP_003409564.1.21219 WP_003409564.1.2123 WP_003409564.1.21231 WP_003409564.1.21234 WP_003409564.1.2126 WP_003409564.1.21292 WP_003409564.1.21307 WP_003409564.1.2131 WP_003409564.1.21311 WP_003409564.1.21321 WP_003409564.1.21365 WP_003409564.1.2137 WP_003409564.1.21392 WP_003409564.1.21397 WP_003409564.1.21415 WP_003409564.1.21418 WP_003409564.1.21430 WP_003409564.1.21434 WP_003409564.1.21444 WP_003409564.1.21468 WP_003409564.1.21498 WP_003409564.1.21509 WP_003409564.1.21513 WP_003409564.1.21560 WP_003409564.1.21565 WP_003409564.1.21586 WP_003409564.1.21591 WP_003409564.1.21594 WP_003409564.1.21602 WP_003409564.1.21615 WP_003409564.1.21638 WP_003409564.1.21639 WP_003409564.1.21655 WP_003409564.1.21658 WP_003409564.1.2168 WP_003409564.1.2174 WP_003409564.1.21741 WP_003409564.1.21742 WP_003409564.1.21777 WP_003409564.1.21786 WP_003409564.1.21795 WP_003409564.1.218 WP_003409564.1.21826 WP_003409564.1.21829 WP_003409564.1.21840 WP_003409564.1.21843 WP_003409564.1.21872 WP_003409564.1.21873 WP_003409564.1.2188 WP_003409564.1.21882 WP_003409564.1.21906 WP_003409564.1.21912 WP_003409564.1.2194 WP_003409564.1.21941 WP_003409564.1.21956 WP_003409564.1.21958 WP_003409564.1.21960 WP_003409564.1.21971 WP_003409564.1.21973 WP_003409564.1.21983 WP_003409564.1.22003 WP_003409564.1.22013 WP_003409564.1.22025 WP_003409564.1.22036 WP_003409564.1.22075 WP_003409564.1.22092 WP_003409564.1.2212 WP_003409564.1.22127 WP_003409564.1.22140 WP_003409564.1.22255 WP_003409564.1.22277 WP_003409564.1.22305 WP_003409564.1.22348 WP_003409564.1.22366 WP_003409564.1.2238 WP_003409564.1.22380 WP_003409564.1.22437 WP_003409564.1.22438 WP_003409564.1.22445 WP_003409564.1.22490 WP_003409564.1.22511 WP_003409564.1.22524 WP_003409564.1.22585 WP_003409564.1.22589 WP_003409564.1.22606 WP_003409564.1.22608 WP_003409564.1.22609 WP_003409564.1.22618 WP_003409564.1.2262 WP_003409564.1.22624 WP_003409564.1.22629 WP_003409564.1.22647 WP_003409564.1.22664 WP_003409564.1.22665 WP_003409564.1.22670 WP_003409564.1.22674 WP_003409564.1.22680 WP_003409564.1.22725 WP_003409564.1.22728 WP_003409564.1.22733 WP_003409564.1.22737 WP_003409564.1.2275 WP_003409564.1.22754 WP_003409564.1.22797 WP_003409564.1.22800 WP_003409564.1.22804 WP_003409564.1.22829 WP_003409564.1.22840 WP_003409564.1.22844 WP_003409564.1.22963 WP_003409564.1.22970 WP_003409564.1.22996 WP_003409564.1.22997 WP_003409564.1.22999 WP_003409564.1.23015 WP_003409564.1.23032 WP_003409564.1.231 WP_003409564.1.23101 WP_003409564.1.2312 WP_003409564.1.23140 WP_003409564.1.23153 WP_003409564.1.23171 WP_003409564.1.23199 WP_003409564.1.2320 WP_003409564.1.23204 WP_003409564.1.23216 WP_003409564.1.23229 WP_003409564.1.23233 WP_003409564.1.2326 WP_003409564.1.23261 WP_003409564.1.23272 WP_003409564.1.23289 WP_003409564.1.23308 WP_003409564.1.23316 WP_003409564.1.23321 WP_003409564.1.23325 WP_003409564.1.2339 WP_003409564.1.23406 WP_003409564.1.23438 WP_003409564.1.23445 WP_003409564.1.23447 WP_003409564.1.23452 WP_003409564.1.23461 WP_003409564.1.2349 WP_003409564.1.23496 WP_003409564.1.23497 WP_003409564.1.23506 WP_003409564.1.23530 WP_003409564.1.23539 WP_003409564.1.23546 WP_003409564.1.23551 WP_003409564.1.23573 WP_003409564.1.23583 WP_003409564.1.23588 WP_003409564.1.23628 WP_003409564.1.23677 WP_003409564.1.23683 WP_003409564.1.23692 WP_003409564.1.23694 WP_003409564.1.23699 WP_003409564.1.2371 WP_003409564.1.23803 WP_003409564.1.23807 WP_003409564.1.23825 WP_003409564.1.23832 WP_003409564.1.2384 WP_003409564.1.23843 WP_003409564.1.23863 WP_003409564.1.2387 WP_003409564.1.23894 WP_003409564.1.23993 WP_003409564.1.2400 WP_003409564.1.24007 WP_003409564.1.24008 WP_003409564.1.24046 WP_003409564.1.24057 WP_003409564.1.24062 WP_003409564.1.24113 WP_003409564.1.24119 WP_003409564.1.24128 WP_003409564.1.24140 WP_003409564.1.24176 WP_003409564.1.24190 WP_003409564.1.24202 WP_003409564.1.24244 WP_003409564.1.24261 WP_003409564.1.24284 WP_003409564.1.24294 WP_003409564.1.24357 WP_003409564.1.24396 WP_003409564.1.24414 WP_003409564.1.24423 WP_003409564.1.2443 WP_003409564.1.24446 WP_003409564.1.24461 WP_003409564.1.24500 WP_003409564.1.24507 WP_003409564.1.24509 WP_003409564.1.24529 WP_003409564.1.24553 WP_003409564.1.24599 WP_003409564.1.24629 WP_003409564.1.24638 WP_003409564.1.24648 WP_003409564.1.2466 WP_003409564.1.24767 WP_003409564.1.24824 WP_003409564.1.24831 WP_003409564.1.24840 WP_003409564.1.24848 WP_003409564.1.24857 WP_003409564.1.2487 WP_003409564.1.24893 WP_003409564.1.24907 WP_003409564.1.24933 WP_003409564.1.24956 WP_003409564.1.24958 WP_003409564.1.24985 WP_003409564.1.2499 WP_003409564.1.25004 WP_003409564.1.2505 WP_003409564.1.25051 WP_003409564.1.2507 WP_003409564.1.25096 WP_003409564.1.25103 WP_003409564.1.25129 WP_003409564.1.25171 WP_003409564.1.25184 WP_003409564.1.25247 WP_003409564.1.25252 WP_003409564.1.25278 WP_003409564.1.25283 WP_003409564.1.25309 WP_003409564.1.25313 WP_003409564.1.25338 WP_003409564.1.25342 WP_003409564.1.25343 WP_003409564.1.25367 WP_003409564.1.25393 WP_003409564.1.25406 WP_003409564.1.25435 WP_003409564.1.25437 WP_003409564.1.25445 WP_003409564.1.25455 WP_003409564.1.25473 WP_003409564.1.25504 WP_003409564.1.25513 WP_003409564.1.25542 WP_003409564.1.25579 WP_003409564.1.25594 WP_003409564.1.25606 WP_003409564.1.25645 WP_003409564.1.2566 WP_003409564.1.25673 WP_003409564.1.25674 WP_003409564.1.25693 WP_003409564.1.25699 WP_003409564.1.25727 WP_003409564.1.25736 WP_003409564.1.25738 WP_003409564.1.25756 WP_003409564.1.25759 WP_003409564.1.2580 WP_003409564.1.25813 WP_003409564.1.25853 WP_003409564.1.25854 WP_003409564.1.25874 WP_003409564.1.25885 WP_003409564.1.25892 WP_003409564.1.25906 WP_003409564.1.25914 WP_003409564.1.25916 WP_003409564.1.2594 WP_003409564.1.25954 WP_003409564.1.25972 WP_003409564.1.26017 WP_003409564.1.26032 WP_003409564.1.26038 WP_003409564.1.26072 WP_003409564.1.26089 WP_003409564.1.26097 WP_003409564.1.26098 WP_003409564.1.26108 WP_003409564.1.26109 WP_003409564.1.26118 WP_003409564.1.26126 WP_003409564.1.2614 WP_003409564.1.26168 WP_003409564.1.26190 WP_003409564.1.2620 WP_003409564.1.26234 WP_003409564.1.26243 WP_003409564.1.26267 WP_003409564.1.26292 WP_003409564.1.26310 WP_003409564.1.26328 WP_003409564.1.26349 WP_003409564.1.26366 WP_003409564.1.26374 WP_003409564.1.26407 WP_003409564.1.26454 WP_003409564.1.26464 WP_003409564.1.2653 WP_003409564.1.26560 WP_003409564.1.26571 WP_003409564.1.2659 WP_003409564.1.26597 WP_003409564.1.26603 WP_003409564.1.26629 WP_003409564.1.26651 WP_003409564.1.26702 WP_003409564.1.26707 WP_003409564.1.26710 WP_003409564.1.26719 WP_003409564.1.26737 WP_003409564.1.26738 WP_003409564.1.26745 WP_003409564.1.26756 WP_003409564.1.2676 WP_003409564.1.2677 WP_003409564.1.26779 WP_003409564.1.26780 WP_003409564.1.26798 WP_003409564.1.26854 WP_003409564.1.26868 WP_003409564.1.26876 WP_003409564.1.26888 WP_003409564.1.26914 WP_003409564.1.26945 WP_003409564.1.26959 WP_003409564.1.26969 WP_003409564.1.26984 WP_003409564.1.26992 WP_003409564.1.27004 WP_003409564.1.27017 WP_003409564.1.27045 WP_003409564.1.27075 WP_003409564.1.27128 WP_003409564.1.27130 WP_003409564.1.27139 WP_003409564.1.27152 WP_003409564.1.27162 WP_003409564.1.27164 WP_003409564.1.27193 WP_003409564.1.27235 WP_003409564.1.27278 WP_003409564.1.27343 WP_003409564.1.27352 WP_003409564.1.27369 WP_003409564.1.27391 WP_003409564.1.27398 WP_003409564.1.27402 WP_003409564.1.27410 WP_003409564.1.27411 WP_003409564.1.27449 WP_003409564.1.27460 WP_003409564.1.27463 WP_003409564.1.2749 WP_003409564.1.27492 WP_003409564.1.27528 WP_003409564.1.27541 WP_003409564.1.27576 WP_003409564.1.27582 WP_003409564.1.27607 WP_003409564.1.2766 WP_003409564.1.277 WP_003409564.1.27724 WP_003409564.1.27730 WP_003409564.1.27736 WP_003409564.1.27743 WP_003409564.1.27750 WP_003409564.1.27771 WP_003409564.1.27779 WP_003409564.1.27795 WP_003409564.1.27803 WP_003409564.1.27819 WP_003409564.1.27835 WP_003409564.1.27935 WP_003409564.1.27962 WP_003409564.1.28053 WP_003409564.1.28092 WP_003409564.1.28106 WP_003409564.1.28131 WP_003409564.1.28142 WP_003409564.1.28159 WP_003409564.1.2816 WP_003409564.1.28161 WP_003409564.1.28192 WP_003409564.1.28202 WP_003409564.1.28241 WP_003409564.1.28242 WP_003409564.1.28251 WP_003409564.1.28255 WP_003409564.1.28269 WP_003409564.1.28276 WP_003409564.1.28293 WP_003409564.1.28331 WP_003409564.1.28367 WP_003409564.1.28378 WP_003409564.1.28391 WP_003409564.1.2842 WP_003409564.1.28448 WP_003409564.1.2847 WP_003409564.1.28471 WP_003409564.1.28473 WP_003409564.1.28493 WP_003409564.1.28497 WP_003409564.1.28530 WP_003409564.1.28545 WP_003409564.1.28561 WP_003409564.1.28567 WP_003409564.1.28585 WP_003409564.1.286 WP_003409564.1.28610 WP_003409564.1.28617 WP_003409564.1.28634 WP_003409564.1.28642 WP_003409564.1.28671 WP_003409564.1.28682 WP_003409564.1.28698 WP_003409564.1.28703 WP_003409564.1.28739 WP_003409564.1.28758 WP_003409564.1.28781 WP_003409564.1.28787 WP_003409564.1.28827 WP_003409564.1.28847 WP_003409564.1.28850 WP_003409564.1.28851 WP_003409564.1.28865 WP_003409564.1.28897 WP_003409564.1.28914 WP_003409564.1.28935 WP_003409564.1.28936 WP_003409564.1.28939 WP_003409564.1.28943 WP_003409564.1.28952 WP_003409564.1.28975 WP_003409564.1.2899 WP_003409564.1.28993 WP_003409564.1.29000 WP_003409564.1.2901 WP_003409564.1.29028 WP_003409564.1.29033 WP_003409564.1.29058 WP_003409564.1.29078 WP_003409564.1.29102 WP_003409564.1.29115 WP_003409564.1.2916 WP_003409564.1.29217 WP_003409564.1.29223 WP_003409564.1.29234 WP_003409564.1.29264 WP_003409564.1.29275 WP_003409564.1.29306 WP_003409564.1.29339 WP_003409564.1.29348 WP_003409564.1.29364 WP_003409564.1.29367 WP_003409564.1.2938 WP_003409564.1.29399 WP_003409564.1.29426 WP_003409564.1.2944 WP_003409564.1.29449 WP_003409564.1.29450 WP_003409564.1.29452 WP_003409564.1.2949 WP_003409564.1.29510 WP_003409564.1.29515 WP_003409564.1.29525 WP_003409564.1.2953 WP_003409564.1.29559 WP_003409564.1.29587 WP_003409564.1.2959 WP_003409564.1.29592 WP_003409564.1.29599 WP_003409564.1.29611 WP_003409564.1.29632 WP_003409564.1.29649 WP_003409564.1.2965 WP_003409564.1.29659 WP_003409564.1.2969 WP_003409564.1.29696 WP_003409564.1.29698 WP_003409564.1.29718 WP_003409564.1.29742 WP_003409564.1.29745 WP_003409564.1.29747 WP_003409564.1.29769 WP_003409564.1.29825 WP_003409564.1.29830 WP_003409564.1.29847 WP_003409564.1.29861 WP_003409564.1.29869 WP_003409564.1.29883 WP_003409564.1.29890 WP_003409564.1.299 WP_003409564.1.29931 WP_003409564.1.29960 WP_003409564.1.30014 WP_003409564.1.3004 WP_003409564.1.30040 WP_003409564.1.30043 WP_003409564.1.30074 WP_003409564.1.30097 WP_003409564.1.30101 WP_003409564.1.30106 WP_003409564.1.30114 WP_003409564.1.30126 WP_003409564.1.30131 WP_003409564.1.30138 WP_003409564.1.30139 WP_003409564.1.30145 WP_003409564.1.30211 WP_003409564.1.30224 WP_003409564.1.30235 WP_003409564.1.30237 WP_003409564.1.3027 WP_003409564.1.30279 WP_003409564.1.30282 WP_003409564.1.30283 WP_003409564.1.30288 WP_003409564.1.30291 WP_003409564.1.30363 WP_003409564.1.30374 WP_003409564.1.30404 WP_003409564.1.3043 WP_003409564.1.30433 WP_003409564.1.30438 WP_003409564.1.30462 WP_003409564.1.30464 WP_003409564.1.30468 WP_003409564.1.30500 WP_003409564.1.3057 WP_003409564.1.30574 WP_003409564.1.30628 WP_003409564.1.30641 WP_003409564.1.30642 WP_003409564.1.30661 WP_003409564.1.30669 WP_003409564.1.30683 WP_003409564.1.30699 WP_003409564.1.30709 WP_003409564.1.30713 WP_003409564.1.30716 WP_003409564.1.30719 WP_003409564.1.30730 WP_003409564.1.30736 WP_003409564.1.30745 WP_003409564.1.30760 WP_003409564.1.30791 WP_003409564.1.308 WP_003409564.1.30807 WP_003409564.1.30818 WP_003409564.1.30824 WP_003409564.1.30848 WP_003409564.1.30877 WP_003409564.1.30888 WP_003409564.1.30901 WP_003409564.1.30903 WP_003409564.1.30912 WP_003409564.1.30913 WP_003409564.1.30914 WP_003409564.1.30919 WP_003409564.1.30977 WP_003409564.1.3100 WP_003409564.1.31002 WP_003409564.1.3101 WP_003409564.1.31034 WP_003409564.1.31047 WP_003409564.1.31070 WP_003409564.1.31074 WP_003409564.1.31102 WP_003409564.1.31127 WP_003409564.1.31184 WP_003409564.1.31199 WP_003409564.1.31226 WP_003409564.1.31230 WP_003409564.1.31233 WP_003409564.1.31263 WP_003409564.1.31264 WP_003409564.1.31270 WP_003409564.1.31287 WP_003409564.1.31290 WP_003409564.1.31304 WP_003409564.1.31346 WP_003409564.1.31348 WP_003409564.1.31354 WP_003409564.1.31390 WP_003409564.1.31414 WP_003409564.1.31417 WP_003409564.1.31428 WP_003409564.1.3143 WP_003409564.1.31458 WP_003409564.1.31483 WP_003409564.1.3149 WP_003409564.1.31498 WP_003409564.1.31507 WP_003409564.1.31537 WP_003409564.1.31548 WP_003409564.1.31569 WP_003409564.1.31573 WP_003409564.1.316 WP_003409564.1.31629 WP_003409564.1.31666 WP_003409564.1.31693 WP_003409564.1.31703 WP_003409564.1.31744 WP_003409564.1.31745 WP_003409564.1.31770 WP_003409564.1.31776 WP_003409564.1.31783 WP_003409564.1.318 WP_003409564.1.3184 WP_003409564.1.31840 WP_003409564.1.31880 WP_003409564.1.31911 WP_003409564.1.31930 WP_003409564.1.31932 WP_003409564.1.31955 WP_003409564.1.31985 WP_003409564.1.31991 WP_003409564.1.31995 WP_003409564.1.32004 WP_003409564.1.32039 WP_003409564.1.3204 WP_003409564.1.32045 WP_003409564.1.32071 WP_003409564.1.32098 WP_003409564.1.32132 WP_003409564.1.32157 WP_003409564.1.32164 WP_003409564.1.32179 WP_003409564.1.32198 WP_003409564.1.32297 WP_003409564.1.32317 WP_003409564.1.32383 WP_003409564.1.32400 WP_003409564.1.32403 WP_003409564.1.32416 WP_003409564.1.32421 WP_003409564.1.32433 WP_003409564.1.32461 WP_003409564.1.32482 WP_003409564.1.32503 WP_003409564.1.32556 WP_003409564.1.32562 WP_003409564.1.32569 WP_003409564.1.32592 WP_003409564.1.32620 WP_003409564.1.32647 WP_003409564.1.32653 WP_003409564.1.32654 WP_003409564.1.3268 WP_003409564.1.32695 WP_003409564.1.32706 WP_003409564.1.32716 WP_003409564.1.32738 WP_003409564.1.32752 WP_003409564.1.32780 WP_003409564.1.32781 WP_003409564.1.32793 WP_003409564.1.32799 WP_003409564.1.32833 WP_003409564.1.32862 WP_003409564.1.32880 WP_003409564.1.32897 WP_003409564.1.32909 WP_003409564.1.32935 WP_003409564.1.32974 WP_003409564.1.33007 WP_003409564.1.3302 WP_003409564.1.33028 WP_003409564.1.33035 WP_003409564.1.33044 WP_003409564.1.33054 WP_003409564.1.33082 WP_003409564.1.33141 WP_003409564.1.33148 WP_003409564.1.33155 WP_003409564.1.33168 WP_003409564.1.3321 WP_003409564.1.33215 WP_003409564.1.3325 WP_003409564.1.3327 WP_003409564.1.33278 WP_003409564.1.33288 WP_003409564.1.33305 WP_003409564.1.3331 WP_003409564.1.33319 WP_003409564.1.3333 WP_003409564.1.33393 WP_003409564.1.33403 WP_003409564.1.33452 WP_003409564.1.33467 WP_003409564.1.33477 WP_003409564.1.3349 WP_003409564.1.33519 WP_003409564.1.33542 WP_003409564.1.33601 WP_003409564.1.33602 WP_003409564.1.33633 WP_003409564.1.33646 WP_003409564.1.33673 WP_003409564.1.3369 WP_003409564.1.33705 WP_003409564.1.33762 WP_003409564.1.33783 WP_003409564.1.33789 WP_003409564.1.3383 WP_003409564.1.33832 WP_003409564.1.33839 WP_003409564.1.33848 WP_003409564.1.3387 WP_003409564.1.33886 WP_003409564.1.33895 WP_003409564.1.33906 WP_003409564.1.33912 WP_003409564.1.33954 WP_003409564.1.3399 WP_003409564.1.34042 WP_003409564.1.3405 WP_003409564.1.34055 WP_003409564.1.34056 WP_003409564.1.34065 WP_003409564.1.3408 WP_003409564.1.34090 WP_003409564.1.34109 WP_003409564.1.34131 WP_003409564.1.34152 WP_003409564.1.34153 WP_003409564.1.34163 WP_003409564.1.34181 WP_003409564.1.34197 WP_003409564.1.34198 WP_003409564.1.34215 WP_003409564.1.34219 WP_003409564.1.34255 WP_003409564.1.34260 WP_003409564.1.34275 WP_003409564.1.343 WP_003409564.1.34347 WP_003409564.1.34358 WP_003409564.1.34392 WP_003409564.1.344 WP_003409564.1.34428 WP_003409564.1.3443 WP_003409564.1.34435 WP_003409564.1.34446 WP_003409564.1.34499 WP_003409564.1.34505 WP_003409564.1.34516 WP_003409564.1.34529 WP_003409564.1.34551 WP_003409564.1.34563 WP_003409564.1.34576 WP_003409564.1.34581 WP_003409564.1.34588 WP_003409564.1.34596 WP_003409564.1.34599 WP_003409564.1.34639 WP_003409564.1.34673 WP_003409564.1.34724 WP_003409564.1.34740 WP_003409564.1.34755 WP_003409564.1.34777 WP_003409564.1.34783 WP_003409564.1.34841 WP_003409564.1.34908 WP_003409564.1.34919 WP_003409564.1.3492 WP_003409564.1.34933 WP_003409564.1.34945 WP_003409564.1.34946 WP_003409564.1.34954 WP_003409564.1.34960 WP_003409564.1.34961 WP_003409564.1.34963 WP_003409564.1.34965 WP_003409564.1.34968 WP_003409564.1.35023 WP_003409564.1.35069 WP_003409564.1.35072 WP_003409564.1.35078 WP_003409564.1.35146 WP_003409564.1.35156 WP_003409564.1.35160 WP_003409564.1.35162 WP_003409564.1.35173 WP_003409564.1.35176 WP_003409564.1.3520 WP_003409564.1.35213 WP_003409564.1.35221 WP_003409564.1.35246 WP_003409564.1.35278 WP_003409564.1.35301 WP_003409564.1.35311 WP_003409564.1.35312 WP_003409564.1.35317 WP_003409564.1.35319 WP_003409564.1.35347 WP_003409564.1.35363 WP_003409564.1.35382 WP_003409564.1.35385 WP_003409564.1.35396 WP_003409564.1.35397 WP_003409564.1.35403 WP_003409564.1.35426 WP_003409564.1.35439 WP_003409564.1.35455 WP_003409564.1.3548 WP_003409564.1.35484 WP_003409564.1.35492 WP_003409564.1.3553 WP_003409564.1.35553 WP_003409564.1.35555 WP_003409564.1.35561 WP_003409564.1.35602 WP_003409564.1.35610 WP_003409564.1.35635 WP_003409564.1.35657 WP_003409564.1.35687 WP_003409564.1.35689 WP_003409564.1.35707 WP_003409564.1.35732 WP_003409564.1.35754 WP_003409564.1.35767 WP_003409564.1.35770 WP_003409564.1.35771 WP_003409564.1.35780 WP_003409564.1.35805 WP_003409564.1.35811 WP_003409564.1.35821 WP_003409564.1.3584 WP_003409564.1.35848 WP_003409564.1.35864 WP_003409564.1.35874 WP_003409564.1.35876 WP_003409564.1.35897 WP_003409564.1.35899 WP_003409564.1.35923 WP_003409564.1.3593 WP_003409564.1.35954 WP_003409564.1.36005 WP_003409564.1.36014 WP_003409564.1.36023 WP_003409564.1.36051 WP_003409564.1.36053 WP_003409564.1.36075 WP_003409564.1.36089 WP_003409564.1.36097 WP_003409564.1.36098 WP_003409564.1.36116 WP_003409564.1.36145 WP_003409564.1.36156 WP_003409564.1.36205 WP_003409564.1.36228 WP_003409564.1.36246 WP_003409564.1.36252 WP_003409564.1.36260 WP_003409564.1.36270 WP_003409564.1.36271 WP_003409564.1.36303 WP_003409564.1.36309 WP_003409564.1.36315 WP_003409564.1.36319 WP_003409564.1.36321 WP_003409564.1.36326 WP_003409564.1.3634 WP_003409564.1.36356 WP_003409564.1.36357 WP_003409564.1.3636 WP_003409564.1.36385 WP_003409564.1.36399 WP_003409564.1.36436 WP_003409564.1.36465 WP_003409564.1.36469 WP_003409564.1.36473 WP_003409564.1.36485 WP_003409564.1.36508 WP_003409564.1.36540 WP_003409564.1.36561 WP_003409564.1.36571 WP_003409564.1.36573 WP_003409564.1.36578 WP_003409564.1.36585 WP_003409564.1.36597 WP_003409564.1.36614 WP_003409564.1.36657 WP_003409564.1.36674 WP_003409564.1.36720 WP_003409564.1.36727 WP_003409564.1.36733 WP_003409564.1.36785 WP_003409564.1.36810 WP_003409564.1.36844 WP_003409564.1.36851 WP_003409564.1.36862 WP_003409564.1.36893 WP_003409564.1.36901 WP_003409564.1.36921 WP_003409564.1.36935 WP_003409564.1.36941 WP_003409564.1.3695 WP_003409564.1.36951 WP_003409564.1.36968 WP_003409564.1.3700 WP_003409564.1.37004 WP_003409564.1.37012 WP_003409564.1.37071 WP_003409564.1.37088 WP_003409564.1.37131 WP_003409564.1.37157 WP_003409564.1.37175 WP_003409564.1.37188 WP_003409564.1.37213 WP_003409564.1.37229 WP_003409564.1.3724 WP_003409564.1.37277 WP_003409564.1.37305 WP_003409564.1.37330 WP_003409564.1.37389 WP_003409564.1.37400 WP_003409564.1.37440 WP_003409564.1.37459 WP_003409564.1.37468 WP_003409564.1.37475 WP_003409564.1.37484 WP_003409564.1.37601 WP_003409564.1.37612 WP_003409564.1.37632 WP_003409564.1.37643 WP_003409564.1.37655 WP_003409564.1.37660 WP_003409564.1.37674 WP_003409564.1.37700 WP_003409564.1.37701 WP_003409564.1.37709 WP_003409564.1.37711 WP_003409564.1.37721 WP_003409564.1.37722 WP_003409564.1.37747 WP_003409564.1.37765 WP_003409564.1.37772 WP_003409564.1.37804 WP_003409564.1.37809 WP_003409564.1.37859 WP_003409564.1.37877 WP_003409564.1.37912 WP_003409564.1.37913 WP_003409564.1.37943 WP_003409564.1.37950 WP_003409564.1.37973 WP_003409564.1.37975 WP_003409564.1.37983 WP_003409564.1.38 WP_003409564.1.38002 WP_003409564.1.3802 WP_003409564.1.38039 WP_003409564.1.38040 WP_003409564.1.38067 WP_003409564.1.38068 WP_003409564.1.38135 WP_003409564.1.38138 WP_003409564.1.38144 WP_003409564.1.38158 WP_003409564.1.38159 WP_003409564.1.38210 WP_003409564.1.38233 WP_003409564.1.38240 WP_003409564.1.38299 WP_003409564.1.38332 WP_003409564.1.38347 WP_003409564.1.38354 WP_003409564.1.38380 WP_003409564.1.38384 WP_003409564.1.38389 WP_003409564.1.38398 WP_003409564.1.38402 WP_003409564.1.38418 WP_003409564.1.38421 WP_003409564.1.38466 WP_003409564.1.38477 WP_003409564.1.38483 WP_003409564.1.3849 WP_003409564.1.385 WP_003409564.1.38530 WP_003409564.1.38535 WP_003409564.1.38539 WP_003409564.1.38594 WP_003409564.1.38601 WP_003409564.1.38611 WP_003409564.1.38638 WP_003409564.1.38639 WP_003409564.1.38646 WP_003409564.1.38648 WP_003409564.1.38654 WP_003409564.1.38659 WP_003409564.1.38660 WP_003409564.1.38666 WP_003409564.1.38671 WP_003409564.1.38672 WP_003409564.1.38677 WP_003409564.1.38750 WP_003409564.1.38772 WP_003409564.1.38812 WP_003409564.1.38821 WP_003409564.1.38844 WP_003409564.1.38863 WP_003409564.1.38865 WP_003409564.1.38873 WP_003409564.1.3889 WP_003409564.1.38894 WP_003409564.1.38909 WP_003409564.1.38939 WP_003409564.1.38974 WP_003409564.1.38975 WP_003409564.1.38991 WP_003409564.1.39025 WP_003409564.1.39070 WP_003409564.1.39072 WP_003409564.1.39095 WP_003409564.1.39106 WP_003409564.1.39165 WP_003409564.1.39174 WP_003409564.1.39176 WP_003409564.1.39178 WP_003409564.1.39190 WP_003409564.1.39201 WP_003409564.1.39207 WP_003409564.1.39211 WP_003409564.1.39236 WP_003409564.1.39239 WP_003409564.1.39252 WP_003409564.1.39288 WP_003409564.1.39295 WP_003409564.1.39306 WP_003409564.1.39359 WP_003409564.1.39364 WP_003409564.1.39400 WP_003409564.1.39447 WP_003409564.1.3945 WP_003409564.1.39450 WP_003409564.1.39455 WP_003409564.1.3949 WP_003409564.1.39521 WP_003409564.1.39560 WP_003409564.1.39592 WP_003409564.1.39593 WP_003409564.1.3960 WP_003409564.1.39616 WP_003409564.1.39654 WP_003409564.1.39657 WP_003409564.1.39661 WP_003409564.1.39674 WP_003409564.1.39678 WP_003409564.1.3968 WP_003409564.1.39694 WP_003409564.1.3971 WP_003409564.1.39718 WP_003409564.1.39728 WP_003409564.1.39739 WP_003409564.1.39748 WP_003409564.1.39751 WP_003409564.1.39759 WP_003409564.1.39801 WP_003409564.1.39804 WP_003409564.1.39848 WP_003409564.1.39877 WP_003409564.1.39925 WP_003409564.1.3994 WP_003409564.1.39959 WP_003409564.1.3996 WP_003409564.1.39960 WP_003409564.1.3997 WP_003409564.1.39980 WP_003409564.1.40000 WP_003409564.1.40028 WP_003409564.1.40029 WP_003409564.1.4003 WP_003409564.1.40094 WP_003409564.1.40096 WP_003409564.1.40150 WP_003409564.1.40156 WP_003409564.1.40174 WP_003409564.1.40186 WP_003409564.1.40276 WP_003409564.1.40277 WP_003409564.1.40323 WP_003409564.1.40336 WP_003409564.1.40353 WP_003409564.1.4036 WP_003409564.1.40372 WP_003409564.1.40402 WP_003409564.1.40413 WP_003409564.1.40440 WP_003409564.1.40446 WP_003409564.1.40451 WP_003409564.1.40455 WP_003409564.1.40523 WP_003409564.1.40543 WP_003409564.1.40641 WP_003409564.1.40646 WP_003409564.1.40651 WP_003409564.1.40653 WP_003409564.1.4067 WP_003409564.1.40723 WP_003409564.1.40731 WP_003409564.1.40735 WP_003409564.1.40795 WP_003409564.1.40799 WP_003409564.1.40852 WP_003409564.1.40876 WP_003409564.1.40881 WP_003409564.1.40922 WP_003409564.1.40948 WP_003409564.1.4095 WP_003409564.1.40956 WP_003409564.1.40957 WP_003409564.1.40964 WP_003409564.1.4097 WP_003409564.1.410 WP_003409564.1.41000 WP_003409564.1.41055 WP_003409564.1.41108 WP_003409564.1.41123 WP_003409564.1.41177 WP_003409564.1.41202 WP_003409564.1.41219 WP_003409564.1.41231 WP_003409564.1.41249 WP_003409564.1.4127 WP_003409564.1.41296 WP_003409564.1.41355 WP_003409564.1.41376 WP_003409564.1.41430 WP_003409564.1.41447 WP_003409564.1.41469 WP_003409564.1.41504 WP_003409564.1.41553 WP_003409564.1.41564 WP_003409564.1.41616 WP_003409564.1.41632 WP_003409564.1.41635 WP_003409564.1.41636 WP_003409564.1.41648 WP_003409564.1.41660 WP_003409564.1.41685 WP_003409564.1.41695 WP_003409564.1.41704 WP_003409564.1.4171 WP_003409564.1.41719 WP_003409564.1.41733 WP_003409564.1.41744 WP_003409564.1.41774 WP_003409564.1.41791 WP_003409564.1.41803 WP_003409564.1.41820 WP_003409564.1.41828 WP_003409564.1.41829 WP_003409564.1.41860 WP_003409564.1.41912 WP_003409564.1.41921 WP_003409564.1.41933 WP_003409564.1.41944 WP_003409564.1.42043 WP_003409564.1.42075 WP_003409564.1.42078 WP_003409564.1.42094 WP_003409564.1.42112 WP_003409564.1.4212 WP_003409564.1.42122 WP_003409564.1.42134 WP_003409564.1.42183 WP_003409564.1.42188 WP_003409564.1.42201 WP_003409564.1.42202 WP_003409564.1.42208 WP_003409564.1.42247 WP_003409564.1.42255 WP_003409564.1.42273 WP_003409564.1.42278 WP_003409564.1.42304 WP_003409564.1.42309 WP_003409564.1.42370 WP_003409564.1.42385 WP_003409564.1.42400 WP_003409564.1.42409 WP_003409564.1.42414 WP_003409564.1.42430 WP_003409564.1.42461 WP_003409564.1.42465 WP_003409564.1.42467 WP_003409564.1.42473 WP_003409564.1.42474 WP_003409564.1.4248 WP_003409564.1.42494 WP_003409564.1.42519 WP_003409564.1.42524 WP_003409564.1.42534 WP_003409564.1.4255 WP_003409564.1.42562 WP_003409564.1.42568 WP_003409564.1.42570 WP_003409564.1.42618 WP_003409564.1.42660 WP_003409564.1.42695 WP_003409564.1.42704 WP_003409564.1.42705 WP_003409564.1.42722 WP_003409564.1.42777 WP_003409564.1.42782 WP_003409564.1.42835 WP_003409564.1.42839 WP_003409564.1.42842 WP_003409564.1.42905 WP_003409564.1.42916 WP_003409564.1.42930 WP_003409564.1.42971 WP_003409564.1.43005 WP_003409564.1.43009 WP_003409564.1.43053 WP_003409564.1.43082 WP_003409564.1.43087 WP_003409564.1.43098 WP_003409564.1.43208 WP_003409564.1.43236 WP_003409564.1.43246 WP_003409564.1.43255 WP_003409564.1.43266 WP_003409564.1.43269 WP_003409564.1.43273 WP_003409564.1.43296 WP_003409564.1.43306 WP_003409564.1.4335 WP_003409564.1.43368 WP_003409564.1.43395 WP_003409564.1.43457 WP_003409564.1.43462 WP_003409564.1.43475 WP_003409564.1.43478 WP_003409564.1.43484 WP_003409564.1.43557 WP_003409564.1.43578 WP_003409564.1.43588 WP_003409564.1.43643 WP_003409564.1.43664 WP_003409564.1.43684 WP_003409564.1.43686 WP_003409564.1.43706 WP_003409564.1.43716 WP_003409564.1.4377 WP_003409564.1.43781 WP_003409564.1.43794 WP_003409564.1.43815 WP_003409564.1.43846 WP_003409564.1.43861 WP_003409564.1.43863 WP_003409564.1.43866 WP_003409564.1.43872 WP_003409564.1.43885 WP_003409564.1.4390 WP_003409564.1.43902 WP_003409564.1.43921 WP_003409564.1.43936 WP_003409564.1.43937 WP_003409564.1.43960 WP_003409564.1.43965 WP_003409564.1.4399 WP_003409564.1.43993 WP_003409564.1.43996 WP_003409564.1.44 WP_003409564.1.44001 WP_003409564.1.44008 WP_003409564.1.44016 WP_003409564.1.44033 WP_003409564.1.44037 WP_003409564.1.44041 WP_003409564.1.44070 WP_003409564.1.44071 WP_003409564.1.44076 WP_003409564.1.44104 WP_003409564.1.44111 WP_003409564.1.44124 WP_003409564.1.44169 WP_003409564.1.44219 WP_003409564.1.44237 WP_003409564.1.44277 WP_003409564.1.44279 WP_003409564.1.44336 WP_003409564.1.44355 WP_003409564.1.44358 WP_003409564.1.4438 WP_003409564.1.44390 WP_003409564.1.44392 WP_003409564.1.4441 WP_003409564.1.44415 WP_003409564.1.44464 WP_003409564.1.44466 WP_003409564.1.44489 WP_003409564.1.44492 WP_003409564.1.44494 WP_003409564.1.44500 WP_003409564.1.44519 WP_003409564.1.44526 WP_003409564.1.44532 WP_003409564.1.44534 WP_003409564.1.44562 WP_003409564.1.44589 WP_003409564.1.44597 WP_003409564.1.44600 WP_003409564.1.44602 WP_003409564.1.44615 WP_003409564.1.4464 WP_003409564.1.44651 WP_003409564.1.44659 WP_003409564.1.44665 WP_003409564.1.44694 WP_003409564.1.44700 WP_003409564.1.44713 WP_003409564.1.44735 WP_003409564.1.44740 WP_003409564.1.44757 WP_003409564.1.4476 WP_003409564.1.44761 WP_003409564.1.44767 WP_003409564.1.44776 WP_003409564.1.44786 WP_003409564.1.44808 WP_003409564.1.44864 WP_003409564.1.44901 WP_003409564.1.44908 WP_003409564.1.44913 WP_003409564.1.4492 WP_003409564.1.44939 WP_003409564.1.44979 WP_003409564.1.44981 WP_003409564.1.45002 WP_003409564.1.45011 WP_003409564.1.4504 WP_003409564.1.45062 WP_003409564.1.45066 WP_003409564.1.45081 WP_003409564.1.45113 WP_003409564.1.45129 WP_003409564.1.45135 WP_003409564.1.45147 WP_003409564.1.45168 WP_003409564.1.4517 WP_003409564.1.45181 WP_003409564.1.45185 WP_003409564.1.45192 WP_003409564.1.45200 WP_003409564.1.45205 WP_003409564.1.45211 WP_003409564.1.45249 WP_003409564.1.4526 WP_003409564.1.45286 WP_003409564.1.45326 WP_003409564.1.45347 WP_003409564.1.45374 WP_003409564.1.45390 WP_003409564.1.454 WP_003409564.1.45407 WP_003409564.1.45451 WP_003409564.1.45453 WP_003409564.1.45460 WP_003409564.1.45463 WP_003409564.1.45470 WP_003409564.1.45474 WP_003409564.1.45491 WP_003409564.1.45510 WP_003409564.1.45563 WP_003409564.1.45584 WP_003409564.1.45590 WP_003409564.1.45619 WP_003409564.1.45626 WP_003409564.1.45631 WP_003409564.1.45666 WP_003409564.1.45697 WP_003409564.1.4571 WP_003409564.1.45731 WP_003409564.1.45743 WP_003409564.1.45765 WP_003409564.1.45776 WP_003409564.1.45783 WP_003409564.1.45805 WP_003409564.1.45815 WP_003409564.1.45849 WP_003409564.1.45867 WP_003409564.1.45884 WP_003409564.1.4590 WP_003409564.1.45923 WP_003409564.1.45926 WP_003409564.1.45963 WP_003409564.1.45989 WP_003409564.1.45992 WP_003409564.1.46025 WP_003409564.1.46083 WP_003409564.1.46090 WP_003409564.1.46092 WP_003409564.1.46100 WP_003409564.1.46101 WP_003409564.1.46103 WP_003409564.1.46107 WP_003409564.1.46127 WP_003409564.1.46128 WP_003409564.1.46129 WP_003409564.1.46141 WP_003409564.1.46150 WP_003409564.1.46201 WP_003409564.1.46226 WP_003409564.1.4624 WP_003409564.1.46253 WP_003409564.1.46268 WP_003409564.1.46285 WP_003409564.1.46300 WP_003409564.1.46313 WP_003409564.1.46336 WP_003409564.1.46365 WP_003409564.1.46370 WP_003409564.1.46381 WP_003409564.1.46402 WP_003409564.1.46411 WP_003409564.1.4644 WP_003409564.1.46442 WP_003409564.1.46453 WP_003409564.1.46463 WP_003409564.1.46478 WP_003409564.1.46492 WP_003409564.1.46521 WP_003409564.1.4653 WP_003409564.1.46532 WP_003409564.1.46539 WP_003409564.1.46568 WP_003409564.1.46585 WP_003409564.1.46609 WP_003409564.1.46613 WP_003409564.1.46625 WP_003409564.1.46642 WP_003409564.1.46647 WP_003409564.1.46674 WP_003409564.1.46724 WP_003409564.1.46758 WP_003409564.1.46773 WP_003409564.1.46777 WP_003409564.1.46786 WP_003409564.1.46792 WP_003409564.1.46847 WP_003409564.1.46851 WP_003409564.1.4687 WP_003409564.1.46897 WP_003409564.1.46936 WP_003409564.1.46980 WP_003409564.1.47011 WP_003409564.1.47012 WP_003409564.1.47066 WP_003409564.1.47077 WP_003409564.1.47083 WP_003409564.1.47106 WP_003409564.1.47142 WP_003409564.1.47147 WP_003409564.1.47166 WP_003409564.1.47178 WP_003409564.1.47179 WP_003409564.1.47194 WP_003409564.1.47207 WP_003409564.1.47210 WP_003409564.1.47261 WP_003409564.1.47262 WP_003409564.1.47402 WP_003409564.1.47423 WP_003409564.1.47467 WP_003409564.1.47502 WP_003409564.1.4751 WP_003409564.1.47511 WP_003409564.1.47537 WP_003409564.1.47540 WP_003409564.1.47568 WP_003409564.1.47572 WP_003409564.1.47588 WP_003409564.1.47636 WP_003409564.1.4764 WP_003409564.1.47653 WP_003409564.1.47679 WP_003409564.1.47681 WP_003409564.1.47690 WP_003409564.1.4771 WP_003409564.1.47717 WP_003409564.1.47743 WP_003409564.1.47754 WP_003409564.1.47773 WP_003409564.1.47776 WP_003409564.1.47780 WP_003409564.1.47805 WP_003409564.1.47832 WP_003409564.1.47847 WP_003409564.1.47858 WP_003409564.1.47893 WP_003409564.1.47899 WP_003409564.1.479 WP_003409564.1.47912 WP_003409564.1.47913 WP_003409564.1.47926 WP_003409564.1.4794 WP_003409564.1.47943 WP_003409564.1.47944 WP_003409564.1.47959 WP_003409564.1.47974 WP_003409564.1.47993 WP_003409564.1.48004 WP_003409564.1.48039 WP_003409564.1.48050 WP_003409564.1.48084 WP_003409564.1.48097 WP_003409564.1.48101 WP_003409564.1.48109 WP_003409564.1.4813 WP_003409564.1.48130 WP_003409564.1.48135 WP_003409564.1.48143 WP_003409564.1.48152 WP_003409564.1.48155 WP_003409564.1.48170 WP_003409564.1.48173 WP_003409564.1.48177 WP_003409564.1.48185 WP_003409564.1.48204 WP_003409564.1.48219 WP_003409564.1.4823 WP_003409564.1.48240 WP_003409564.1.48256 WP_003409564.1.48264 WP_003409564.1.48287 WP_003409564.1.48330 WP_003409564.1.48333 WP_003409564.1.48348 WP_003409564.1.48354 WP_003409564.1.48372 WP_003409564.1.48383 WP_003409564.1.48419 WP_003409564.1.48423 WP_003409564.1.48443 WP_003409564.1.48450 WP_003409564.1.48462 WP_003409564.1.48543 WP_003409564.1.48550 WP_003409564.1.48605 WP_003409564.1.48618 WP_003409564.1.4863 WP_003409564.1.48648 WP_003409564.1.48658 WP_003409564.1.48666 WP_003409564.1.48687 WP_003409564.1.48779 WP_003409564.1.4878 WP_003409564.1.48798 WP_003409564.1.48802 WP_003409564.1.48826 WP_003409564.1.48831 WP_003409564.1.48843 WP_003409564.1.48857 WP_003409564.1.4890 WP_003409564.1.48946 WP_003409564.1.48979 WP_003409564.1.49017 WP_003409564.1.49048 WP_003409564.1.49059 WP_003409564.1.4906 WP_003409564.1.4907 WP_003409564.1.49103 WP_003409564.1.49110 WP_003409564.1.49111 WP_003409564.1.49112 WP_003409564.1.4919 WP_003409564.1.49251 WP_003409564.1.49254 WP_003409564.1.49263 WP_003409564.1.49291 WP_003409564.1.49296 WP_003409564.1.49335 WP_003409564.1.49337 WP_003409564.1.49419 WP_003409564.1.49426 WP_003409564.1.49437 WP_003409564.1.49439 WP_003409564.1.49474 WP_003409564.1.49506 WP_003409564.1.49516 WP_003409564.1.49523 WP_003409564.1.49526 WP_003409564.1.49532 WP_003409564.1.49588 WP_003409564.1.4959 WP_003409564.1.49687 WP_003409564.1.49699 WP_003409564.1.49709 WP_003409564.1.4971 WP_003409564.1.4972 WP_003409564.1.49736 WP_003409564.1.49746 WP_003409564.1.49764 WP_003409564.1.49773 WP_003409564.1.49796 WP_003409564.1.49814 WP_003409564.1.49815 WP_003409564.1.49816 WP_003409564.1.49839 WP_003409564.1.49857 WP_003409564.1.49878 WP_003409564.1.49880 WP_003409564.1.49944 WP_003409564.1.4999 WP_003409564.1.49990 WP_003409564.1.50068 WP_003409564.1.50077 WP_003409564.1.5008 WP_003409564.1.50081 WP_003409564.1.50122 WP_003409564.1.50126 WP_003409564.1.50149 WP_003409564.1.50162 WP_003409564.1.5018 WP_003409564.1.50194 WP_003409564.1.50218 WP_003409564.1.50235 WP_003409564.1.50249 WP_003409564.1.50265 WP_003409564.1.50271 WP_003409564.1.50324 WP_003409564.1.50347 WP_003409564.1.50372 WP_003409564.1.50398 WP_003409564.1.50407 WP_003409564.1.50444 WP_003409564.1.50466 WP_003409564.1.50472 WP_003409564.1.5048 WP_003409564.1.50498 WP_003409564.1.5050 WP_003409564.1.50540 WP_003409564.1.50554 WP_003409564.1.50557 WP_003409564.1.50601 WP_003409564.1.50610 WP_003409564.1.50633 WP_003409564.1.50642 WP_003409564.1.50655 WP_003409564.1.50659 WP_003409564.1.50683 WP_003409564.1.50689 WP_003409564.1.50692 WP_003409564.1.50714 WP_003409564.1.50729 WP_003409564.1.50756 WP_003409564.1.50784 WP_003409564.1.50794 WP_003409564.1.50841 WP_003409564.1.50860 WP_003409564.1.50868 WP_003409564.1.50877 WP_003409564.1.5096 WP_003409564.1.50981 WP_003409564.1.50987 WP_003409564.1.51003 WP_003409564.1.51009 WP_003409564.1.51037 WP_003409564.1.51074 WP_003409564.1.51082 WP_003409564.1.51101 WP_003409564.1.51116 WP_003409564.1.51149 WP_003409564.1.51156 WP_003409564.1.51157 WP_003409564.1.51213 WP_003409564.1.51232 WP_003409564.1.51239 WP_003409564.1.51247 WP_003409564.1.51266 WP_003409564.1.51279 WP_003409564.1.51291 WP_003409564.1.51294 WP_003409564.1.51301 WP_003409564.1.51329 WP_003409564.1.51391 WP_003409564.1.51422 WP_003409564.1.51445 WP_003409564.1.51455 WP_003409564.1.51466 WP_003409564.1.51468 WP_003409564.1.51478 WP_003409564.1.51497 WP_003409564.1.51520 WP_003409564.1.51593 WP_003409564.1.51628 WP_003409564.1.5164 WP_003409564.1.51647 WP_003409564.1.51660 WP_003409564.1.51696 WP_003409564.1.51721 WP_003409564.1.51788 WP_003409564.1.51795 WP_003409564.1.51801 WP_003409564.1.51817 WP_003409564.1.51819 WP_003409564.1.51854 WP_003409564.1.51923 WP_003409564.1.51942 WP_003409564.1.51948 WP_003409564.1.51963 WP_003409564.1.51969 WP_003409564.1.52000 WP_003409564.1.52001 WP_003409564.1.52003 WP_003409564.1.52006 WP_003409564.1.52036 WP_003409564.1.52038 WP_003409564.1.52046 WP_003409564.1.52059 WP_003409564.1.52069 WP_003409564.1.52082 WP_003409564.1.52102 WP_003409564.1.52106 WP_003409564.1.52166 WP_003409564.1.52168 WP_003409564.1.52173 WP_003409564.1.52178 WP_003409564.1.52206 WP_003409564.1.52216 WP_003409564.1.52238 WP_003409564.1.52241 WP_003409564.1.52280 WP_003409564.1.52314 WP_003409564.1.52385 WP_003409564.1.52390 WP_003409564.1.524 WP_003409564.1.52460 WP_003409564.1.52485 WP_003409564.1.52486 WP_003409564.1.52495 WP_003409564.1.52504 WP_003409564.1.52522 WP_003409564.1.52531 WP_003409564.1.52533 WP_003409564.1.52545 WP_003409564.1.52553 WP_003409564.1.52563 WP_003409564.1.52564 WP_003409564.1.52574 WP_003409564.1.52641 WP_003409564.1.52673 WP_003409564.1.52674 WP_003409564.1.52708 WP_003409564.1.52713 WP_003409564.1.52761 WP_003409564.1.52778 WP_003409564.1.52791 WP_003409564.1.52797 WP_003409564.1.52818 WP_003409564.1.52872 WP_003409564.1.52873 WP_003409564.1.52891 WP_003409564.1.52892 WP_003409564.1.52909 WP_003409564.1.52970 WP_003409564.1.52998 WP_003409564.1.53053 WP_003409564.1.53056 WP_003409564.1.5306 WP_003409564.1.53088 WP_003409564.1.5309 WP_003409564.1.531 WP_003409564.1.53117 WP_003409564.1.53118 WP_003409564.1.53142 WP_003409564.1.53143 WP_003409564.1.53157 WP_003409564.1.53167 WP_003409564.1.53200 WP_003409564.1.53204 WP_003409564.1.53213 WP_003409564.1.53217 WP_003409564.1.53226 WP_003409564.1.53229 WP_003409564.1.53230 WP_003409564.1.53237 WP_003409564.1.53254 WP_003409564.1.53257 WP_003409564.1.5327 WP_003409564.1.53276 WP_003409564.1.53278 WP_003409564.1.533 WP_003409564.1.53302 WP_003409564.1.53306 WP_003409564.1.5334 WP_003409564.1.5335 WP_003409564.1.53353 WP_003409564.1.53381 WP_003409564.1.53413 WP_003409564.1.53458 WP_003409564.1.53460 WP_003409564.1.53480 WP_003409564.1.53517 WP_003409564.1.53522 WP_003409564.1.53525 WP_003409564.1.53526 WP_003409564.1.53553 WP_003409564.1.53606 WP_003409564.1.53609 WP_003409564.1.53628 WP_003409564.1.53643 WP_003409564.1.53667 WP_003409564.1.53679 WP_003409564.1.53715 WP_003409564.1.53730 WP_003409564.1.53742 WP_003409564.1.53743 WP_003409564.1.53754 WP_003409564.1.53775 WP_003409564.1.53787 WP_003409564.1.53803 WP_003409564.1.53818 WP_003409564.1.53853 WP_003409564.1.53865 WP_003409564.1.53888 WP_003409564.1.53900 WP_003409564.1.53912 WP_003409564.1.53914 WP_003409564.1.53952 WP_003409564.1.53973 WP_003409564.1.5398 WP_003409564.1.5408 WP_003409564.1.54089 WP_003409564.1.54093 WP_003409564.1.54099 WP_003409564.1.54112 WP_003409564.1.54125 WP_003409564.1.54141 WP_003409564.1.54162 WP_003409564.1.54179 WP_003409564.1.54206 WP_003409564.1.54218 WP_003409564.1.54225 WP_003409564.1.54227 WP_003409564.1.54232 WP_003409564.1.54241 WP_003409564.1.54245 WP_003409564.1.54247 WP_003409564.1.54260 WP_003409564.1.54275 WP_003409564.1.54280 WP_003409564.1.5429 WP_003409564.1.54294 WP_003409564.1.54314 WP_003409564.1.54347 WP_003409564.1.54351 WP_003409564.1.54370 WP_003409564.1.54428 WP_003409564.1.54449 WP_003409564.1.54494 WP_003409564.1.54502 WP_003409564.1.54514 WP_003409564.1.54519 WP_003409564.1.5452 WP_003409564.1.54531 WP_003409564.1.54537 WP_003409564.1.54553 WP_003409564.1.54555 WP_003409564.1.54575 WP_003409564.1.54633 WP_003409564.1.54686 WP_003409564.1.54687 WP_003409564.1.54705 WP_003409564.1.54730 WP_003409564.1.54732 WP_003409564.1.5475 WP_003409564.1.54797 WP_003409564.1.54807 WP_003409564.1.54836 WP_003409564.1.54838 WP_003409564.1.54860 WP_003409564.1.54888 WP_003409564.1.54897 WP_003409564.1.54905 WP_003409564.1.54909 WP_003409564.1.54937 WP_003409564.1.54939 WP_003409564.1.54944 WP_003409564.1.54945 WP_003409564.1.54953 WP_003409564.1.54964 WP_003409564.1.55015 WP_003409564.1.55022 WP_003409564.1.55023 WP_003409564.1.55051 WP_003409564.1.55072 WP_003409564.1.55088 WP_003409564.1.55106 WP_003409564.1.55126 WP_003409564.1.55128 WP_003409564.1.55140 WP_003409564.1.55150 WP_003409564.1.55210 WP_003409564.1.55227 WP_003409564.1.55248 WP_003409564.1.55257 WP_003409564.1.55258 WP_003409564.1.55267 WP_003409564.1.55279 WP_003409564.1.55307 WP_003409564.1.55326 WP_003409564.1.55328 WP_003409564.1.5533 WP_003409564.1.55345 WP_003409564.1.55396 WP_003409564.1.55398 WP_003409564.1.55441 WP_003409564.1.55459 WP_003409564.1.55501 WP_003409564.1.55504 WP_003409564.1.55578 WP_003409564.1.55626 WP_003409564.1.55641 WP_003409564.1.5569 WP_003409564.1.55723 WP_003409564.1.55735 WP_003409564.1.5574 WP_003409564.1.55772 WP_003409564.1.55802 WP_003409564.1.55819 WP_003409564.1.55821 WP_003409564.1.5583 WP_003409564.1.55849 WP_003409564.1.55856 WP_003409564.1.55860 WP_003409564.1.55882 WP_003409564.1.55883 WP_003409564.1.55894 WP_003409564.1.55902 WP_003409564.1.55908 WP_003409564.1.55909 WP_003409564.1.5591 WP_003409564.1.55961 WP_003409564.1.55977 WP_003409564.1.55983 WP_003409564.1.56028 WP_003409564.1.56057 WP_003409564.1.56060 WP_003409564.1.56107 WP_003409564.1.56132 WP_003409564.1.56163 WP_003409564.1.56167 WP_003409564.1.56178 WP_003409564.1.56287 WP_003409564.1.56292 WP_003409564.1.56327 WP_003409564.1.56341 WP_003409564.1.56359 WP_003409564.1.56365 WP_003409564.1.56394 WP_003409564.1.56443 WP_003409564.1.56473 WP_003409564.1.56478 WP_003409564.1.56500 WP_003409564.1.56517 WP_003409564.1.56534 WP_003409564.1.5656 WP_003409564.1.56577 WP_003409564.1.56593 WP_003409564.1.56625 WP_003409564.1.56637 WP_003409564.1.56670 WP_003409564.1.56697 WP_003409564.1.567 WP_003409564.1.56701 WP_003409564.1.56709 WP_003409564.1.56743 WP_003409564.1.56755 WP_003409564.1.56764 WP_003409564.1.56769 WP_003409564.1.56795 WP_003409564.1.5681 WP_003409564.1.56827 WP_003409564.1.56839 WP_003409564.1.56863 WP_003409564.1.56868 WP_003409564.1.56869 WP_003409564.1.56915 WP_003409564.1.56926 WP_003409564.1.56961 WP_003409564.1.56971 WP_003409564.1.56972 WP_003409564.1.57023 WP_003409564.1.57035 WP_003409564.1.57077 WP_003409564.1.57087 WP_003409564.1.57094 WP_003409564.1.57134 WP_003409564.1.57151 WP_003409564.1.57169 WP_003409564.1.57208 WP_003409564.1.57212 WP_003409564.1.57230 WP_003409564.1.5724 WP_003409564.1.5725 WP_003409564.1.5727 WP_003409564.1.57273 WP_003409564.1.573 WP_003409564.1.57314 WP_003409564.1.57326 WP_003409564.1.57328 WP_003409564.1.57331 WP_003409564.1.57340 WP_003409564.1.57351 WP_003409564.1.57352 WP_003409564.1.57380 WP_003409564.1.57430 WP_003409564.1.5744 WP_003409564.1.57440 WP_003409564.1.5745 WP_003409564.1.57461 WP_003409564.1.57469 WP_003409564.1.57489 WP_003409564.1.575 WP_003409564.1.57509 WP_003409564.1.57519 WP_003409564.1.57525 WP_003409564.1.57551 WP_003409564.1.5758 WP_003409564.1.57596 WP_003409564.1.57604 WP_003409564.1.57617 WP_003409564.1.57619 WP_003409564.1.57627 WP_003409564.1.57642 WP_003409564.1.57658 WP_003409564.1.57667 WP_003409564.1.57675 WP_003409564.1.57689 WP_003409564.1.57708 WP_003409564.1.57794 WP_003409564.1.57821 WP_003409564.1.57825 WP_003409564.1.57843 WP_003409564.1.57906 WP_003409564.1.57924 WP_003409564.1.57926 WP_003409564.1.57930 WP_003409564.1.57957 WP_003409564.1.57960 WP_003409564.1.57964 WP_003409564.1.57991 WP_003409564.1.58086 WP_003409564.1.58101 WP_003409564.1.58103 WP_003409564.1.58108 WP_003409564.1.5811 WP_003409564.1.58121 WP_003409564.1.58145 WP_003409564.1.58164 WP_003409564.1.58174 WP_003409564.1.582 WP_003409564.1.58202 WP_003409564.1.58209 WP_003409564.1.58215 WP_003409564.1.5824 WP_003409564.1.58250 WP_003409564.1.58259 WP_003409564.1.58283 WP_003409564.1.58288 WP_003409564.1.5830 WP_003409564.1.58303 WP_003409564.1.58311 WP_003409564.1.58330 WP_003409564.1.58359 WP_003409564.1.58386 WP_003409564.1.58393 WP_003409564.1.58431 WP_003409564.1.5844 WP_003409564.1.58457 WP_003409564.1.58488 WP_003409564.1.58518 WP_003409564.1.58534 WP_003409564.1.58559 WP_003409564.1.58567 WP_003409564.1.58573 WP_003409564.1.58602 WP_003409564.1.58612 WP_003409564.1.58619 WP_003409564.1.58630 WP_003409564.1.5865 WP_003409564.1.58671 WP_003409564.1.58690 WP_003409564.1.58702 WP_003409564.1.58743 WP_003409564.1.58754 WP_003409564.1.5879 WP_003409564.1.5881 WP_003409564.1.58824 WP_003409564.1.58848 WP_003409564.1.58857 WP_003409564.1.58891 WP_003409564.1.58892 WP_003409564.1.5890 WP_003409564.1.58904 WP_003409564.1.58921 WP_003409564.1.58930 WP_003409564.1.58939 WP_003409564.1.58941 WP_003409564.1.58953 WP_003409564.1.58961 WP_003409564.1.5898 WP_003409564.1.59025 WP_003409564.1.59029 WP_003409564.1.59037 WP_003409564.1.59044 WP_003409564.1.59085 WP_003409564.1.59088 WP_003409564.1.59112 WP_003409564.1.59130 WP_003409564.1.5914 WP_003409564.1.59147 WP_003409564.1.59166 WP_003409564.1.59205 WP_003409564.1.59209 WP_003409564.1.59237 WP_003409564.1.59240 WP_003409564.1.59253 WP_003409564.1.59254 WP_003409564.1.59262 WP_003409564.1.59270 WP_003409564.1.5928 WP_003409564.1.59304 WP_003409564.1.59305 WP_003409564.1.59309 WP_003409564.1.59316 WP_003409564.1.59326 WP_003409564.1.59328 WP_003409564.1.59333 WP_003409564.1.59338 WP_003409564.1.59388 WP_003409564.1.59428 WP_003409564.1.59487 WP_003409564.1.59537 WP_003409564.1.59561 WP_003409564.1.59677 WP_003409564.1.59722 WP_003409564.1.59727 WP_003409564.1.59732 WP_003409564.1.59738 WP_003409564.1.59750 WP_003409564.1.59757 WP_003409564.1.59761 WP_003409564.1.59808 WP_003409564.1.59850 WP_003409564.1.59856 WP_003409564.1.59860 WP_003409564.1.59861 WP_003409564.1.5987 WP_003409564.1.59878 WP_003409564.1.59888 WP_003409564.1.59952 WP_003409564.1.5996 WP_003409564.1.59961 WP_003409564.1.59974 WP_003409564.1.6000 WP_003409564.1.60007 WP_003409564.1.60016 WP_003409564.1.6003 WP_003409564.1.60047 WP_003409564.1.6007 WP_003409564.1.60091 WP_003409564.1.60121 WP_003409564.1.60125 WP_003409564.1.60135 WP_003409564.1.60139 WP_003409564.1.60152 WP_003409564.1.60171 WP_003409564.1.60197 WP_003409564.1.6020 WP_003409564.1.60205 WP_003409564.1.60207 WP_003409564.1.60215 WP_003409564.1.60217 WP_003409564.1.60267 WP_003409564.1.60288 WP_003409564.1.60291 WP_003409564.1.60301 WP_003409564.1.60305 WP_003409564.1.60312 WP_003409564.1.60313 WP_003409564.1.60314 WP_003409564.1.60367 WP_003409564.1.60376 WP_003409564.1.60403 WP_003409564.1.60413 WP_003409564.1.60421 WP_003409564.1.60451 WP_003409564.1.60460 WP_003409564.1.60479 WP_003409564.1.60487 WP_003409564.1.60512 WP_003409564.1.60573 WP_003409564.1.60583 WP_003409564.1.60632 WP_003409564.1.60657 WP_003409564.1.60687 WP_003409564.1.60689 WP_003409564.1.60727 WP_003409564.1.60738 WP_003409564.1.60763 WP_003409564.1.6077 WP_003409564.1.60791 WP_003409564.1.60834 WP_003409564.1.60870 WP_003409564.1.60878 WP_003409564.1.60879 WP_003409564.1.60913 WP_003409564.1.60978 WP_003409564.1.61000 WP_003409564.1.61001 WP_003409564.1.61012 WP_003409564.1.61014 WP_003409564.1.61015 WP_003409564.1.61037 WP_003409564.1.61052 WP_003409564.1.61065 WP_003409564.1.61100 WP_003409564.1.61101 WP_003409564.1.61138 WP_003409564.1.61142 WP_003409564.1.61198 WP_003409564.1.612 WP_003409564.1.61234 WP_003409564.1.61281 WP_003409564.1.61314 WP_003409564.1.61321 WP_003409564.1.61326 WP_003409564.1.61328 WP_003409564.1.61368 WP_003409564.1.61391 WP_003409564.1.61406 WP_003409564.1.61409 WP_003409564.1.61420 WP_003409564.1.61422 WP_003409564.1.61425 WP_003409564.1.61428 WP_003409564.1.61469 WP_003409564.1.61494 WP_003409564.1.61522 WP_003409564.1.61552 WP_003409564.1.61557 WP_003409564.1.61567 WP_003409564.1.61571 WP_003409564.1.61573 WP_003409564.1.61584 WP_003409564.1.61586 WP_003409564.1.6159 WP_003409564.1.61592 WP_003409564.1.6160 WP_003409564.1.61614 WP_003409564.1.6163 WP_003409564.1.61655 WP_003409564.1.61665 WP_003409564.1.61669 WP_003409564.1.61682 WP_003409564.1.61692 WP_003409564.1.61719 WP_003409564.1.61728 WP_003409564.1.61750 WP_003409564.1.61754 WP_003409564.1.61755 WP_003409564.1.61757 WP_003409564.1.6179 WP_003409564.1.61793 WP_003409564.1.61816 WP_003409564.1.61842 WP_003409564.1.61850 WP_003409564.1.61862 WP_003409564.1.61865 WP_003409564.1.61868 WP_003409564.1.61911 WP_003409564.1.61925 WP_003409564.1.61941 WP_003409564.1.61953 WP_003409564.1.61979 WP_003409564.1.61986 WP_003409564.1.61987 WP_003409564.1.61998 WP_003409564.1.62021 WP_003409564.1.62087 WP_003409564.1.62089 WP_003409564.1.62101 WP_003409564.1.62104 WP_003409564.1.6211 WP_003409564.1.62132 WP_003409564.1.62162 WP_003409564.1.62225 WP_003409564.1.62230 WP_003409564.1.62238 WP_003409564.1.62249 WP_003409564.1.62270 WP_003409564.1.62281 WP_003409564.1.62307 WP_003409564.1.6231 WP_003409564.1.62359 WP_003409564.1.62360 WP_003409564.1.62371 WP_003409564.1.62379 WP_003409564.1.62395 WP_003409564.1.62408 WP_003409564.1.62449 WP_003409564.1.62468 WP_003409564.1.6248 WP_003409564.1.62508 WP_003409564.1.62565 WP_003409564.1.62594 WP_003409564.1.62606 WP_003409564.1.62616 WP_003409564.1.62666 WP_003409564.1.62687 WP_003409564.1.62715 WP_003409564.1.62730 WP_003409564.1.62738 WP_003409564.1.62761 WP_003409564.1.62766 WP_003409564.1.62786 WP_003409564.1.62813 WP_003409564.1.62839 WP_003409564.1.62841 WP_003409564.1.62909 WP_003409564.1.62936 WP_003409564.1.6294 WP_003409564.1.6295 WP_003409564.1.62962 WP_003409564.1.63007 WP_003409564.1.63019 WP_003409564.1.63032 WP_003409564.1.63037 WP_003409564.1.63064 WP_003409564.1.63066 WP_003409564.1.63072 WP_003409564.1.6308 WP_003409564.1.63081 WP_003409564.1.63096 WP_003409564.1.63106 WP_003409564.1.6314 WP_003409564.1.63144 WP_003409564.1.63154 WP_003409564.1.63160 WP_003409564.1.63161 WP_003409564.1.63166 WP_003409564.1.63175 WP_003409564.1.63194 WP_003409564.1.6322 WP_003409564.1.63222 WP_003409564.1.63247 WP_003409564.1.6328 WP_003409564.1.63291 WP_003409564.1.63312 WP_003409564.1.63317 WP_003409564.1.63331 WP_003409564.1.63373 WP_003409564.1.63384 WP_003409564.1.63403 WP_003409564.1.63424 WP_003409564.1.63428 WP_003409564.1.6345 WP_003409564.1.63464 WP_003409564.1.63483 WP_003409564.1.63502 WP_003409564.1.63504 WP_003409564.1.63522 WP_003409564.1.63530 WP_003409564.1.63538 WP_003409564.1.63564 WP_003409564.1.63567 WP_003409564.1.63596 WP_003409564.1.63600 WP_003409564.1.63623 WP_003409564.1.63624 WP_003409564.1.63625 WP_003409564.1.63627 WP_003409564.1.63654 WP_003409564.1.63662 WP_003409564.1.63711 WP_003409564.1.63734 WP_003409564.1.63807 WP_003409564.1.63819 WP_003409564.1.63844 WP_003409564.1.63888 WP_003409564.1.63913 WP_003409564.1.63915 WP_003409564.1.63918 WP_003409564.1.63961 WP_003409564.1.63970 WP_003409564.1.64000 WP_003409564.1.64027 WP_003409564.1.64058 WP_003409564.1.64065 WP_003409564.1.6407 WP_003409564.1.64082 WP_003409564.1.64091 WP_003409564.1.64102 WP_003409564.1.64104 WP_003409564.1.64119 WP_003409564.1.64169 WP_003409564.1.64219 WP_003409564.1.6422 WP_003409564.1.64222 WP_003409564.1.64223 WP_003409564.1.64228 WP_003409564.1.64235 WP_003409564.1.64249 WP_003409564.1.6427 WP_003409564.1.64278 WP_003409564.1.64287 WP_003409564.1.64414 WP_003409564.1.64419 WP_003409564.1.6443 WP_003409564.1.64463 WP_003409564.1.64480 WP_003409564.1.64497 WP_003409564.1.64506 WP_003409564.1.64511 WP_003409564.1.64513 WP_003409564.1.64514 WP_003409564.1.64515 WP_003409564.1.64522 WP_003409564.1.64526 WP_003409564.1.64543 WP_003409564.1.6456 WP_003409564.1.64567 WP_003409564.1.64588 WP_003409564.1.64589 WP_003409564.1.64594 WP_003409564.1.64595 WP_003409564.1.64608 WP_003409564.1.64619 WP_003409564.1.64629 WP_003409564.1.6464 WP_003409564.1.64664 WP_003409564.1.64669 WP_003409564.1.64672 WP_003409564.1.64680 WP_003409564.1.64682 WP_003409564.1.64727 WP_003409564.1.64729 WP_003409564.1.64774 WP_003409564.1.64776 WP_003409564.1.64802 WP_003409564.1.64832 WP_003409564.1.6486 WP_003409564.1.64870 WP_003409564.1.64898 WP_003409564.1.64922 WP_003409564.1.64924 WP_003409564.1.6493 WP_003409564.1.64937 WP_003409564.1.64941 WP_003409564.1.64966 WP_003409564.1.64973 WP_003409564.1.65001 WP_003409564.1.65026 WP_003409564.1.65070 WP_003409564.1.65079 WP_003409564.1.65102 WP_003409564.1.65157 WP_003409564.1.65181 WP_003409564.1.65212 WP_003409564.1.65229 WP_003409564.1.6523 WP_003409564.1.65253 WP_003409564.1.65289 WP_003409564.1.65291 WP_003409564.1.65315 WP_003409564.1.65329 WP_003409564.1.6536 WP_003409564.1.65374 WP_003409564.1.65386 WP_003409564.1.65414 WP_003409564.1.65416 WP_003409564.1.65433 WP_003409564.1.65455 WP_003409564.1.65467 WP_003409564.1.65488 WP_003409564.1.65529 WP_003409564.1.65539 WP_003409564.1.65583 WP_003409564.1.65612 WP_003409564.1.65623 WP_003409564.1.65635 WP_003409564.1.65637 WP_003409564.1.65648 WP_003409564.1.65683 WP_003409564.1.65686 WP_003409564.1.65688 WP_003409564.1.65707 WP_003409564.1.65733 WP_003409564.1.65746 WP_003409564.1.65747 WP_003409564.1.65759 WP_003409564.1.65816 WP_003409564.1.65830 WP_003409564.1.65858 WP_003409564.1.65862 WP_003409564.1.65869 WP_003409564.1.65893 WP_003409564.1.65929 WP_003409564.1.65932 WP_003409564.1.65958 WP_003409564.1.65974 WP_003409564.1.66004 WP_003409564.1.6606 WP_003409564.1.66089 WP_003409564.1.66149 WP_003409564.1.66151 WP_003409564.1.66229 WP_003409564.1.66276 WP_003409564.1.66293 WP_003409564.1.66297 WP_003409564.1.66323 WP_003409564.1.66325 WP_003409564.1.6633 WP_003409564.1.66334 WP_003409564.1.66355 WP_003409564.1.66367 WP_003409564.1.66394 WP_003409564.1.66396 WP_003409564.1.66451 WP_003409564.1.66455 WP_003409564.1.66457 WP_003409564.1.66460 WP_003409564.1.66464 WP_003409564.1.66466 WP_003409564.1.66487 WP_003409564.1.66504 WP_003409564.1.66544 WP_003409564.1.66558 WP_003409564.1.66580 WP_003409564.1.66582 WP_003409564.1.66612 WP_003409564.1.66615 WP_003409564.1.66617 WP_003409564.1.66635 WP_003409564.1.66656 WP_003409564.1.66663 WP_003409564.1.66675 WP_003409564.1.66715 WP_003409564.1.66718 WP_003409564.1.66762 WP_003409564.1.66776 WP_003409564.1.66808 WP_003409564.1.66817 WP_003409564.1.66819 WP_003409564.1.66826 WP_003409564.1.66830 WP_003409564.1.66842 WP_003409564.1.66868 WP_003409564.1.66878 WP_003409564.1.66880 WP_003409564.1.66893 WP_003409564.1.66961 WP_003409564.1.67005 WP_003409564.1.6704 WP_003409564.1.67044 WP_003409564.1.67061 WP_003409564.1.67089 WP_003409564.1.67098 WP_003409564.1.67146 WP_003409564.1.67170 WP_003409564.1.67197 WP_003409564.1.67198 WP_003409564.1.6720 WP_003409564.1.67207 WP_003409564.1.67218 WP_003409564.1.67220 WP_003409564.1.67225 WP_003409564.1.67231 WP_003409564.1.6724 WP_003409564.1.67257 WP_003409564.1.67298 WP_003409564.1.67307 WP_003409564.1.67324 WP_003409564.1.67332 WP_003409564.1.67346 WP_003409564.1.67354 WP_003409564.1.67360 WP_003409564.1.67381 WP_003409564.1.67396 WP_003409564.1.67417 WP_003409564.1.67422 WP_003409564.1.67453 WP_003409564.1.67459 WP_003409564.1.6746 WP_003409564.1.67473 WP_003409564.1.67481 WP_003409564.1.67482 WP_003409564.1.67496 WP_003409564.1.67499 WP_003409564.1.67516 WP_003409564.1.67523 WP_003409564.1.67536 WP_003409564.1.67575 WP_003409564.1.67587 WP_003409564.1.67598 WP_003409564.1.67600 WP_003409564.1.67602 WP_003409564.1.67630 WP_003409564.1.67679 WP_003409564.1.67692 WP_003409564.1.67744 WP_003409564.1.6775 WP_003409564.1.67750 WP_003409564.1.6777 WP_003409564.1.67809 WP_003409564.1.67816 WP_003409564.1.67844 WP_003409564.1.67848 WP_003409564.1.67870 WP_003409564.1.67888 WP_003409564.1.67915 WP_003409564.1.67945 WP_003409564.1.67949 WP_003409564.1.67980 WP_003409564.1.67982 WP_003409564.1.68022 WP_003409564.1.68029 WP_003409564.1.68037 WP_003409564.1.68038 WP_003409564.1.68045 WP_003409564.1.68057 WP_003409564.1.68083 WP_003409564.1.68088 WP_003409564.1.68106 WP_003409564.1.68110 WP_003409564.1.68153 WP_003409564.1.68164 WP_003409564.1.68169 WP_003409564.1.68193 WP_003409564.1.68212 WP_003409564.1.68227 WP_003409564.1.68243 WP_003409564.1.6825 WP_003409564.1.68297 WP_003409564.1.68309 WP_003409564.1.68325 WP_003409564.1.68329 WP_003409564.1.68340 WP_003409564.1.68384 WP_003409564.1.68388 WP_003409564.1.68429 WP_003409564.1.6843 WP_003409564.1.68433 WP_003409564.1.68444 WP_003409564.1.68465 WP_003409564.1.68484 WP_003409564.1.68518 WP_003409564.1.68569 WP_003409564.1.68576 WP_003409564.1.68580 WP_003409564.1.68586 WP_003409564.1.68623 WP_003409564.1.68624 WP_003409564.1.68637 WP_003409564.1.68646 WP_003409564.1.68667 WP_003409564.1.68669 WP_003409564.1.68672 WP_003409564.1.68684 WP_003409564.1.68704 WP_003409564.1.68708 WP_003409564.1.6872 WP_003409564.1.68730 WP_003409564.1.68734 WP_003409564.1.68748 WP_003409564.1.68754 WP_003409564.1.6876 WP_003409564.1.68761 WP_003409564.1.68763 WP_003409564.1.68766 WP_003409564.1.68774 WP_003409564.1.68796 WP_003409564.1.68824 WP_003409564.1.68832 WP_003409564.1.68833 WP_003409564.1.68841 WP_003409564.1.68859 WP_003409564.1.68876 WP_003409564.1.68906 WP_003409564.1.68916 WP_003409564.1.68923 WP_003409564.1.68945 WP_003409564.1.6896 WP_003409564.1.68981 WP_003409564.1.68984 WP_003409564.1.68997 WP_003409564.1.69008 WP_003409564.1.69076 WP_003409564.1.69079 WP_003409564.1.6908 WP_003409564.1.69082 WP_003409564.1.69178 WP_003409564.1.69181 WP_003409564.1.69208 WP_003409564.1.69231 WP_003409564.1.69256 WP_003409564.1.69311 WP_003409564.1.69315 WP_003409564.1.69322 WP_003409564.1.69342 WP_003409564.1.6936 WP_003409564.1.69369 WP_003409564.1.69374 WP_003409564.1.69398 WP_003409564.1.69401 WP_003409564.1.69426 WP_003409564.1.69427 WP_003409564.1.69429 WP_003409564.1.6949 WP_003409564.1.6951 WP_003409564.1.69511 WP_003409564.1.69526 WP_003409564.1.69528 WP_003409564.1.69547 WP_003409564.1.69573 WP_003409564.1.69581 WP_003409564.1.6960 WP_003409564.1.69617 WP_003409564.1.69634 WP_003409564.1.69647 WP_003409564.1.69659 WP_003409564.1.69673 WP_003409564.1.69682 WP_003409564.1.69684 WP_003409564.1.69686 WP_003409564.1.69707 WP_003409564.1.69709 WP_003409564.1.69723 WP_003409564.1.69736 WP_003409564.1.69778 WP_003409564.1.69800 WP_003409564.1.69802 WP_003409564.1.69845 WP_003409564.1.69870 WP_003409564.1.69873 WP_003409564.1.69898 WP_003409564.1.69913 WP_003409564.1.69925 WP_003409564.1.69931 WP_003409564.1.69938 WP_003409564.1.69955 WP_003409564.1.69957 WP_003409564.1.69981 WP_003409564.1.69990 WP_003409564.1.70 WP_003409564.1.70000 WP_003409564.1.70017 WP_003409564.1.70032 WP_003409564.1.70055 WP_003409564.1.70062 WP_003409564.1.70072 WP_003409564.1.70131 WP_003409564.1.70132 WP_003409564.1.7022 WP_003409564.1.70227 WP_003409564.1.70255 WP_003409564.1.70271 WP_003409564.1.70274 WP_003409564.1.7029 WP_003409564.1.70325 WP_003409564.1.70328 WP_003409564.1.70356 WP_003409564.1.70364 WP_003409564.1.70368 WP_003409564.1.70369 WP_003409564.1.70418 WP_003409564.1.70422 WP_003409564.1.70435 WP_003409564.1.70444 WP_003409564.1.70463 WP_003409564.1.70471 WP_003409564.1.70480 WP_003409564.1.70494 WP_003409564.1.70498 WP_003409564.1.70505 WP_003409564.1.70525 WP_003409564.1.70573 WP_003409564.1.70577 WP_003409564.1.70610 WP_003409564.1.70615 WP_003409564.1.70618 WP_003409564.1.70622 WP_003409564.1.70626 WP_003409564.1.70668 WP_003409564.1.70699 WP_003409564.1.70704 WP_003409564.1.70729 WP_003409564.1.70757 WP_003409564.1.70782 WP_003409564.1.70796 WP_003409564.1.70830 WP_003409564.1.70834 WP_003409564.1.7084 WP_003409564.1.70840 WP_003409564.1.70864 WP_003409564.1.70871 WP_003409564.1.70915 WP_003409564.1.70958 WP_003409564.1.70964 WP_003409564.1.70976 WP_003409564.1.71015 WP_003409564.1.71026 WP_003409564.1.71063 WP_003409564.1.71076 WP_003409564.1.71083 WP_003409564.1.7111 WP_003409564.1.71118 WP_003409564.1.71128 WP_003409564.1.7113 WP_003409564.1.71187 WP_003409564.1.71191 WP_003409564.1.71255 WP_003409564.1.71258 WP_003409564.1.71259 WP_003409564.1.71289 WP_003409564.1.71326 WP_003409564.1.71329 WP_003409564.1.71331 WP_003409564.1.71344 WP_003409564.1.71390 WP_003409564.1.71399 WP_003409564.1.71414 WP_003409564.1.71440 WP_003409564.1.71457 WP_003409564.1.7146 WP_003409564.1.71464 WP_003409564.1.71492 WP_003409564.1.71509 WP_003409564.1.71516 WP_003409564.1.71517 WP_003409564.1.71527 WP_003409564.1.71532 WP_003409564.1.71545 WP_003409564.1.71546 WP_003409564.1.71569 WP_003409564.1.71604 WP_003409564.1.71630 WP_003409564.1.71638 WP_003409564.1.71654 WP_003409564.1.71664 WP_003409564.1.71665 WP_003409564.1.71683 WP_003409564.1.71701 WP_003409564.1.71718 WP_003409564.1.71731 WP_003409564.1.71778 WP_003409564.1.71781 WP_003409564.1.71803 WP_003409564.1.71820 WP_003409564.1.71847 WP_003409564.1.7185 WP_003409564.1.71851 WP_003409564.1.71871 WP_003409564.1.71909 WP_003409564.1.71957 WP_003409564.1.71970 WP_003409564.1.72047 WP_003409564.1.72061 WP_003409564.1.72062 WP_003409564.1.72072 WP_003409564.1.72111 WP_003409564.1.72122 WP_003409564.1.72128 WP_003409564.1.72143 WP_003409564.1.7216 WP_003409564.1.72168 WP_003409564.1.72179 WP_003409564.1.72209 WP_003409564.1.72219 WP_003409564.1.72227 WP_003409564.1.7224 WP_003409564.1.72268 WP_003409564.1.72332 WP_003409564.1.72380 WP_003409564.1.72401 WP_003409564.1.72405 WP_003409564.1.72420 WP_003409564.1.72441 WP_003409564.1.72451 WP_003409564.1.72452 WP_003409564.1.72457 WP_003409564.1.72459 WP_003409564.1.72460 WP_003409564.1.72466 WP_003409564.1.72487 WP_003409564.1.72488 WP_003409564.1.72492 WP_003409564.1.72506 WP_003409564.1.72543 WP_003409564.1.7256 WP_003409564.1.72576 WP_003409564.1.72578 WP_003409564.1.72585 WP_003409564.1.72591 WP_003409564.1.72592 WP_003409564.1.72640 WP_003409564.1.72661 WP_003409564.1.72684 WP_003409564.1.72739 WP_003409564.1.72744 WP_003409564.1.72755 WP_003409564.1.72759 WP_003409564.1.72784 WP_003409564.1.72792 WP_003409564.1.72826 WP_003409564.1.72831 WP_003409564.1.72852 WP_003409564.1.72853 WP_003409564.1.72879 WP_003409564.1.72880 WP_003409564.1.72938 WP_003409564.1.72954 WP_003409564.1.72957 WP_003409564.1.72959 WP_003409564.1.72973 WP_003409564.1.72988 WP_003409564.1.72993 WP_003409564.1.73006 WP_003409564.1.73013 WP_003409564.1.73025 WP_003409564.1.73028 WP_003409564.1.73042 WP_003409564.1.73045 WP_003409564.1.73092 WP_003409564.1.73118 WP_003409564.1.7312 WP_003409564.1.73127 WP_003409564.1.73134 WP_003409564.1.73150 WP_003409564.1.73154 WP_003409564.1.73163 WP_003409564.1.73182 WP_003409564.1.73205 WP_003409564.1.7321 WP_003409564.1.73310 WP_003409564.1.73315 WP_003409564.1.73365 WP_003409564.1.73391 WP_003409564.1.73404 WP_003409564.1.73424 WP_003409564.1.73436 WP_003409564.1.73445 WP_003409564.1.73453 WP_003409564.1.73465 WP_003409564.1.73466 WP_003409564.1.73470 WP_003409564.1.73471 WP_003409564.1.73478 WP_003409564.1.73482 WP_003409564.1.73507 WP_003409564.1.73532 WP_003409564.1.73550 WP_003409564.1.73564 WP_003409564.1.73623 WP_003409564.1.73629 WP_003409564.1.73644 WP_003409564.1.7366 WP_003409564.1.73661 WP_003409564.1.7368 WP_003409564.1.73688 WP_003409564.1.73723 WP_003409564.1.73744 WP_003409564.1.73750 WP_003409564.1.73760 WP_003409564.1.73774 WP_003409564.1.7379 WP_003409564.1.73813 WP_003409564.1.73840 WP_003409564.1.73876 WP_003409564.1.7389 WP_003409564.1.73986 WP_003409564.1.74016 WP_003409564.1.74039 WP_003409564.1.74083 WP_003409564.1.74101 WP_003409564.1.74107 WP_003409564.1.74120 WP_003409564.1.74129 WP_003409564.1.74144 WP_003409564.1.7417 WP_003409564.1.74190 WP_003409564.1.74210 WP_003409564.1.7423 WP_003409564.1.74259 WP_003409564.1.74262 WP_003409564.1.74269 WP_003409564.1.74282 WP_003409564.1.74291 WP_003409564.1.74296 WP_003409564.1.74304 WP_003409564.1.7432 WP_003409564.1.74347 WP_003409564.1.7436 WP_003409564.1.74378 WP_003409564.1.74382 WP_003409564.1.74395 WP_003409564.1.74400 WP_003409564.1.74401 WP_003409564.1.74432 WP_003409564.1.74442 WP_003409564.1.74487 WP_003409564.1.74499 WP_003409564.1.74504 WP_003409564.1.74511 WP_003409564.1.74523 WP_003409564.1.74525 WP_003409564.1.74551 WP_003409564.1.74555 WP_003409564.1.74628 WP_003409564.1.74641 WP_003409564.1.74653 WP_003409564.1.74660 WP_003409564.1.74683 WP_003409564.1.7469 WP_003409564.1.74725 WP_003409564.1.74760 WP_003409564.1.74786 WP_003409564.1.74809 WP_003409564.1.74820 WP_003409564.1.74870 WP_003409564.1.74881 WP_003409564.1.74888 WP_003409564.1.74952 WP_003409564.1.7496 WP_003409564.1.74988 WP_003409564.1.75043 WP_003409564.1.75055 WP_003409564.1.75078 WP_003409564.1.75081 WP_003409564.1.75120 WP_003409564.1.75163 WP_003409564.1.75188 WP_003409564.1.75200 WP_003409564.1.75202 WP_003409564.1.75234 WP_003409564.1.75239 WP_003409564.1.75250 WP_003409564.1.75263 WP_003409564.1.75281 WP_003409564.1.75342 WP_003409564.1.7535 WP_003409564.1.75376 WP_003409564.1.75391 WP_003409564.1.75395 WP_003409564.1.75441 WP_003409564.1.75510 WP_003409564.1.75581 WP_003409564.1.75598 WP_003409564.1.75635 WP_003409564.1.75645 WP_003409564.1.75665 WP_003409564.1.75671 WP_003409564.1.75741 WP_003409564.1.75749 WP_003409564.1.75772 WP_003409564.1.75774 WP_003409564.1.75811 WP_003409564.1.75833 WP_003409564.1.7585 WP_003409564.1.75864 WP_003409564.1.75868 WP_003409564.1.75878 WP_003409564.1.75927 WP_003409564.1.75946 WP_003409564.1.75968 WP_003409564.1.75974 WP_003409564.1.76007 WP_003409564.1.76016 WP_003409564.1.76032 WP_003409564.1.76037 WP_003409564.1.7604 WP_003409564.1.76045 WP_003409564.1.76052 WP_003409564.1.76058 WP_003409564.1.76064 WP_003409564.1.76110 WP_003409564.1.76126 WP_003409564.1.76133 WP_003409564.1.76138 WP_003409564.1.76157 WP_003409564.1.76172 WP_003409564.1.76177 WP_003409564.1.76183 WP_003409564.1.76209 WP_003409564.1.76239 WP_003409564.1.76277 WP_003409564.1.76281 WP_003409564.1.76291 WP_003409564.1.76297 WP_003409564.1.76379 WP_003409564.1.76403 WP_003409564.1.76413 WP_003409564.1.76414 WP_003409564.1.76427 WP_003409564.1.76436 WP_003409564.1.76442 WP_003409564.1.76443 WP_003409564.1.76456 WP_003409564.1.76521 WP_003409564.1.76533 WP_003409564.1.76616 WP_003409564.1.76625 WP_003409564.1.76629 WP_003409564.1.76635 WP_003409564.1.76638 WP_003409564.1.76639 WP_003409564.1.76640 WP_003409564.1.76644 WP_003409564.1.76677 WP_003409564.1.76678 WP_003409564.1.76679 WP_003409564.1.76734 WP_003409564.1.76744 WP_003409564.1.76750 WP_003409564.1.76754 WP_003409564.1.76757 WP_003409564.1.76781 WP_003409564.1.76818 WP_003409564.1.76824 WP_003409564.1.76835 WP_003409564.1.76873 WP_003409564.1.76881 WP_003409564.1.76888 WP_003409564.1.76900 WP_003409564.1.7691 WP_003409564.1.76947 WP_003409564.1.76954 WP_003409564.1.76955 WP_003409564.1.76963 WP_003409564.1.76976 WP_003409564.1.770 WP_003409564.1.77000 WP_003409564.1.77008 WP_003409564.1.77021 WP_003409564.1.77056 WP_003409564.1.77065 WP_003409564.1.77075 WP_003409564.1.77107 WP_003409564.1.77115 WP_003409564.1.77118 WP_003409564.1.77125 WP_003409564.1.77141 WP_003409564.1.77142 WP_003409564.1.77166 WP_003409564.1.77250 WP_003409564.1.77252 WP_003409564.1.77260 WP_003409564.1.77266 WP_003409564.1.77280 WP_003409564.1.77285 WP_003409564.1.77312 WP_003409564.1.77348 WP_003409564.1.77351 WP_003409564.1.77352 WP_003409564.1.77361 WP_003409564.1.774 WP_003409564.1.7740 WP_003409564.1.77404 WP_003409564.1.77425 WP_003409564.1.77463 WP_003409564.1.77474 WP_003409564.1.7748 WP_003409564.1.77484 WP_003409564.1.77491 WP_003409564.1.77499 WP_003409564.1.77510 WP_003409564.1.77530 WP_003409564.1.77554 WP_003409564.1.77559 WP_003409564.1.77599 WP_003409564.1.77605 WP_003409564.1.7762 WP_003409564.1.77627 WP_003409564.1.77649 WP_003409564.1.77654 WP_003409564.1.7766 WP_003409564.1.77667 WP_003409564.1.77704 WP_003409564.1.77706 WP_003409564.1.77726 WP_003409564.1.77774 WP_003409564.1.7778 WP_003409564.1.77790 WP_003409564.1.77809 WP_003409564.1.77820 WP_003409564.1.77843 WP_003409564.1.77855 WP_003409564.1.77865 WP_003409564.1.77868 WP_003409564.1.77890 WP_003409564.1.77909 WP_003409564.1.77911 WP_003409564.1.77931 WP_003409564.1.77984 WP_003409564.1.78020 WP_003409564.1.78024 WP_003409564.1.78075 WP_003409564.1.78084 WP_003409564.1.78086 WP_003409564.1.7809 WP_003409564.1.78098 WP_003409564.1.78105 WP_003409564.1.78113 WP_003409564.1.78136 WP_003409564.1.78162 WP_003409564.1.7817 WP_003409564.1.78200 WP_003409564.1.78216 WP_003409564.1.78236 WP_003409564.1.78238 WP_003409564.1.78322 WP_003409564.1.78338 WP_003409564.1.7836 WP_003409564.1.78360 WP_003409564.1.78386 WP_003409564.1.78435 WP_003409564.1.7844 WP_003409564.1.78459 WP_003409564.1.78488 WP_003409564.1.7849 WP_003409564.1.78499 WP_003409564.1.785 WP_003409564.1.78516 WP_003409564.1.78524 WP_003409564.1.78526 WP_003409564.1.78538 WP_003409564.1.78544 WP_003409564.1.78545 WP_003409564.1.78547 WP_003409564.1.78574 WP_003409564.1.78580 WP_003409564.1.7860 WP_003409564.1.78620 WP_003409564.1.78646 WP_003409564.1.78648 WP_003409564.1.78649 WP_003409564.1.78655 WP_003409564.1.78657 WP_003409564.1.78659 WP_003409564.1.7869 WP_003409564.1.78692 WP_003409564.1.78760 WP_003409564.1.78766 WP_003409564.1.78776 WP_003409564.1.78778 WP_003409564.1.78784 WP_003409564.1.78788 WP_003409564.1.78790 WP_003409564.1.78860 WP_003409564.1.7887 WP_003409564.1.78884 WP_003409564.1.78932 WP_003409564.1.78969 WP_003409564.1.78977 WP_003409564.1.78980 WP_003409564.1.79005 WP_003409564.1.79016 WP_003409564.1.79033 WP_003409564.1.79064 WP_003409564.1.79066 WP_003409564.1.79068 WP_003409564.1.79077 WP_003409564.1.79095 WP_003409564.1.79112 WP_003409564.1.79122 WP_003409564.1.79145 WP_003409564.1.79152 WP_003409564.1.79163 WP_003409564.1.79182 WP_003409564.1.79198 WP_003409564.1.79213 WP_003409564.1.79218 WP_003409564.1.79268 WP_003409564.1.79273 WP_003409564.1.79278 WP_003409564.1.79290 WP_003409564.1.79319 WP_003409564.1.79326 WP_003409564.1.7933 WP_003409564.1.79330 WP_003409564.1.79339 WP_003409564.1.79394 WP_003409564.1.79399 WP_003409564.1.79413 WP_003409564.1.79422 WP_003409564.1.79445 WP_003409564.1.79447 WP_003409564.1.79455 WP_003409564.1.79471 WP_003409564.1.79480 WP_003409564.1.79482 WP_003409564.1.79488 WP_003409564.1.79500 WP_003409564.1.79502 WP_003409564.1.79508 WP_003409564.1.79514 WP_003409564.1.79561 WP_003409564.1.79565 WP_003409564.1.79578 WP_003409564.1.79588 WP_003409564.1.79598 WP_003409564.1.79615 WP_003409564.1.79684 WP_003409564.1.79698 WP_003409564.1.797 WP_003409564.1.79744 WP_003409564.1.79784 WP_003409564.1.79802 WP_003409564.1.79806 WP_003409564.1.79819 WP_003409564.1.79826 WP_003409564.1.79828 WP_003409564.1.79851 WP_003409564.1.79853 WP_003409564.1.79863 WP_003409564.1.79881 WP_003409564.1.79885 WP_003409564.1.79898 WP_003409564.1.7990 WP_003409564.1.79900 WP_003409564.1.79913 WP_003409564.1.79918 WP_003409564.1.79947 WP_003409564.1.79948 WP_003409564.1.7995 WP_003409564.1.7997 WP_003409564.1.80004 WP_003409564.1.80015 WP_003409564.1.80022 WP_003409564.1.80030 WP_003409564.1.80054 WP_003409564.1.80084 WP_003409564.1.80099 WP_003409564.1.80129 WP_003409564.1.80177 WP_003409564.1.80234 WP_003409564.1.8026 WP_003409564.1.80275 WP_003409564.1.8029 WP_003409564.1.80299 WP_003409564.1.80300 WP_003409564.1.80304 WP_003409564.1.80326 WP_003409564.1.80351 WP_003409564.1.8037 WP_003409564.1.80370 WP_003409564.1.80387 WP_003409564.1.80399 WP_003409564.1.8044 WP_003409564.1.80451 WP_003409564.1.80458 WP_003409564.1.80461 WP_003409564.1.80490 WP_003409564.1.80503 WP_003409564.1.80507 WP_003409564.1.80552 WP_003409564.1.80576 WP_003409564.1.80588 WP_003409564.1.80599 WP_003409564.1.8060 WP_003409564.1.80624 WP_003409564.1.80636 WP_003409564.1.80669 WP_003409564.1.80673 WP_003409564.1.80711 WP_003409564.1.80714 WP_003409564.1.80743 WP_003409564.1.80784 WP_003409564.1.80815 WP_003409564.1.80853 WP_003409564.1.80918 WP_003409564.1.8093 WP_003409564.1.80967 WP_003409564.1.8097 WP_003409564.1.80988 WP_003409564.1.81007 WP_003409564.1.81013 WP_003409564.1.8105 WP_003409564.1.81059 WP_003409564.1.81063 WP_003409564.1.81066 WP_003409564.1.81075 WP_003409564.1.81091 WP_003409564.1.81119 WP_003409564.1.81125 WP_003409564.1.81136 WP_003409564.1.8114 WP_003409564.1.81189 WP_003409564.1.81192 WP_003409564.1.812 WP_003409564.1.81230 WP_003409564.1.81249 WP_003409564.1.81250 WP_003409564.1.81264 WP_003409564.1.8128 WP_003409564.1.81287 WP_003409564.1.81297 WP_003409564.1.8138 WP_003409564.1.81407 WP_003409564.1.8143 WP_003409564.1.81439 WP_003409564.1.81465 WP_003409564.1.81505 WP_003409564.1.81529 WP_003409564.1.81538 WP_003409564.1.81541 WP_003409564.1.81560 WP_003409564.1.81561 WP_003409564.1.81567 WP_003409564.1.81583 WP_003409564.1.81686 WP_003409564.1.81712 WP_003409564.1.81720 WP_003409564.1.81731 WP_003409564.1.81774 WP_003409564.1.81788 WP_003409564.1.81809 WP_003409564.1.81820 WP_003409564.1.81850 WP_003409564.1.81883 WP_003409564.1.81891 WP_003409564.1.81911 WP_003409564.1.81918 WP_003409564.1.82011 WP_003409564.1.82048 WP_003409564.1.82069 WP_003409564.1.82071 WP_003409564.1.82108 WP_003409564.1.82136 WP_003409564.1.82142 WP_003409564.1.8215 WP_003409564.1.82158 WP_003409564.1.8217 WP_003409564.1.82209 WP_003409564.1.82210 WP_003409564.1.82228 WP_003409564.1.82236 WP_003409564.1.82251 WP_003409564.1.82271 WP_003409564.1.82305 WP_003409564.1.82307 WP_003409564.1.82309 WP_003409564.1.82317 WP_003409564.1.8232 WP_003409564.1.82346 WP_003409564.1.82374 WP_003409564.1.82385 WP_003409564.1.82429 WP_003409564.1.82460 WP_003409564.1.82462 WP_003409564.1.82483 WP_003409564.1.82494 WP_003409564.1.82531 WP_003409564.1.82546 WP_003409564.1.82547 WP_003409564.1.82549 WP_003409564.1.82577 WP_003409564.1.82592 WP_003409564.1.82597 WP_003409564.1.82598 WP_003409564.1.82625 WP_003409564.1.82642 WP_003409564.1.82651 WP_003409564.1.82653 WP_003409564.1.82681 WP_003409564.1.82685 WP_003409564.1.8271 WP_003409564.1.82712 WP_003409564.1.8273 WP_003409564.1.82743 WP_003409564.1.82757 WP_003409564.1.82774 WP_003409564.1.82803 WP_003409564.1.82836 WP_003409564.1.82860 WP_003409564.1.82871 WP_003409564.1.82892 WP_003409564.1.82935 WP_003409564.1.82957 WP_003409564.1.82973 WP_003409564.1.82981 WP_003409564.1.82983 WP_003409564.1.83004 WP_003409564.1.83009 WP_003409564.1.83044 WP_003409564.1.83065 WP_003409564.1.83074 WP_003409564.1.83110 WP_003409564.1.83146 WP_003409564.1.83149 WP_003409564.1.83159 WP_003409564.1.8317 WP_003409564.1.83173 WP_003409564.1.83181 WP_003409564.1.83182 WP_003409564.1.83191 WP_003409564.1.83197 WP_003409564.1.83212 WP_003409564.1.8326 WP_003409564.1.83262 WP_003409564.1.83268 WP_003409564.1.83273 WP_003409564.1.83309 WP_003409564.1.83332 WP_003409564.1.83334 WP_003409564.1.83341 WP_003409564.1.83349 WP_003409564.1.8335 WP_003409564.1.83353 WP_003409564.1.83367 WP_003409564.1.83380 WP_003409564.1.83381 WP_003409564.1.83389 WP_003409564.1.83408 WP_003409564.1.83409 WP_003409564.1.83435 WP_003409564.1.83470 WP_003409564.1.83524 WP_003409564.1.83526 WP_003409564.1.8358 WP_003409564.1.83589 WP_003409564.1.83601 WP_003409564.1.83611 WP_003409564.1.83638 WP_003409564.1.83648 WP_003409564.1.83656 WP_003409564.1.83667 WP_003409564.1.83689 WP_003409564.1.83692 WP_003409564.1.83705 WP_003409564.1.83766 WP_003409564.1.83793 WP_003409564.1.83794 WP_003409564.1.83802 WP_003409564.1.83805 WP_003409564.1.83839 WP_003409564.1.83842 WP_003409564.1.83850 WP_003409564.1.83861 WP_003409564.1.83884 WP_003409564.1.83920 WP_003409564.1.83929 WP_003409564.1.83930 WP_003409564.1.83975 WP_003409564.1.83991 WP_003409564.1.8400 WP_003409564.1.84027 WP_003409564.1.8404 WP_003409564.1.84057 WP_003409564.1.84070 WP_003409564.1.8409 WP_003409564.1.84112 WP_003409564.1.84146 WP_003409564.1.8415 WP_003409564.1.84176 WP_003409564.1.84186 WP_003409564.1.84192 WP_003409564.1.84228 WP_003409564.1.8424 WP_003409564.1.84244 WP_003409564.1.84259 WP_003409564.1.8426 WP_003409564.1.84277 WP_003409564.1.84287 WP_003409564.1.8434 WP_003409564.1.84388 WP_003409564.1.84408 WP_003409564.1.84409 WP_003409564.1.84438 WP_003409564.1.84460 WP_003409564.1.84488 WP_003409564.1.84504 WP_003409564.1.84525 WP_003409564.1.84620 WP_003409564.1.84623 WP_003409564.1.84641 WP_003409564.1.84655 WP_003409564.1.84666 WP_003409564.1.84670 WP_003409564.1.84739 WP_003409564.1.84748 WP_003409564.1.84766 WP_003409564.1.84772 WP_003409564.1.84774 WP_003409564.1.848 WP_003409564.1.84812 WP_003409564.1.84836 WP_003409564.1.84839 WP_003409564.1.84846 WP_003409564.1.84873 WP_003409564.1.84938 WP_003409564.1.84968 WP_003409564.1.84973 WP_003409564.1.84981 WP_003409564.1.84985 WP_003409564.1.8503 WP_003409564.1.85038 WP_003409564.1.85041 WP_003409564.1.85043 WP_003409564.1.8505 WP_003409564.1.85074 WP_003409564.1.8509 WP_003409564.1.8512 WP_003409564.1.85148 WP_003409564.1.8518 WP_003409564.1.8522 WP_003409564.1.85242 WP_003409564.1.85276 WP_003409564.1.85281 WP_003409564.1.85284 WP_003409564.1.85314 WP_003409564.1.85319 WP_003409564.1.85330 WP_003409564.1.85341 WP_003409564.1.85346 WP_003409564.1.8535 WP_003409564.1.85363 WP_003409564.1.85371 WP_003409564.1.85377 WP_003409564.1.85387 WP_003409564.1.85399 WP_003409564.1.85458 WP_003409564.1.8546 WP_003409564.1.85464 WP_003409564.1.85478 WP_003409564.1.85480 WP_003409564.1.85488 WP_003409564.1.85495 WP_003409564.1.85551 WP_003409564.1.85557 WP_003409564.1.85577 WP_003409564.1.85597 WP_003409564.1.85599 WP_003409564.1.85610 WP_003409564.1.8563 WP_003409564.1.85648 WP_003409564.1.85679 WP_003409564.1.85704 WP_003409564.1.85717 WP_003409564.1.85727 WP_003409564.1.85737 WP_003409564.1.85763 WP_003409564.1.85808 WP_003409564.1.85819 WP_003409564.1.85820 WP_003409564.1.85823 WP_003409564.1.85832 WP_003409564.1.8586 WP_003409564.1.85894 WP_003409564.1.85909 WP_003409564.1.85913 WP_003409564.1.85953 WP_003409564.1.85986 WP_003409564.1.86000 WP_003409564.1.86024 WP_003409564.1.86025 WP_003409564.1.86032 WP_003409564.1.86048 WP_003409564.1.86052 WP_003409564.1.86067 WP_003409564.1.86103 WP_003409564.1.86122 WP_003409564.1.86124 WP_003409564.1.86160 WP_003409564.1.86164 WP_003409564.1.86168 WP_003409564.1.86190 WP_003409564.1.86204 WP_003409564.1.86208 WP_003409564.1.86235 WP_003409564.1.86249 WP_003409564.1.86260 WP_003409564.1.86290 WP_003409564.1.863 WP_003409564.1.86327 WP_003409564.1.86337 WP_003409564.1.86368 WP_003409564.1.86377 WP_003409564.1.86425 WP_003409564.1.86459 WP_003409564.1.8649 WP_003409564.1.86499 WP_003409564.1.86520 WP_003409564.1.86561 WP_003409564.1.86568 WP_003409564.1.86575 WP_003409564.1.86584 WP_003409564.1.86605 WP_003409564.1.86626 WP_003409564.1.86648 WP_003409564.1.8666 WP_003409564.1.86684 WP_003409564.1.86696 WP_003409564.1.86705 WP_003409564.1.86718 WP_003409564.1.86725 WP_003409564.1.86757 WP_003409564.1.86766 WP_003409564.1.86801 WP_003409564.1.86814 WP_003409564.1.86820 WP_003409564.1.86825 WP_003409564.1.86834 WP_003409564.1.8685 WP_003409564.1.86851 WP_003409564.1.86855 WP_003409564.1.86867 WP_003409564.1.86877 WP_003409564.1.86883 WP_003409564.1.8689 WP_003409564.1.86892 WP_003409564.1.86933 WP_003409564.1.86941 WP_003409564.1.86950 WP_003409564.1.86962 WP_003409564.1.86963 WP_003409564.1.86979 WP_003409564.1.8700 WP_003409564.1.87001 WP_003409564.1.87002 WP_003409564.1.87031 WP_003409564.1.87116 WP_003409564.1.87117 WP_003409564.1.8714 WP_003409564.1.87162 WP_003409564.1.87178 WP_003409564.1.87191 WP_003409564.1.87201 WP_003409564.1.87209 WP_003409564.1.87266 WP_003409564.1.87273 WP_003409564.1.87275 WP_003409564.1.8733 WP_003409564.1.87345 WP_003409564.1.87369 WP_003409564.1.8737 WP_003409564.1.87401 WP_003409564.1.87404 WP_003409564.1.87409 WP_003409564.1.87444 WP_003409564.1.87446 WP_003409564.1.87459 WP_003409564.1.87472 WP_003409564.1.87489 WP_003409564.1.87494 WP_003409564.1.87496 WP_003409564.1.87582 WP_003409564.1.87588 WP_003409564.1.87617 WP_003409564.1.87619 WP_003409564.1.87620 WP_003409564.1.87634 WP_003409564.1.87643 WP_003409564.1.8765 WP_003409564.1.87650 WP_003409564.1.87654 WP_003409564.1.87658 WP_003409564.1.87665 WP_003409564.1.87676 WP_003409564.1.87677 WP_003409564.1.87684 WP_003409564.1.87692 WP_003409564.1.87707 WP_003409564.1.87732 WP_003409564.1.87784 WP_003409564.1.87796 WP_003409564.1.87809 WP_003409564.1.87817 WP_003409564.1.87827 WP_003409564.1.87831 WP_003409564.1.87835 WP_003409564.1.87837 WP_003409564.1.87866 WP_003409564.1.8789 WP_003409564.1.87911 WP_003409564.1.87924 WP_003409564.1.87951 WP_003409564.1.87955 WP_003409564.1.87956 WP_003409564.1.87991 WP_003409564.1.88 WP_003409564.1.88002 WP_003409564.1.88037 WP_003409564.1.88039 WP_003409564.1.88072 WP_003409564.1.88077 WP_003409564.1.88121 WP_003409564.1.88180 WP_003409564.1.88191 WP_003409564.1.88205 WP_003409564.1.88217 WP_003409564.1.88219 WP_003409564.1.88245 WP_003409564.1.88253 WP_003409564.1.88294 WP_003409564.1.88315 WP_003409564.1.88316 WP_003409564.1.88320 WP_003409564.1.88338 WP_003409564.1.8840 WP_003409564.1.88437 WP_003409564.1.88469 WP_003409564.1.88489 WP_003409564.1.88507 WP_003409564.1.88521 WP_003409564.1.88530 WP_003409564.1.88537 WP_003409564.1.88541 WP_003409564.1.88592 WP_003409564.1.88616 WP_003409564.1.88618 WP_003409564.1.8862 WP_003409564.1.88625 WP_003409564.1.88632 WP_003409564.1.88634 WP_003409564.1.88649 WP_003409564.1.8870 WP_003409564.1.88737 WP_003409564.1.88756 WP_003409564.1.888 WP_003409564.1.88824 WP_003409564.1.88886 WP_003409564.1.88965 WP_003409564.1.88985 WP_003409564.1.8902 WP_003409564.1.89025 WP_003409564.1.89041 WP_003409564.1.89046 WP_003409564.1.89082 WP_003409564.1.89162 WP_003409564.1.89168 WP_003409564.1.8917 WP_003409564.1.89193 WP_003409564.1.89205 WP_003409564.1.89207 WP_003409564.1.89225 WP_003409564.1.8925 WP_003409564.1.89277 WP_003409564.1.89286 WP_003409564.1.89293 WP_003409564.1.89320 WP_003409564.1.8935 WP_003409564.1.89371 WP_003409564.1.89378 WP_003409564.1.89392 WP_003409564.1.89406 WP_003409564.1.8943 WP_003409564.1.89451 WP_003409564.1.89453 WP_003409564.1.89473 WP_003409564.1.89475 WP_003409564.1.89483 WP_003409564.1.895 WP_003409564.1.89513 WP_003409564.1.89517 WP_003409564.1.89522 WP_003409564.1.8954 WP_003409564.1.89543 WP_003409564.1.89567 WP_003409564.1.8957 WP_003409564.1.89572 WP_003409564.1.89589 WP_003409564.1.89607 WP_003409564.1.89613 WP_003409564.1.89625 WP_003409564.1.89648 WP_003409564.1.8967 WP_003409564.1.89670 WP_003409564.1.89676 WP_003409564.1.89729 WP_003409564.1.89739 WP_003409564.1.89762 WP_003409564.1.8977 WP_003409564.1.89802 WP_003409564.1.89808 WP_003409564.1.8982 WP_003409564.1.89829 WP_003409564.1.89831 WP_003409564.1.89844 WP_003409564.1.89849 WP_003409564.1.8989 WP_003409564.1.89901 WP_003409564.1.89903 WP_003409564.1.89909 WP_003409564.1.8992 WP_003409564.1.89922 WP_003409564.1.89926 WP_003409564.1.89963 WP_003409564.1.89971 WP_003409564.1.8998 WP_003409564.1.89987 WP_003409564.1.900 WP_003409564.1.90048 WP_003409564.1.9007 WP_003409564.1.90080 WP_003409564.1.90130 WP_003409564.1.90134 WP_003409564.1.90137 WP_003409564.1.90157 WP_003409564.1.90184 WP_003409564.1.90199 WP_003409564.1.90231 WP_003409564.1.90245 WP_003409564.1.90308 WP_003409564.1.90322 WP_003409564.1.90328 WP_003409564.1.90372 WP_003409564.1.90439 WP_003409564.1.90481 WP_003409564.1.90499 WP_003409564.1.9050 WP_003409564.1.90527 WP_003409564.1.90550 WP_003409564.1.90560 WP_003409564.1.90612 WP_003409564.1.90640 WP_003409564.1.90672 WP_003409564.1.90687 WP_003409564.1.90691 WP_003409564.1.90711 WP_003409564.1.90722 WP_003409564.1.90744 WP_003409564.1.9075 WP_003409564.1.90756 WP_003409564.1.90767 WP_003409564.1.90771 WP_003409564.1.90785 WP_003409564.1.90788 WP_003409564.1.90800 WP_003409564.1.90810 WP_003409564.1.90816 WP_003409564.1.90819 WP_003409564.1.9082 WP_003409564.1.90831 WP_003409564.1.90884 WP_003409564.1.90899 WP_003409564.1.90906 WP_003409564.1.90958 WP_003409564.1.90976 WP_003409564.1.90977 WP_003409564.1.90987 WP_003409564.1.9102 WP_003409564.1.91026 WP_003409564.1.91032 WP_003409564.1.91043 WP_003409564.1.91053 WP_003409564.1.91082 WP_003409564.1.91106 WP_003409564.1.91112 WP_003409564.1.91144 WP_003409564.1.91151 WP_003409564.1.91157 WP_003409564.1.91167 WP_003409564.1.91169 WP_003409564.1.91192 WP_003409564.1.91201 WP_003409564.1.91207 WP_003409564.1.91208 WP_003409564.1.91211 WP_003409564.1.91214 WP_003409564.1.91230 WP_003409564.1.91244 WP_003409564.1.91251 WP_003409564.1.91260 WP_003409564.1.91265 WP_003409564.1.91284 WP_003409564.1.91294 WP_003409564.1.91303 WP_003409564.1.91322 WP_003409564.1.91352 WP_003409564.1.91386 WP_003409564.1.9139 WP_003409564.1.91398 WP_003409564.1.91430 WP_003409564.1.91436 WP_003409564.1.91483 WP_003409564.1.91496 WP_003409564.1.91507 WP_003409564.1.91576 WP_003409564.1.91589 WP_003409564.1.91694 WP_003409564.1.91695 WP_003409564.1.91713 WP_003409564.1.91716 WP_003409564.1.91717 WP_003409564.1.91728 WP_003409564.1.91759 WP_003409564.1.91784 WP_003409564.1.91785 WP_003409564.1.91786 WP_003409564.1.91802 WP_003409564.1.91822 WP_003409564.1.91828 WP_003409564.1.9189 WP_003409564.1.91896 WP_003409564.1.9190 WP_003409564.1.91915 WP_003409564.1.91931 WP_003409564.1.91937 WP_003409564.1.91944 WP_003409564.1.91953 WP_003409564.1.91957 WP_003409564.1.91976 WP_003409564.1.91978 WP_003409564.1.92021 WP_003409564.1.92083 WP_003409564.1.92127 WP_003409564.1.92144 WP_003409564.1.92150 WP_003409564.1.92153 WP_003409564.1.92190 WP_003409564.1.92192 WP_003409564.1.92200 WP_003409564.1.92220 WP_003409564.1.92221 WP_003409564.1.92222 WP_003409564.1.92273 WP_003409564.1.92289 WP_003409564.1.9229 WP_003409564.1.92294 WP_003409564.1.92300 WP_003409564.1.92317 WP_003409564.1.92334 WP_003409564.1.92338 WP_003409564.1.92345 WP_003409564.1.92356 WP_003409564.1.92364 WP_003409564.1.92380 WP_003409564.1.92416 WP_003409564.1.92428 WP_003409564.1.92447 WP_003409564.1.92456 WP_003409564.1.92467 WP_003409564.1.92471 WP_003409564.1.92490 WP_003409564.1.92508 WP_003409564.1.9251 WP_003409564.1.92511 WP_003409564.1.92523 WP_003409564.1.92527 WP_003409564.1.92536 WP_003409564.1.92592 WP_003409564.1.92597 WP_003409564.1.92603 WP_003409564.1.92606 WP_003409564.1.92610 WP_003409564.1.92613 WP_003409564.1.9263 WP_003409564.1.9265 WP_003409564.1.92650 WP_003409564.1.92660 WP_003409564.1.92677 WP_003409564.1.92685 WP_003409564.1.92689 WP_003409564.1.92690 WP_003409564.1.92706 WP_003409564.1.92714 WP_003409564.1.92736 WP_003409564.1.9274 WP_003409564.1.92752 WP_003409564.1.92760 WP_003409564.1.92777 WP_003409564.1.92803 WP_003409564.1.92833 WP_003409564.1.92856 WP_003409564.1.92881 WP_003409564.1.92892 WP_003409564.1.92907 WP_003409564.1.92908 WP_003409564.1.9291 WP_003409564.1.92917 WP_003409564.1.92996 WP_003409564.1.93006 WP_003409564.1.93008 WP_003409564.1.93009 WP_003409564.1.93015 WP_003409564.1.93043 WP_003409564.1.9307 WP_003409564.1.93083 WP_003409564.1.93097 WP_003409564.1.93137 WP_003409564.1.93192 WP_003409564.1.93199 WP_003409564.1.93203 WP_003409564.1.93212 WP_003409564.1.93234 WP_003409564.1.93245 WP_003409564.1.93257 WP_003409564.1.93265 WP_003409564.1.93297 WP_003409564.1.93320 WP_003409564.1.93328 WP_003409564.1.93337 WP_003409564.1.93343 WP_003409564.1.93349 WP_003409564.1.93363 WP_003409564.1.93377 WP_003409564.1.9338 WP_003409564.1.93407 WP_003409564.1.93417 WP_003409564.1.93419 WP_003409564.1.93426 WP_003409564.1.9344 WP_003409564.1.93443 WP_003409564.1.93447 WP_003409564.1.93470 WP_003409564.1.93483 WP_003409564.1.93487 WP_003409564.1.93495 WP_003409564.1.93499 WP_003409564.1.93516 WP_003409564.1.93536 WP_003409564.1.93544 WP_003409564.1.93555 WP_003409564.1.93560 WP_003409564.1.93564 WP_003409564.1.9357 WP_003409564.1.93573 WP_003409564.1.93576 WP_003409564.1.93588 WP_003409564.1.9363 WP_003409564.1.93645 WP_003409564.1.93649 WP_003409564.1.93659 WP_003409564.1.93677 WP_003409564.1.9368 WP_003409564.1.93689 WP_003409564.1.93693 WP_003409564.1.93698 WP_003409564.1.93706 WP_003409564.1.9371 WP_003409564.1.93792 WP_003409564.1.93823 WP_003409564.1.93871 WP_003409564.1.9388 WP_003409564.1.93894 WP_003409564.1.93903 WP_003409564.1.93907 WP_003409564.1.93913 WP_003409564.1.93946 WP_003409564.1.93950 WP_003409564.1.93953 WP_003409564.1.93954 WP_003409564.1.93988 WP_003409564.1.9407 WP_003409564.1.94143 WP_003409564.1.94154 WP_003409564.1.94184 WP_003409564.1.94204 WP_003409564.1.94205 WP_003409564.1.94226 WP_003409564.1.94231 WP_003409564.1.94256 WP_003409564.1.94261 WP_003409564.1.94281 WP_003409564.1.94292 WP_003409564.1.94297 WP_003409564.1.9431 WP_003409564.1.94326 WP_003409564.1.94339 WP_003409564.1.94392 WP_003409564.1.94416 WP_003409564.1.94421 WP_003409564.1.94456 WP_003409564.1.94470 WP_003409564.1.94480 WP_003409564.1.94495 WP_003409564.1.94511 WP_003409564.1.94512 WP_003409564.1.94528 WP_003409564.1.94564 WP_003409564.1.946 WP_003409564.1.94602 WP_003409564.1.94623 WP_003409564.1.94629 WP_003409564.1.9465 WP_003409564.1.94673 WP_003409564.1.94714 WP_003409564.1.94730 WP_003409564.1.94736 WP_003409564.1.94776 WP_003409564.1.9478 WP_003409564.1.94834 WP_003409564.1.94852 WP_003409564.1.94872 WP_003409564.1.9488 WP_003409564.1.94902 WP_003409564.1.94916 WP_003409564.1.94979 WP_003409564.1.94994 WP_003409564.1.94996 WP_003409564.1.94998 WP_003409564.1.95007 WP_003409564.1.95010 WP_003409564.1.95015 WP_003409564.1.95034 WP_003409564.1.95068 WP_003409564.1.95081 WP_003409564.1.95082 WP_003409564.1.9509 WP_003409564.1.95096 WP_003409564.1.95112 WP_003409564.1.95138 WP_003409564.1.95179 WP_003409564.1.95188 WP_003409564.1.95190 WP_003409564.1.95234 WP_003409564.1.95241 WP_003409564.1.95245 WP_003409564.1.95257 WP_003409564.1.95279 WP_003409564.1.9531 WP_003409564.1.95335 WP_003409564.1.95344 WP_003409564.1.9535 WP_003409564.1.95370 WP_003409564.1.95392 WP_003409564.1.95416 WP_003409564.1.95417 WP_003409564.1.95454 WP_003409564.1.95455 WP_003409564.1.95491 WP_003409564.1.95497 WP_003409564.1.95508 WP_003409564.1.95509 WP_003409564.1.95529 WP_003409564.1.95556 WP_003409564.1.95557 WP_003409564.1.95565 WP_003409564.1.95578 WP_003409564.1.95580 WP_003409564.1.95585 WP_003409564.1.95643 WP_003409564.1.95679 WP_003409564.1.95685 WP_003409564.1.957 WP_003409564.1.95724 WP_003409564.1.95727 WP_003409564.1.95730 WP_003409564.1.95735 WP_003409564.1.95772 WP_003409564.1.95797 WP_003409564.1.95839 WP_003409564.1.9585 WP_003409564.1.9590 WP_003409564.1.95902 WP_003409564.1.95924 WP_003409564.1.95926 WP_003409564.1.95953 WP_003409564.1.95958 WP_003409564.1.95964 WP_003409564.1.95973 WP_003409564.1.96006 WP_003409564.1.9602 WP_003409564.1.96036 WP_003409564.1.96062 WP_003409564.1.96065 WP_003409564.1.96098 WP_003409564.1.96146 WP_003409564.1.96166 WP_003409564.1.96171 WP_003409564.1.96182 WP_003409564.1.96204 WP_003409564.1.96230 WP_003409564.1.96235 WP_003409564.1.96242 WP_003409564.1.96254 WP_003409564.1.96259 WP_003409564.1.96286 WP_003409564.1.96313 WP_003409564.1.96318 WP_003409564.1.96345 WP_003409564.1.96360 WP_003409564.1.96373 WP_003409564.1.96456 WP_003409564.1.96486 WP_003409564.1.96560 WP_003409564.1.96569 WP_003409564.1.96573 WP_003409564.1.96575 WP_003409564.1.96576 WP_003409564.1.96611 WP_003409564.1.96621 WP_003409564.1.9667 WP_003409564.1.96681 WP_003409564.1.96726 WP_003409564.1.96733 WP_003409564.1.96742 WP_003409564.1.96754 WP_003409564.1.9678 WP_003409564.1.96832 WP_003409564.1.9685 WP_003409564.1.97008 WP_003409564.1.97009 WP_003409564.1.97056 WP_003409564.1.97084 WP_003409564.1.97087 WP_003409564.1.97094 WP_003409564.1.97096 WP_003409564.1.97099 WP_003409564.1.97108 WP_003409564.1.97113 WP_003409564.1.97122 WP_003409564.1.97127 WP_003409564.1.97129 WP_003409564.1.97136 WP_003409564.1.9716 WP_003409564.1.97176 WP_003409564.1.97222 WP_003409564.1.97223 WP_003409564.1.97237 WP_003409564.1.97242 WP_003409564.1.97270 WP_003409564.1.97283 WP_003409564.1.97296 WP_003409564.1.97321 WP_003409564.1.97325 WP_003409564.1.97330 WP_003409564.1.97366 WP_003409564.1.97376 WP_003409564.1.97380 WP_003409564.1.9739 WP_003409564.1.97462 WP_003409564.1.97517 WP_003409564.1.97519 WP_003409564.1.97535 WP_003409564.1.97540 WP_003409564.1.97545 WP_003409564.1.97546 WP_003409564.1.97550 WP_003409564.1.97577 WP_003409564.1.97584 WP_003409564.1.9759 WP_003409564.1.97591 WP_003409564.1.97609 WP_003409564.1.97618 WP_003409564.1.9763 WP_003409564.1.97669 WP_003409564.1.97673 WP_003409564.1.97700 WP_003409564.1.97701 WP_003409564.1.9773 WP_003409564.1.97730 WP_003409564.1.97740 WP_003409564.1.97751 WP_003409564.1.97754 WP_003409564.1.97797 WP_003409564.1.9782 WP_003409564.1.9784 WP_003409564.1.97888 WP_003409564.1.9790 WP_003409564.1.9795 WP_003409564.1.97951 WP_003409564.1.97958 WP_003409564.1.97966 WP_003409564.1.97977 WP_003409564.1.97979 WP_003409564.1.97995 WP_003409564.1.98018 WP_003409564.1.98034 WP_003409564.1.98052 WP_003409564.1.98071 WP_003409564.1.98072 WP_003409564.1.98113 WP_003409564.1.98114 WP_003409564.1.98128 WP_003409564.1.98181 WP_003409564.1.98188 WP_003409564.1.98189 WP_003409564.1.98213 WP_003409564.1.98225 WP_003409564.1.98291 WP_003409564.1.98335 WP_003409564.1.98350 WP_003409564.1.98395 WP_003409564.1.98412 WP_003409564.1.98441 WP_003409564.1.98443 WP_003409564.1.98462 WP_003409564.1.9848 WP_003409564.1.98482 WP_003409564.1.98486 WP_003409564.1.98488 WP_003409564.1.98503 WP_003409564.1.98516 WP_003409564.1.98524 WP_003409564.1.98536 WP_003409564.1.98541 WP_003409564.1.98566 WP_003409564.1.98576 WP_003409564.1.98590 WP_003409564.1.98594 WP_003409564.1.98599 WP_003409564.1.98629 WP_003409564.1.98645 WP_003409564.1.98646 WP_003409564.1.98649 WP_003409564.1.98656 WP_003409564.1.9867 WP_003409564.1.98674 WP_003409564.1.98697 WP_003409564.1.98701 WP_003409564.1.98739 WP_003409564.1.98749 WP_003409564.1.98765 WP_003409564.1.98770 WP_003409564.1.98777 WP_003409564.1.98778 WP_003409564.1.98802 WP_003409564.1.98838 WP_003409564.1.98850 WP_003409564.1.98906 WP_003409564.1.98935 WP_003409564.1.98948 WP_003409564.1.98953 WP_003409564.1.98984 WP_003409564.1.99000 WP_003409564.1.99023 WP_003409564.1.99030 WP_003409564.1.99055 WP_003409564.1.99062 WP_003409564.1.99086 WP_003409564.1.99115 WP_003409564.1.99117 WP_003409564.1.99161 WP_003409564.1.99176 WP_003409564.1.99205 WP_003409564.1.99211 WP_003409564.1.99216 WP_003409564.1.99222 WP_003409564.1.99251 WP_003409564.1.99294 WP_003409564.1.99312 WP_003409564.1.99315 WP_003409564.1.99316 WP_003409564.1.99322 WP_003409564.1.99328 WP_003409564.1.99365 WP_003409564.1.99368 WP_003409564.1.99379 WP_003409564.1.99396 WP_003409564.1.99402 WP_003409564.1.99404 WP_003409564.1.99419 WP_003409564.1.99438 WP_003409564.1.99460 WP_003409564.1.99468 WP_003409564.1.99473 WP_003409564.1.99513 WP_003409564.1.99529 WP_003409564.1.99548 WP_003409564.1.99572 WP_003409564.1.99575 WP_003409564.1.99578 WP_003409564.1.99605 WP_003409564.1.99609 WP_003409564.1.99617 WP_003409564.1.99635 WP_003409564.1.99650 WP_003409564.1.99672 WP_003409564.1.99701 WP_003409564.1.99711 WP_003409564.1.99716 WP_003409564.1.99740 WP_003409564.1.99745 WP_003409564.1.99749 WP_003409564.1.9976 WP_003409564.1.99798 WP_003409564.1.99817 WP_003409564.1.99832 WP_003409564.1.99847 WP_003409564.1.99852 WP_003409564.1.99886 WP_003409564.1.99897 WP_003409564.1.99899 WP_003409564.1.99915 WP_003409564.1.9993 WP_003409564.1.99982 WP_003409564.1.99991 gi|148823121|ref|YP_001287875.1| gi|385998685|ref|YP_005916983.1| gi|506926390|ref|YP_008006840.1| gi|148661717|ref|YP_001283240.1| gi|494700325|ref|YP_007965807.1| gi|506926390|ref|YP_008006840.1| gi|433642044|ref|YP_007287803.1| gi|31793102|ref|NP_855595.1| gi|392432507|ref|YP_006473551.1| gi|339631962|ref|YP_004723604.1| gi|433631026|ref|YP_007264654.1| gi|433634958|ref|YP_007268585.1| gi|340626918|ref|YP_004745370.1| gi|15841381|ref|NP_336418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]