SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740630|ref|YP_002161944.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740630|ref|YP_002161944.1|
Domain Number 1 Region: 14-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.07e-34
Family SCOPe 0.000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197740630|ref|YP_002161944.1|
Sequence length 118
Comment ArsR family transcriptional regulator CmtR [Mycobacterium tuberculosis str. Haarlem]
Sequence
MLTCEMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRG
CGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTDQPCVAERAASGEAVEMTGS
Download sequence
Identical sequences A0A045HH61 A0A083W8A1 A0A0H3LB79 A0A0H3MBJ1 A0A109S805 A0A109SXI8 A0A120IX41 A0A197J0G2 A0A1S1B7Z0 A5U419 F8MAC4 G0TLY6 I6XD18 M8CE68 P67732 P9WMI8 P9WMI9 R4LW12 R4M722
gi|506926489|ref|YP_008006939.1| gi|339632033|ref|YP_004723675.1| gi|392432418|ref|YP_006473462.1| gi|31793174|ref|NP_855667.1| gi|224990372|ref|YP_002645059.1| gi|340627005|ref|YP_004745457.1| gi|15609131|ref|NP_216510.1| gi|494700421|ref|YP_007965903.1| gi|525674640|ref|YP_008226096.1| gi|375296204|ref|YP_005100471.1| gi|471337954|ref|YP_007610667.1| gi|385998771|ref|YP_005917069.1| gi|197740630|ref|YP_002161944.1| gi|494696377|ref|YP_007961880.1| gi|479314917|ref|YP_007854969.1| gi|494692510|ref|YP_007958053.1| gi|386004946|ref|YP_005923225.1| NP_216510.1.84033 WP_003410018.1.100000 WP_003410018.1.100021 WP_003410018.1.100069 WP_003410018.1.100087 WP_003410018.1.10015 WP_003410018.1.100208 WP_003410018.1.100216 WP_003410018.1.10022 WP_003410018.1.100255 WP_003410018.1.100260 WP_003410018.1.100270 WP_003410018.1.100279 WP_003410018.1.100308 WP_003410018.1.100318 WP_003410018.1.100337 WP_003410018.1.100338 WP_003410018.1.10037 WP_003410018.1.100383 WP_003410018.1.100395 WP_003410018.1.100396 WP_003410018.1.1004 WP_003410018.1.100401 WP_003410018.1.100459 WP_003410018.1.100460 WP_003410018.1.100552 WP_003410018.1.100581 WP_003410018.1.100625 WP_003410018.1.10064 WP_003410018.1.100666 WP_003410018.1.100677 WP_003410018.1.100682 WP_003410018.1.100697 WP_003410018.1.100703 WP_003410018.1.100716 WP_003410018.1.100722 WP_003410018.1.100754 WP_003410018.1.100757 WP_003410018.1.1008 WP_003410018.1.100812 WP_003410018.1.100845 WP_003410018.1.100866 WP_003410018.1.10088 WP_003410018.1.100889 WP_003410018.1.10090 WP_003410018.1.100910 WP_003410018.1.100915 WP_003410018.1.100918 WP_003410018.1.100935 WP_003410018.1.100984 WP_003410018.1.100992 WP_003410018.1.100998 WP_003410018.1.101 WP_003410018.1.101025 WP_003410018.1.101028 WP_003410018.1.10104 WP_003410018.1.101048 WP_003410018.1.101054 WP_003410018.1.101075 WP_003410018.1.101146 WP_003410018.1.10116 WP_003410018.1.10117 WP_003410018.1.101209 WP_003410018.1.10125 WP_003410018.1.101290 WP_003410018.1.101323 WP_003410018.1.101350 WP_003410018.1.101367 WP_003410018.1.101398 WP_003410018.1.101403 WP_003410018.1.101421 WP_003410018.1.10144 WP_003410018.1.101442 WP_003410018.1.10145 WP_003410018.1.101452 WP_003410018.1.101456 WP_003410018.1.101493 WP_003410018.1.101496 WP_003410018.1.101525 WP_003410018.1.101533 WP_003410018.1.101535 WP_003410018.1.101553 WP_003410018.1.101558 WP_003410018.1.10156 WP_003410018.1.101573 WP_003410018.1.101576 WP_003410018.1.10159 WP_003410018.1.101592 WP_003410018.1.101604 WP_003410018.1.101607 WP_003410018.1.101622 WP_003410018.1.101644 WP_003410018.1.101659 WP_003410018.1.101671 WP_003410018.1.101687 WP_003410018.1.101698 WP_003410018.1.10170 WP_003410018.1.101713 WP_003410018.1.101722 WP_003410018.1.101733 WP_003410018.1.101743 WP_003410018.1.101753 WP_003410018.1.101754 WP_003410018.1.101764 WP_003410018.1.101773 WP_003410018.1.101795 WP_003410018.1.101797 WP_003410018.1.101798 WP_003410018.1.101802 WP_003410018.1.101826 WP_003410018.1.101836 WP_003410018.1.101858 WP_003410018.1.101859 WP_003410018.1.101862 WP_003410018.1.101888 WP_003410018.1.101894 WP_003410018.1.101899 WP_003410018.1.1019 WP_003410018.1.101923 WP_003410018.1.101925 WP_003410018.1.10193 WP_003410018.1.101996 WP_003410018.1.102 WP_003410018.1.102008 WP_003410018.1.102017 WP_003410018.1.102053 WP_003410018.1.102055 WP_003410018.1.102063 WP_003410018.1.102099 WP_003410018.1.1021 WP_003410018.1.10211 WP_003410018.1.102119 WP_003410018.1.102121 WP_003410018.1.10216 WP_003410018.1.10224 WP_003410018.1.10253 WP_003410018.1.10262 WP_003410018.1.10272 WP_003410018.1.10277 WP_003410018.1.1033 WP_003410018.1.10350 WP_003410018.1.10362 WP_003410018.1.10366 WP_003410018.1.10376 WP_003410018.1.10396 WP_003410018.1.10410 WP_003410018.1.10414 WP_003410018.1.10421 WP_003410018.1.10430 WP_003410018.1.1044 WP_003410018.1.10440 WP_003410018.1.10445 WP_003410018.1.10471 WP_003410018.1.10472 WP_003410018.1.10489 WP_003410018.1.105 WP_003410018.1.10518 WP_003410018.1.10523 WP_003410018.1.10545 WP_003410018.1.1057 WP_003410018.1.10594 WP_003410018.1.10603 WP_003410018.1.10606 WP_003410018.1.10615 WP_003410018.1.10623 WP_003410018.1.10635 WP_003410018.1.10643 WP_003410018.1.10662 WP_003410018.1.10740 WP_003410018.1.10756 WP_003410018.1.10791 WP_003410018.1.10799 WP_003410018.1.10825 WP_003410018.1.10848 WP_003410018.1.10863 WP_003410018.1.10879 WP_003410018.1.10912 WP_003410018.1.10916 WP_003410018.1.10923 WP_003410018.1.1095 WP_003410018.1.10956 WP_003410018.1.10958 WP_003410018.1.10962 WP_003410018.1.10980 WP_003410018.1.10981 WP_003410018.1.10993 WP_003410018.1.1100 WP_003410018.1.11040 WP_003410018.1.11061 WP_003410018.1.11070 WP_003410018.1.11141 WP_003410018.1.11171 WP_003410018.1.11175 WP_003410018.1.11176 WP_003410018.1.11222 WP_003410018.1.11329 WP_003410018.1.1133 WP_003410018.1.11342 WP_003410018.1.11373 WP_003410018.1.11376 WP_003410018.1.11390 WP_003410018.1.11402 WP_003410018.1.11481 WP_003410018.1.11489 WP_003410018.1.11491 WP_003410018.1.11514 WP_003410018.1.11587 WP_003410018.1.11589 WP_003410018.1.11596 WP_003410018.1.11604 WP_003410018.1.11610 WP_003410018.1.11697 WP_003410018.1.11707 WP_003410018.1.11752 WP_003410018.1.11758 WP_003410018.1.11761 WP_003410018.1.11775 WP_003410018.1.11804 WP_003410018.1.11826 WP_003410018.1.11856 WP_003410018.1.11898 WP_003410018.1.11906 WP_003410018.1.11939 WP_003410018.1.11960 WP_003410018.1.11961 WP_003410018.1.11972 WP_003410018.1.11984 WP_003410018.1.120 WP_003410018.1.12001 WP_003410018.1.12049 WP_003410018.1.12052 WP_003410018.1.12100 WP_003410018.1.12116 WP_003410018.1.12130 WP_003410018.1.12133 WP_003410018.1.12161 WP_003410018.1.12165 WP_003410018.1.12184 WP_003410018.1.12187 WP_003410018.1.12190 WP_003410018.1.12216 WP_003410018.1.12265 WP_003410018.1.12275 WP_003410018.1.12294 WP_003410018.1.123 WP_003410018.1.1231 WP_003410018.1.12314 WP_003410018.1.12327 WP_003410018.1.12338 WP_003410018.1.1236 WP_003410018.1.12371 WP_003410018.1.12372 WP_003410018.1.12389 WP_003410018.1.12406 WP_003410018.1.1241 WP_003410018.1.12421 WP_003410018.1.12424 WP_003410018.1.12446 WP_003410018.1.12479 WP_003410018.1.12519 WP_003410018.1.12523 WP_003410018.1.12526 WP_003410018.1.1255 WP_003410018.1.12550 WP_003410018.1.12551 WP_003410018.1.12563 WP_003410018.1.12611 WP_003410018.1.12669 WP_003410018.1.1267 WP_003410018.1.12672 WP_003410018.1.12692 WP_003410018.1.1271 WP_003410018.1.12710 WP_003410018.1.12768 WP_003410018.1.1279 WP_003410018.1.12794 WP_003410018.1.12801 WP_003410018.1.12804 WP_003410018.1.12821 WP_003410018.1.12841 WP_003410018.1.12854 WP_003410018.1.12871 WP_003410018.1.12941 WP_003410018.1.12947 WP_003410018.1.12957 WP_003410018.1.12972 WP_003410018.1.13028 WP_003410018.1.13043 WP_003410018.1.13086 WP_003410018.1.13090 WP_003410018.1.13096 WP_003410018.1.13163 WP_003410018.1.13175 WP_003410018.1.13183 WP_003410018.1.132 WP_003410018.1.13249 WP_003410018.1.13282 WP_003410018.1.13284 WP_003410018.1.13296 WP_003410018.1.13298 WP_003410018.1.13302 WP_003410018.1.13306 WP_003410018.1.13312 WP_003410018.1.13313 WP_003410018.1.13321 WP_003410018.1.13345 WP_003410018.1.13358 WP_003410018.1.13370 WP_003410018.1.13375 WP_003410018.1.1338 WP_003410018.1.13420 WP_003410018.1.13433 WP_003410018.1.13435 WP_003410018.1.13438 WP_003410018.1.13461 WP_003410018.1.13466 WP_003410018.1.13489 WP_003410018.1.13526 WP_003410018.1.13551 WP_003410018.1.13561 WP_003410018.1.13564 WP_003410018.1.13579 WP_003410018.1.13647 WP_003410018.1.13667 WP_003410018.1.13687 WP_003410018.1.13697 WP_003410018.1.13719 WP_003410018.1.13763 WP_003410018.1.1377 WP_003410018.1.13774 WP_003410018.1.13786 WP_003410018.1.13793 WP_003410018.1.13794 WP_003410018.1.13817 WP_003410018.1.13834 WP_003410018.1.13866 WP_003410018.1.13880 WP_003410018.1.13899 WP_003410018.1.13909 WP_003410018.1.13910 WP_003410018.1.13919 WP_003410018.1.13920 WP_003410018.1.13952 WP_003410018.1.13953 WP_003410018.1.13962 WP_003410018.1.1398 WP_003410018.1.13988 WP_003410018.1.14027 WP_003410018.1.14046 WP_003410018.1.14115 WP_003410018.1.1415 WP_003410018.1.14158 WP_003410018.1.14162 WP_003410018.1.14175 WP_003410018.1.14178 WP_003410018.1.14194 WP_003410018.1.14195 WP_003410018.1.14208 WP_003410018.1.14238 WP_003410018.1.14266 WP_003410018.1.14273 WP_003410018.1.14303 WP_003410018.1.14306 WP_003410018.1.14307 WP_003410018.1.14310 WP_003410018.1.14341 WP_003410018.1.14382 WP_003410018.1.14416 WP_003410018.1.14428 WP_003410018.1.14441 WP_003410018.1.14469 WP_003410018.1.14477 WP_003410018.1.14504 WP_003410018.1.14514 WP_003410018.1.1452 WP_003410018.1.14527 WP_003410018.1.1454 WP_003410018.1.14544 WP_003410018.1.14548 WP_003410018.1.14551 WP_003410018.1.14561 WP_003410018.1.14573 WP_003410018.1.1462 WP_003410018.1.14658 WP_003410018.1.14667 WP_003410018.1.14668 WP_003410018.1.14675 WP_003410018.1.14694 WP_003410018.1.14695 WP_003410018.1.14709 WP_003410018.1.14766 WP_003410018.1.14783 WP_003410018.1.14865 WP_003410018.1.14872 WP_003410018.1.14905 WP_003410018.1.14926 WP_003410018.1.14951 WP_003410018.1.14955 WP_003410018.1.15003 WP_003410018.1.15009 WP_003410018.1.15028 WP_003410018.1.15040 WP_003410018.1.15052 WP_003410018.1.15065 WP_003410018.1.15072 WP_003410018.1.15089 WP_003410018.1.1509 WP_003410018.1.15126 WP_003410018.1.15131 WP_003410018.1.15168 WP_003410018.1.15172 WP_003410018.1.15174 WP_003410018.1.15196 WP_003410018.1.15210 WP_003410018.1.15216 WP_003410018.1.15217 WP_003410018.1.1523 WP_003410018.1.15232 WP_003410018.1.15238 WP_003410018.1.15240 WP_003410018.1.15253 WP_003410018.1.15267 WP_003410018.1.1527 WP_003410018.1.15292 WP_003410018.1.15299 WP_003410018.1.15302 WP_003410018.1.15322 WP_003410018.1.1534 WP_003410018.1.15345 WP_003410018.1.15365 WP_003410018.1.15372 WP_003410018.1.15386 WP_003410018.1.15387 WP_003410018.1.15442 WP_003410018.1.15447 WP_003410018.1.15449 WP_003410018.1.15477 WP_003410018.1.15481 WP_003410018.1.15492 WP_003410018.1.15511 WP_003410018.1.15512 WP_003410018.1.15559 WP_003410018.1.15566 WP_003410018.1.15599 WP_003410018.1.1560 WP_003410018.1.15611 WP_003410018.1.1563 WP_003410018.1.15633 WP_003410018.1.15643 WP_003410018.1.15688 WP_003410018.1.15755 WP_003410018.1.15763 WP_003410018.1.15774 WP_003410018.1.1578 WP_003410018.1.15780 WP_003410018.1.15827 WP_003410018.1.15834 WP_003410018.1.15842 WP_003410018.1.15848 WP_003410018.1.15853 WP_003410018.1.15870 WP_003410018.1.15877 WP_003410018.1.15893 WP_003410018.1.15926 WP_003410018.1.15933 WP_003410018.1.15946 WP_003410018.1.15958 WP_003410018.1.15973 WP_003410018.1.15987 WP_003410018.1.15993 WP_003410018.1.16009 WP_003410018.1.16025 WP_003410018.1.16043 WP_003410018.1.16055 WP_003410018.1.16066 WP_003410018.1.16069 WP_003410018.1.16077 WP_003410018.1.16106 WP_003410018.1.16108 WP_003410018.1.16110 WP_003410018.1.16130 WP_003410018.1.16139 WP_003410018.1.16141 WP_003410018.1.16143 WP_003410018.1.1630 WP_003410018.1.16318 WP_003410018.1.1632 WP_003410018.1.16327 WP_003410018.1.16334 WP_003410018.1.16341 WP_003410018.1.16345 WP_003410018.1.16374 WP_003410018.1.16384 WP_003410018.1.16386 WP_003410018.1.164 WP_003410018.1.1642 WP_003410018.1.16421 WP_003410018.1.16424 WP_003410018.1.16426 WP_003410018.1.16431 WP_003410018.1.16438 WP_003410018.1.1644 WP_003410018.1.16448 WP_003410018.1.16451 WP_003410018.1.16476 WP_003410018.1.16480 WP_003410018.1.16494 WP_003410018.1.1652 WP_003410018.1.16549 WP_003410018.1.16560 WP_003410018.1.16598 WP_003410018.1.16609 WP_003410018.1.16619 WP_003410018.1.16620 WP_003410018.1.16622 WP_003410018.1.16637 WP_003410018.1.1669 WP_003410018.1.16707 WP_003410018.1.16731 WP_003410018.1.16743 WP_003410018.1.1683 WP_003410018.1.16837 WP_003410018.1.16852 WP_003410018.1.16937 WP_003410018.1.16940 WP_003410018.1.16950 WP_003410018.1.16959 WP_003410018.1.1697 WP_003410018.1.16973 WP_003410018.1.16977 WP_003410018.1.16987 WP_003410018.1.17005 WP_003410018.1.17006 WP_003410018.1.17015 WP_003410018.1.17019 WP_003410018.1.17039 WP_003410018.1.17041 WP_003410018.1.17052 WP_003410018.1.17057 WP_003410018.1.17062 WP_003410018.1.1707 WP_003410018.1.17094 WP_003410018.1.17130 WP_003410018.1.17138 WP_003410018.1.17147 WP_003410018.1.17167 WP_003410018.1.17224 WP_003410018.1.17251 WP_003410018.1.17288 WP_003410018.1.17304 WP_003410018.1.17314 WP_003410018.1.17345 WP_003410018.1.17381 WP_003410018.1.17391 WP_003410018.1.17412 WP_003410018.1.1743 WP_003410018.1.17440 WP_003410018.1.17466 WP_003410018.1.17477 WP_003410018.1.17483 WP_003410018.1.17505 WP_003410018.1.17527 WP_003410018.1.17535 WP_003410018.1.17540 WP_003410018.1.17553 WP_003410018.1.17558 WP_003410018.1.17599 WP_003410018.1.17635 WP_003410018.1.17655 WP_003410018.1.17679 WP_003410018.1.1768 WP_003410018.1.17687 WP_003410018.1.17700 WP_003410018.1.17710 WP_003410018.1.17713 WP_003410018.1.17722 WP_003410018.1.17746 WP_003410018.1.17788 WP_003410018.1.17798 WP_003410018.1.17803 WP_003410018.1.17816 WP_003410018.1.17821 WP_003410018.1.17830 WP_003410018.1.17868 WP_003410018.1.17878 WP_003410018.1.1792 WP_003410018.1.17923 WP_003410018.1.1795 WP_003410018.1.17973 WP_003410018.1.18009 WP_003410018.1.18013 WP_003410018.1.18033 WP_003410018.1.18065 WP_003410018.1.18070 WP_003410018.1.18116 WP_003410018.1.18120 WP_003410018.1.18126 WP_003410018.1.1817 WP_003410018.1.18170 WP_003410018.1.18206 WP_003410018.1.18216 WP_003410018.1.18240 WP_003410018.1.18257 WP_003410018.1.18297 WP_003410018.1.18306 WP_003410018.1.18364 WP_003410018.1.18399 WP_003410018.1.18411 WP_003410018.1.18444 WP_003410018.1.18448 WP_003410018.1.18467 WP_003410018.1.18476 WP_003410018.1.18522 WP_003410018.1.18580 WP_003410018.1.18582 WP_003410018.1.18587 WP_003410018.1.186 WP_003410018.1.18601 WP_003410018.1.18639 WP_003410018.1.18646 WP_003410018.1.18647 WP_003410018.1.1868 WP_003410018.1.18694 WP_003410018.1.18710 WP_003410018.1.18751 WP_003410018.1.18781 WP_003410018.1.18793 WP_003410018.1.18804 WP_003410018.1.18816 WP_003410018.1.18823 WP_003410018.1.18827 WP_003410018.1.18838 WP_003410018.1.18849 WP_003410018.1.18856 WP_003410018.1.18945 WP_003410018.1.1898 WP_003410018.1.19005 WP_003410018.1.19056 WP_003410018.1.19063 WP_003410018.1.19066 WP_003410018.1.19071 WP_003410018.1.19094 WP_003410018.1.19144 WP_003410018.1.19159 WP_003410018.1.19193 WP_003410018.1.19231 WP_003410018.1.19243 WP_003410018.1.19295 WP_003410018.1.19307 WP_003410018.1.19326 WP_003410018.1.19364 WP_003410018.1.19382 WP_003410018.1.19400 WP_003410018.1.19426 WP_003410018.1.19429 WP_003410018.1.19464 WP_003410018.1.19480 WP_003410018.1.19512 WP_003410018.1.19553 WP_003410018.1.19562 WP_003410018.1.19564 WP_003410018.1.19568 WP_003410018.1.19595 WP_003410018.1.19596 WP_003410018.1.19600 WP_003410018.1.19630 WP_003410018.1.1967 WP_003410018.1.19694 WP_003410018.1.1970 WP_003410018.1.19707 WP_003410018.1.19742 WP_003410018.1.19785 WP_003410018.1.19820 WP_003410018.1.19868 WP_003410018.1.19874 WP_003410018.1.19890 WP_003410018.1.19900 WP_003410018.1.19922 WP_003410018.1.19936 WP_003410018.1.19946 WP_003410018.1.19949 WP_003410018.1.19960 WP_003410018.1.19964 WP_003410018.1.20007 WP_003410018.1.20016 WP_003410018.1.20028 WP_003410018.1.20037 WP_003410018.1.20039 WP_003410018.1.20082 WP_003410018.1.20085 WP_003410018.1.20097 WP_003410018.1.20116 WP_003410018.1.20130 WP_003410018.1.20140 WP_003410018.1.20141 WP_003410018.1.20142 WP_003410018.1.20158 WP_003410018.1.20239 WP_003410018.1.20243 WP_003410018.1.20259 WP_003410018.1.20262 WP_003410018.1.20268 WP_003410018.1.20272 WP_003410018.1.20273 WP_003410018.1.20294 WP_003410018.1.20300 WP_003410018.1.20309 WP_003410018.1.20322 WP_003410018.1.20372 WP_003410018.1.20381 WP_003410018.1.204 WP_003410018.1.20427 WP_003410018.1.20432 WP_003410018.1.20457 WP_003410018.1.20459 WP_003410018.1.20460 WP_003410018.1.20542 WP_003410018.1.20578 WP_003410018.1.20608 WP_003410018.1.20624 WP_003410018.1.20628 WP_003410018.1.2066 WP_003410018.1.20707 WP_003410018.1.20722 WP_003410018.1.20729 WP_003410018.1.20742 WP_003410018.1.20751 WP_003410018.1.20776 WP_003410018.1.20843 WP_003410018.1.20850 WP_003410018.1.2086 WP_003410018.1.20868 WP_003410018.1.20876 WP_003410018.1.20897 WP_003410018.1.20898 WP_003410018.1.2090 WP_003410018.1.20911 WP_003410018.1.20916 WP_003410018.1.20921 WP_003410018.1.20926 WP_003410018.1.20927 WP_003410018.1.20951 WP_003410018.1.20970 WP_003410018.1.2104 WP_003410018.1.21070 WP_003410018.1.21127 WP_003410018.1.21135 WP_003410018.1.21173 WP_003410018.1.21187 WP_003410018.1.212 WP_003410018.1.2120 WP_003410018.1.21218 WP_003410018.1.21219 WP_003410018.1.2123 WP_003410018.1.21231 WP_003410018.1.21234 WP_003410018.1.2126 WP_003410018.1.21292 WP_003410018.1.21307 WP_003410018.1.2131 WP_003410018.1.21321 WP_003410018.1.21365 WP_003410018.1.2137 WP_003410018.1.21392 WP_003410018.1.21403 WP_003410018.1.21415 WP_003410018.1.21418 WP_003410018.1.21430 WP_003410018.1.21434 WP_003410018.1.21444 WP_003410018.1.21468 WP_003410018.1.21498 WP_003410018.1.21509 WP_003410018.1.21513 WP_003410018.1.21565 WP_003410018.1.21586 WP_003410018.1.21594 WP_003410018.1.21602 WP_003410018.1.21615 WP_003410018.1.21638 WP_003410018.1.21639 WP_003410018.1.21655 WP_003410018.1.2168 WP_003410018.1.2174 WP_003410018.1.21741 WP_003410018.1.21742 WP_003410018.1.21777 WP_003410018.1.21786 WP_003410018.1.21795 WP_003410018.1.218 WP_003410018.1.21826 WP_003410018.1.21829 WP_003410018.1.21840 WP_003410018.1.21843 WP_003410018.1.21872 WP_003410018.1.21873 WP_003410018.1.2188 WP_003410018.1.21882 WP_003410018.1.21906 WP_003410018.1.21912 WP_003410018.1.2194 WP_003410018.1.21941 WP_003410018.1.21956 WP_003410018.1.21958 WP_003410018.1.21960 WP_003410018.1.21971 WP_003410018.1.21973 WP_003410018.1.21983 WP_003410018.1.22003 WP_003410018.1.22013 WP_003410018.1.22036 WP_003410018.1.22075 WP_003410018.1.22092 WP_003410018.1.2212 WP_003410018.1.22127 WP_003410018.1.22140 WP_003410018.1.22233 WP_003410018.1.22255 WP_003410018.1.22277 WP_003410018.1.22305 WP_003410018.1.22366 WP_003410018.1.2238 WP_003410018.1.22380 WP_003410018.1.22437 WP_003410018.1.22438 WP_003410018.1.22445 WP_003410018.1.22490 WP_003410018.1.22511 WP_003410018.1.22524 WP_003410018.1.2253 WP_003410018.1.22585 WP_003410018.1.22606 WP_003410018.1.22608 WP_003410018.1.22609 WP_003410018.1.22618 WP_003410018.1.2262 WP_003410018.1.22624 WP_003410018.1.22629 WP_003410018.1.22647 WP_003410018.1.22664 WP_003410018.1.22665 WP_003410018.1.22670 WP_003410018.1.22674 WP_003410018.1.22680 WP_003410018.1.22725 WP_003410018.1.22728 WP_003410018.1.22733 WP_003410018.1.22737 WP_003410018.1.2275 WP_003410018.1.22754 WP_003410018.1.22797 WP_003410018.1.22800 WP_003410018.1.22804 WP_003410018.1.22829 WP_003410018.1.22840 WP_003410018.1.22844 WP_003410018.1.22963 WP_003410018.1.22970 WP_003410018.1.22996 WP_003410018.1.22999 WP_003410018.1.23015 WP_003410018.1.23032 WP_003410018.1.231 WP_003410018.1.23101 WP_003410018.1.2312 WP_003410018.1.23140 WP_003410018.1.23153 WP_003410018.1.23171 WP_003410018.1.2320 WP_003410018.1.23204 WP_003410018.1.23216 WP_003410018.1.23229 WP_003410018.1.23233 WP_003410018.1.2326 WP_003410018.1.23261 WP_003410018.1.23272 WP_003410018.1.23289 WP_003410018.1.2329 WP_003410018.1.23308 WP_003410018.1.23316 WP_003410018.1.23321 WP_003410018.1.23325 WP_003410018.1.2339 WP_003410018.1.23406 WP_003410018.1.23438 WP_003410018.1.23447 WP_003410018.1.23452 WP_003410018.1.23461 WP_003410018.1.2349 WP_003410018.1.23496 WP_003410018.1.23497 WP_003410018.1.23506 WP_003410018.1.23530 WP_003410018.1.23539 WP_003410018.1.23546 WP_003410018.1.23551 WP_003410018.1.23573 WP_003410018.1.23583 WP_003410018.1.23588 WP_003410018.1.23628 WP_003410018.1.23677 WP_003410018.1.23683 WP_003410018.1.23692 WP_003410018.1.23694 WP_003410018.1.23699 WP_003410018.1.2371 WP_003410018.1.23803 WP_003410018.1.23807 WP_003410018.1.23825 WP_003410018.1.23832 WP_003410018.1.2384 WP_003410018.1.23843 WP_003410018.1.23863 WP_003410018.1.2387 WP_003410018.1.23993 WP_003410018.1.2400 WP_003410018.1.24008 WP_003410018.1.24046 WP_003410018.1.24057 WP_003410018.1.24062 WP_003410018.1.24113 WP_003410018.1.24119 WP_003410018.1.24128 WP_003410018.1.24140 WP_003410018.1.24176 WP_003410018.1.24190 WP_003410018.1.24202 WP_003410018.1.24244 WP_003410018.1.24261 WP_003410018.1.24284 WP_003410018.1.24294 WP_003410018.1.24357 WP_003410018.1.24396 WP_003410018.1.24414 WP_003410018.1.24423 WP_003410018.1.2443 WP_003410018.1.24446 WP_003410018.1.24461 WP_003410018.1.24500 WP_003410018.1.24507 WP_003410018.1.24509 WP_003410018.1.24529 WP_003410018.1.24553 WP_003410018.1.24629 WP_003410018.1.24648 WP_003410018.1.2466 WP_003410018.1.24767 WP_003410018.1.24824 WP_003410018.1.24831 WP_003410018.1.24840 WP_003410018.1.24848 WP_003410018.1.24857 WP_003410018.1.2487 WP_003410018.1.24893 WP_003410018.1.24907 WP_003410018.1.24933 WP_003410018.1.24956 WP_003410018.1.24958 WP_003410018.1.24985 WP_003410018.1.2499 WP_003410018.1.25004 WP_003410018.1.2505 WP_003410018.1.25051 WP_003410018.1.2507 WP_003410018.1.25096 WP_003410018.1.25103 WP_003410018.1.25129 WP_003410018.1.25171 WP_003410018.1.25184 WP_003410018.1.25247 WP_003410018.1.25252 WP_003410018.1.25278 WP_003410018.1.25283 WP_003410018.1.25309 WP_003410018.1.25313 WP_003410018.1.25338 WP_003410018.1.25342 WP_003410018.1.25367 WP_003410018.1.25393 WP_003410018.1.25406 WP_003410018.1.25435 WP_003410018.1.25437 WP_003410018.1.25445 WP_003410018.1.25455 WP_003410018.1.25473 WP_003410018.1.25504 WP_003410018.1.25513 WP_003410018.1.25542 WP_003410018.1.25579 WP_003410018.1.25594 WP_003410018.1.25606 WP_003410018.1.25645 WP_003410018.1.2566 WP_003410018.1.25673 WP_003410018.1.25693 WP_003410018.1.25699 WP_003410018.1.25727 WP_003410018.1.25736 WP_003410018.1.25738 WP_003410018.1.25759 WP_003410018.1.2580 WP_003410018.1.25813 WP_003410018.1.25853 WP_003410018.1.25854 WP_003410018.1.25874 WP_003410018.1.25885 WP_003410018.1.25892 WP_003410018.1.25906 WP_003410018.1.25914 WP_003410018.1.25916 WP_003410018.1.2594 WP_003410018.1.25954 WP_003410018.1.25965 WP_003410018.1.25972 WP_003410018.1.26017 WP_003410018.1.26032 WP_003410018.1.26038 WP_003410018.1.26072 WP_003410018.1.26089 WP_003410018.1.26097 WP_003410018.1.26098 WP_003410018.1.26108 WP_003410018.1.26109 WP_003410018.1.26118 WP_003410018.1.26126 WP_003410018.1.2614 WP_003410018.1.26168 WP_003410018.1.26182 WP_003410018.1.26190 WP_003410018.1.2620 WP_003410018.1.26234 WP_003410018.1.26243 WP_003410018.1.26265 WP_003410018.1.26267 WP_003410018.1.26292 WP_003410018.1.26310 WP_003410018.1.26328 WP_003410018.1.26349 WP_003410018.1.26366 WP_003410018.1.26374 WP_003410018.1.26407 WP_003410018.1.26412 WP_003410018.1.26454 WP_003410018.1.26464 WP_003410018.1.2653 WP_003410018.1.26560 WP_003410018.1.26571 WP_003410018.1.2659 WP_003410018.1.26597 WP_003410018.1.26603 WP_003410018.1.26651 WP_003410018.1.26702 WP_003410018.1.26707 WP_003410018.1.26710 WP_003410018.1.26719 WP_003410018.1.26737 WP_003410018.1.26738 WP_003410018.1.26745 WP_003410018.1.26756 WP_003410018.1.2676 WP_003410018.1.2677 WP_003410018.1.26779 WP_003410018.1.26780 WP_003410018.1.26798 WP_003410018.1.26868 WP_003410018.1.26876 WP_003410018.1.26888 WP_003410018.1.26914 WP_003410018.1.26945 WP_003410018.1.26959 WP_003410018.1.26969 WP_003410018.1.26984 WP_003410018.1.26992 WP_003410018.1.27004 WP_003410018.1.27045 WP_003410018.1.27074 WP_003410018.1.27128 WP_003410018.1.27139 WP_003410018.1.27152 WP_003410018.1.27162 WP_003410018.1.27164 WP_003410018.1.27193 WP_003410018.1.27235 WP_003410018.1.27254 WP_003410018.1.27278 WP_003410018.1.27343 WP_003410018.1.27352 WP_003410018.1.27369 WP_003410018.1.27391 WP_003410018.1.27398 WP_003410018.1.27402 WP_003410018.1.27410 WP_003410018.1.27411 WP_003410018.1.27449 WP_003410018.1.27460 WP_003410018.1.27463 WP_003410018.1.2749 WP_003410018.1.27492 WP_003410018.1.27528 WP_003410018.1.27541 WP_003410018.1.27576 WP_003410018.1.27582 WP_003410018.1.27607 WP_003410018.1.2766 WP_003410018.1.277 WP_003410018.1.27724 WP_003410018.1.27730 WP_003410018.1.27743 WP_003410018.1.27750 WP_003410018.1.27771 WP_003410018.1.27779 WP_003410018.1.27795 WP_003410018.1.27803 WP_003410018.1.27819 WP_003410018.1.27835 WP_003410018.1.27915 WP_003410018.1.27935 WP_003410018.1.27962 WP_003410018.1.28053 WP_003410018.1.28092 WP_003410018.1.28106 WP_003410018.1.28131 WP_003410018.1.28142 WP_003410018.1.28159 WP_003410018.1.2816 WP_003410018.1.28161 WP_003410018.1.28192 WP_003410018.1.28202 WP_003410018.1.28241 WP_003410018.1.28242 WP_003410018.1.28251 WP_003410018.1.28255 WP_003410018.1.28269 WP_003410018.1.28276 WP_003410018.1.28293 WP_003410018.1.28331 WP_003410018.1.28367 WP_003410018.1.28391 WP_003410018.1.2842 WP_003410018.1.2847 WP_003410018.1.28471 WP_003410018.1.28473 WP_003410018.1.28493 WP_003410018.1.28497 WP_003410018.1.28530 WP_003410018.1.28545 WP_003410018.1.28561 WP_003410018.1.28567 WP_003410018.1.28585 WP_003410018.1.286 WP_003410018.1.28610 WP_003410018.1.28617 WP_003410018.1.28634 WP_003410018.1.28642 WP_003410018.1.28671 WP_003410018.1.28682 WP_003410018.1.28698 WP_003410018.1.28703 WP_003410018.1.28739 WP_003410018.1.28758 WP_003410018.1.28781 WP_003410018.1.28787 WP_003410018.1.28827 WP_003410018.1.28839 WP_003410018.1.28847 WP_003410018.1.28850 WP_003410018.1.28851 WP_003410018.1.28865 WP_003410018.1.28897 WP_003410018.1.28914 WP_003410018.1.28935 WP_003410018.1.28936 WP_003410018.1.28939 WP_003410018.1.28943 WP_003410018.1.28952 WP_003410018.1.28975 WP_003410018.1.2899 WP_003410018.1.28993 WP_003410018.1.29000 WP_003410018.1.2901 WP_003410018.1.29028 WP_003410018.1.29033 WP_003410018.1.29058 WP_003410018.1.29078 WP_003410018.1.29102 WP_003410018.1.29115 WP_003410018.1.2916 WP_003410018.1.29217 WP_003410018.1.29223 WP_003410018.1.29234 WP_003410018.1.29264 WP_003410018.1.29275 WP_003410018.1.29306 WP_003410018.1.29339 WP_003410018.1.29348 WP_003410018.1.29364 WP_003410018.1.29367 WP_003410018.1.2938 WP_003410018.1.29399 WP_003410018.1.29426 WP_003410018.1.2944 WP_003410018.1.29450 WP_003410018.1.2949 WP_003410018.1.29510 WP_003410018.1.29515 WP_003410018.1.29525 WP_003410018.1.2953 WP_003410018.1.29559 WP_003410018.1.29587 WP_003410018.1.29592 WP_003410018.1.29599 WP_003410018.1.29611 WP_003410018.1.29632 WP_003410018.1.29649 WP_003410018.1.2965 WP_003410018.1.29659 WP_003410018.1.2969 WP_003410018.1.29696 WP_003410018.1.29698 WP_003410018.1.29718 WP_003410018.1.29742 WP_003410018.1.29745 WP_003410018.1.29747 WP_003410018.1.29825 WP_003410018.1.29830 WP_003410018.1.29847 WP_003410018.1.29861 WP_003410018.1.29869 WP_003410018.1.29883 WP_003410018.1.29890 WP_003410018.1.299 WP_003410018.1.29931 WP_003410018.1.29960 WP_003410018.1.30014 WP_003410018.1.3004 WP_003410018.1.30040 WP_003410018.1.30043 WP_003410018.1.30101 WP_003410018.1.30106 WP_003410018.1.30114 WP_003410018.1.30126 WP_003410018.1.30131 WP_003410018.1.30138 WP_003410018.1.30139 WP_003410018.1.30211 WP_003410018.1.30224 WP_003410018.1.30235 WP_003410018.1.30237 WP_003410018.1.3027 WP_003410018.1.30279 WP_003410018.1.30282 WP_003410018.1.30283 WP_003410018.1.30288 WP_003410018.1.30291 WP_003410018.1.30363 WP_003410018.1.30374 WP_003410018.1.30404 WP_003410018.1.3043 WP_003410018.1.30433 WP_003410018.1.30438 WP_003410018.1.30462 WP_003410018.1.30464 WP_003410018.1.30468 WP_003410018.1.30500 WP_003410018.1.3057 WP_003410018.1.30574 WP_003410018.1.30628 WP_003410018.1.30641 WP_003410018.1.30642 WP_003410018.1.30661 WP_003410018.1.30669 WP_003410018.1.30683 WP_003410018.1.30699 WP_003410018.1.30709 WP_003410018.1.30713 WP_003410018.1.30716 WP_003410018.1.30719 WP_003410018.1.30730 WP_003410018.1.30732 WP_003410018.1.30736 WP_003410018.1.30745 WP_003410018.1.30760 WP_003410018.1.30791 WP_003410018.1.30807 WP_003410018.1.30818 WP_003410018.1.30848 WP_003410018.1.30877 WP_003410018.1.30888 WP_003410018.1.30901 WP_003410018.1.30903 WP_003410018.1.30912 WP_003410018.1.30913 WP_003410018.1.30914 WP_003410018.1.30919 WP_003410018.1.30977 WP_003410018.1.3100 WP_003410018.1.31002 WP_003410018.1.3101 WP_003410018.1.31047 WP_003410018.1.31070 WP_003410018.1.31074 WP_003410018.1.31102 WP_003410018.1.31127 WP_003410018.1.31199 WP_003410018.1.31226 WP_003410018.1.31230 WP_003410018.1.31233 WP_003410018.1.31263 WP_003410018.1.31264 WP_003410018.1.31270 WP_003410018.1.31287 WP_003410018.1.31290 WP_003410018.1.31304 WP_003410018.1.31346 WP_003410018.1.31348 WP_003410018.1.31354 WP_003410018.1.31390 WP_003410018.1.31414 WP_003410018.1.31417 WP_003410018.1.31428 WP_003410018.1.3143 WP_003410018.1.31458 WP_003410018.1.31483 WP_003410018.1.3149 WP_003410018.1.31498 WP_003410018.1.31507 WP_003410018.1.31537 WP_003410018.1.31548 WP_003410018.1.31569 WP_003410018.1.31573 WP_003410018.1.316 WP_003410018.1.31629 WP_003410018.1.31666 WP_003410018.1.31693 WP_003410018.1.31703 WP_003410018.1.31744 WP_003410018.1.31745 WP_003410018.1.31770 WP_003410018.1.31776 WP_003410018.1.3184 WP_003410018.1.31840 WP_003410018.1.31880 WP_003410018.1.31911 WP_003410018.1.31930 WP_003410018.1.31932 WP_003410018.1.31955 WP_003410018.1.31985 WP_003410018.1.31991 WP_003410018.1.31995 WP_003410018.1.32004 WP_003410018.1.32039 WP_003410018.1.3204 WP_003410018.1.32045 WP_003410018.1.32071 WP_003410018.1.32098 WP_003410018.1.32132 WP_003410018.1.32157 WP_003410018.1.32164 WP_003410018.1.32179 WP_003410018.1.32198 WP_003410018.1.32297 WP_003410018.1.32317 WP_003410018.1.32383 WP_003410018.1.32400 WP_003410018.1.32403 WP_003410018.1.32416 WP_003410018.1.32421 WP_003410018.1.32433 WP_003410018.1.32461 WP_003410018.1.32482 WP_003410018.1.32556 WP_003410018.1.32562 WP_003410018.1.32569 WP_003410018.1.32592 WP_003410018.1.32620 WP_003410018.1.32647 WP_003410018.1.32653 WP_003410018.1.32654 WP_003410018.1.3268 WP_003410018.1.32706 WP_003410018.1.32716 WP_003410018.1.32738 WP_003410018.1.32752 WP_003410018.1.32780 WP_003410018.1.32793 WP_003410018.1.32799 WP_003410018.1.32822 WP_003410018.1.32862 WP_003410018.1.32880 WP_003410018.1.32897 WP_003410018.1.32909 WP_003410018.1.32935 WP_003410018.1.32974 WP_003410018.1.33007 WP_003410018.1.33028 WP_003410018.1.33035 WP_003410018.1.33044 WP_003410018.1.33054 WP_003410018.1.33082 WP_003410018.1.33141 WP_003410018.1.33148 WP_003410018.1.33155 WP_003410018.1.33168 WP_003410018.1.3321 WP_003410018.1.33215 WP_003410018.1.3325 WP_003410018.1.3327 WP_003410018.1.33278 WP_003410018.1.33288 WP_003410018.1.33305 WP_003410018.1.3331 WP_003410018.1.33319 WP_003410018.1.3333 WP_003410018.1.33393 WP_003410018.1.33403 WP_003410018.1.33452 WP_003410018.1.33467 WP_003410018.1.33477 WP_003410018.1.3349 WP_003410018.1.33519 WP_003410018.1.33542 WP_003410018.1.33601 WP_003410018.1.33602 WP_003410018.1.33633 WP_003410018.1.33673 WP_003410018.1.3369 WP_003410018.1.33705 WP_003410018.1.33762 WP_003410018.1.33783 WP_003410018.1.33789 WP_003410018.1.3383 WP_003410018.1.33832 WP_003410018.1.33839 WP_003410018.1.33848 WP_003410018.1.3387 WP_003410018.1.33886 WP_003410018.1.33895 WP_003410018.1.33906 WP_003410018.1.33912 WP_003410018.1.3399 WP_003410018.1.34042 WP_003410018.1.3405 WP_003410018.1.34055 WP_003410018.1.34056 WP_003410018.1.3408 WP_003410018.1.34090 WP_003410018.1.34109 WP_003410018.1.34111 WP_003410018.1.34131 WP_003410018.1.34152 WP_003410018.1.34153 WP_003410018.1.34163 WP_003410018.1.34181 WP_003410018.1.34197 WP_003410018.1.34198 WP_003410018.1.34215 WP_003410018.1.34219 WP_003410018.1.34255 WP_003410018.1.34260 WP_003410018.1.34275 WP_003410018.1.343 WP_003410018.1.34347 WP_003410018.1.34358 WP_003410018.1.34392 WP_003410018.1.344 WP_003410018.1.34428 WP_003410018.1.3443 WP_003410018.1.34435 WP_003410018.1.34446 WP_003410018.1.34499 WP_003410018.1.34505 WP_003410018.1.34516 WP_003410018.1.34529 WP_003410018.1.34551 WP_003410018.1.34563 WP_003410018.1.34576 WP_003410018.1.34581 WP_003410018.1.34588 WP_003410018.1.34596 WP_003410018.1.34599 WP_003410018.1.34639 WP_003410018.1.34673 WP_003410018.1.34724 WP_003410018.1.34740 WP_003410018.1.34755 WP_003410018.1.34777 WP_003410018.1.34783 WP_003410018.1.34841 WP_003410018.1.34908 WP_003410018.1.34919 WP_003410018.1.3492 WP_003410018.1.34933 WP_003410018.1.34945 WP_003410018.1.34946 WP_003410018.1.34954 WP_003410018.1.34960 WP_003410018.1.34961 WP_003410018.1.34963 WP_003410018.1.34965 WP_003410018.1.34968 WP_003410018.1.35069 WP_003410018.1.35072 WP_003410018.1.35078 WP_003410018.1.35100 WP_003410018.1.35146 WP_003410018.1.35156 WP_003410018.1.35160 WP_003410018.1.35162 WP_003410018.1.35173 WP_003410018.1.35176 WP_003410018.1.3520 WP_003410018.1.35221 WP_003410018.1.35246 WP_003410018.1.35278 WP_003410018.1.35301 WP_003410018.1.35311 WP_003410018.1.35312 WP_003410018.1.35317 WP_003410018.1.35319 WP_003410018.1.35347 WP_003410018.1.35363 WP_003410018.1.35382 WP_003410018.1.35385 WP_003410018.1.35396 WP_003410018.1.35397 WP_003410018.1.35426 WP_003410018.1.35439 WP_003410018.1.35455 WP_003410018.1.3548 WP_003410018.1.35484 WP_003410018.1.35492 WP_003410018.1.3553 WP_003410018.1.35553 WP_003410018.1.35561 WP_003410018.1.35602 WP_003410018.1.35610 WP_003410018.1.35635 WP_003410018.1.35657 WP_003410018.1.35680 WP_003410018.1.35687 WP_003410018.1.35689 WP_003410018.1.35707 WP_003410018.1.35732 WP_003410018.1.35754 WP_003410018.1.35767 WP_003410018.1.35770 WP_003410018.1.35771 WP_003410018.1.35780 WP_003410018.1.35805 WP_003410018.1.35811 WP_003410018.1.35821 WP_003410018.1.35848 WP_003410018.1.35864 WP_003410018.1.35874 WP_003410018.1.35876 WP_003410018.1.35897 WP_003410018.1.35899 WP_003410018.1.35923 WP_003410018.1.3593 WP_003410018.1.35954 WP_003410018.1.36005 WP_003410018.1.36014 WP_003410018.1.36051 WP_003410018.1.36053 WP_003410018.1.36075 WP_003410018.1.36089 WP_003410018.1.36097 WP_003410018.1.36098 WP_003410018.1.36116 WP_003410018.1.36145 WP_003410018.1.36156 WP_003410018.1.36205 WP_003410018.1.36228 WP_003410018.1.36246 WP_003410018.1.36252 WP_003410018.1.36260 WP_003410018.1.36270 WP_003410018.1.36271 WP_003410018.1.36303 WP_003410018.1.36309 WP_003410018.1.36315 WP_003410018.1.36319 WP_003410018.1.36321 WP_003410018.1.36326 WP_003410018.1.3634 WP_003410018.1.36356 WP_003410018.1.36357 WP_003410018.1.36385 WP_003410018.1.36399 WP_003410018.1.36436 WP_003410018.1.36469 WP_003410018.1.36473 WP_003410018.1.36508 WP_003410018.1.36540 WP_003410018.1.36561 WP_003410018.1.36571 WP_003410018.1.36573 WP_003410018.1.36578 WP_003410018.1.36585 WP_003410018.1.36597 WP_003410018.1.36614 WP_003410018.1.36657 WP_003410018.1.36674 WP_003410018.1.36720 WP_003410018.1.36727 WP_003410018.1.36733 WP_003410018.1.36785 WP_003410018.1.36810 WP_003410018.1.36844 WP_003410018.1.36851 WP_003410018.1.36862 WP_003410018.1.36893 WP_003410018.1.36901 WP_003410018.1.36921 WP_003410018.1.36935 WP_003410018.1.36941 WP_003410018.1.3695 WP_003410018.1.36951 WP_003410018.1.36968 WP_003410018.1.3700 WP_003410018.1.37004 WP_003410018.1.37012 WP_003410018.1.37071 WP_003410018.1.37088 WP_003410018.1.37131 WP_003410018.1.37157 WP_003410018.1.37175 WP_003410018.1.37188 WP_003410018.1.37229 WP_003410018.1.3724 WP_003410018.1.37277 WP_003410018.1.37305 WP_003410018.1.37389 WP_003410018.1.37400 WP_003410018.1.37440 WP_003410018.1.37459 WP_003410018.1.37475 WP_003410018.1.37484 WP_003410018.1.37601 WP_003410018.1.37612 WP_003410018.1.37643 WP_003410018.1.37655 WP_003410018.1.37660 WP_003410018.1.37700 WP_003410018.1.37701 WP_003410018.1.37709 WP_003410018.1.37711 WP_003410018.1.37721 WP_003410018.1.37722 WP_003410018.1.37747 WP_003410018.1.37765 WP_003410018.1.37772 WP_003410018.1.37804 WP_003410018.1.37809 WP_003410018.1.37859 WP_003410018.1.37877 WP_003410018.1.37912 WP_003410018.1.37913 WP_003410018.1.37943 WP_003410018.1.37950 WP_003410018.1.37973 WP_003410018.1.37975 WP_003410018.1.37983 WP_003410018.1.38 WP_003410018.1.38002 WP_003410018.1.3802 WP_003410018.1.38039 WP_003410018.1.38040 WP_003410018.1.38067 WP_003410018.1.38068 WP_003410018.1.38135 WP_003410018.1.38138 WP_003410018.1.38144 WP_003410018.1.38158 WP_003410018.1.38159 WP_003410018.1.38210 WP_003410018.1.38233 WP_003410018.1.38240 WP_003410018.1.38332 WP_003410018.1.38347 WP_003410018.1.38354 WP_003410018.1.38380 WP_003410018.1.38384 WP_003410018.1.38389 WP_003410018.1.38398 WP_003410018.1.38402 WP_003410018.1.38418 WP_003410018.1.38421 WP_003410018.1.38466 WP_003410018.1.38477 WP_003410018.1.38483 WP_003410018.1.3849 WP_003410018.1.385 WP_003410018.1.38530 WP_003410018.1.38535 WP_003410018.1.38539 WP_003410018.1.38594 WP_003410018.1.38601 WP_003410018.1.38611 WP_003410018.1.38638 WP_003410018.1.38639 WP_003410018.1.38646 WP_003410018.1.38648 WP_003410018.1.38654 WP_003410018.1.38659 WP_003410018.1.38660 WP_003410018.1.38666 WP_003410018.1.38672 WP_003410018.1.38677 WP_003410018.1.38750 WP_003410018.1.38772 WP_003410018.1.38812 WP_003410018.1.38821 WP_003410018.1.38844 WP_003410018.1.38863 WP_003410018.1.38865 WP_003410018.1.38873 WP_003410018.1.3889 WP_003410018.1.38894 WP_003410018.1.38939 WP_003410018.1.38974 WP_003410018.1.38991 WP_003410018.1.39025 WP_003410018.1.39070 WP_003410018.1.39072 WP_003410018.1.39095 WP_003410018.1.39106 WP_003410018.1.39165 WP_003410018.1.39174 WP_003410018.1.39176 WP_003410018.1.39178 WP_003410018.1.39190 WP_003410018.1.39201 WP_003410018.1.39207 WP_003410018.1.39211 WP_003410018.1.39236 WP_003410018.1.39239 WP_003410018.1.39252 WP_003410018.1.39288 WP_003410018.1.39295 WP_003410018.1.39306 WP_003410018.1.39364 WP_003410018.1.39400 WP_003410018.1.39447 WP_003410018.1.3945 WP_003410018.1.39450 WP_003410018.1.39455 WP_003410018.1.3949 WP_003410018.1.39521 WP_003410018.1.39560 WP_003410018.1.39592 WP_003410018.1.3960 WP_003410018.1.39616 WP_003410018.1.39654 WP_003410018.1.39661 WP_003410018.1.39674 WP_003410018.1.39678 WP_003410018.1.3968 WP_003410018.1.39694 WP_003410018.1.3971 WP_003410018.1.39718 WP_003410018.1.39728 WP_003410018.1.39739 WP_003410018.1.39748 WP_003410018.1.39751 WP_003410018.1.39759 WP_003410018.1.39801 WP_003410018.1.39804 WP_003410018.1.39848 WP_003410018.1.39877 WP_003410018.1.39925 WP_003410018.1.3994 WP_003410018.1.39959 WP_003410018.1.3996 WP_003410018.1.39960 WP_003410018.1.3997 WP_003410018.1.39980 WP_003410018.1.40000 WP_003410018.1.40028 WP_003410018.1.40029 WP_003410018.1.4003 WP_003410018.1.40094 WP_003410018.1.40096 WP_003410018.1.40150 WP_003410018.1.40156 WP_003410018.1.40174 WP_003410018.1.40186 WP_003410018.1.40276 WP_003410018.1.40277 WP_003410018.1.40323 WP_003410018.1.40336 WP_003410018.1.40353 WP_003410018.1.4036 WP_003410018.1.40372 WP_003410018.1.40402 WP_003410018.1.40413 WP_003410018.1.40440 WP_003410018.1.40446 WP_003410018.1.40451 WP_003410018.1.40455 WP_003410018.1.40523 WP_003410018.1.40543 WP_003410018.1.40641 WP_003410018.1.40646 WP_003410018.1.40651 WP_003410018.1.40653 WP_003410018.1.4067 WP_003410018.1.40705 WP_003410018.1.40723 WP_003410018.1.40731 WP_003410018.1.40735 WP_003410018.1.40795 WP_003410018.1.40799 WP_003410018.1.40852 WP_003410018.1.40876 WP_003410018.1.40881 WP_003410018.1.40922 WP_003410018.1.40948 WP_003410018.1.4095 WP_003410018.1.40956 WP_003410018.1.40957 WP_003410018.1.40964 WP_003410018.1.410 WP_003410018.1.41000 WP_003410018.1.41055 WP_003410018.1.41108 WP_003410018.1.41123 WP_003410018.1.41202 WP_003410018.1.41219 WP_003410018.1.41231 WP_003410018.1.41249 WP_003410018.1.4127 WP_003410018.1.41296 WP_003410018.1.41355 WP_003410018.1.41430 WP_003410018.1.41447 WP_003410018.1.41469 WP_003410018.1.41504 WP_003410018.1.41553 WP_003410018.1.41564 WP_003410018.1.41583 WP_003410018.1.41616 WP_003410018.1.41632 WP_003410018.1.41635 WP_003410018.1.41636 WP_003410018.1.41648 WP_003410018.1.41660 WP_003410018.1.41685 WP_003410018.1.41695 WP_003410018.1.41704 WP_003410018.1.4171 WP_003410018.1.41719 WP_003410018.1.41733 WP_003410018.1.41744 WP_003410018.1.41774 WP_003410018.1.41791 WP_003410018.1.41803 WP_003410018.1.41820 WP_003410018.1.41828 WP_003410018.1.41829 WP_003410018.1.41860 WP_003410018.1.41912 WP_003410018.1.41921 WP_003410018.1.41944 WP_003410018.1.42043 WP_003410018.1.42075 WP_003410018.1.42078 WP_003410018.1.42112 WP_003410018.1.4212 WP_003410018.1.42122 WP_003410018.1.42134 WP_003410018.1.42201 WP_003410018.1.42208 WP_003410018.1.42247 WP_003410018.1.42255 WP_003410018.1.42273 WP_003410018.1.42278 WP_003410018.1.42304 WP_003410018.1.42309 WP_003410018.1.42370 WP_003410018.1.42385 WP_003410018.1.42400 WP_003410018.1.42409 WP_003410018.1.42414 WP_003410018.1.42417 WP_003410018.1.42430 WP_003410018.1.42461 WP_003410018.1.42465 WP_003410018.1.42467 WP_003410018.1.42473 WP_003410018.1.42474 WP_003410018.1.4248 WP_003410018.1.42494 WP_003410018.1.42519 WP_003410018.1.42524 WP_003410018.1.42534 WP_003410018.1.4255 WP_003410018.1.42562 WP_003410018.1.42568 WP_003410018.1.42570 WP_003410018.1.42618 WP_003410018.1.42660 WP_003410018.1.42695 WP_003410018.1.42704 WP_003410018.1.42705 WP_003410018.1.42722 WP_003410018.1.42782 WP_003410018.1.42835 WP_003410018.1.42839 WP_003410018.1.42842 WP_003410018.1.42905 WP_003410018.1.42916 WP_003410018.1.42930 WP_003410018.1.42971 WP_003410018.1.43005 WP_003410018.1.43009 WP_003410018.1.43053 WP_003410018.1.43082 WP_003410018.1.43087 WP_003410018.1.43098 WP_003410018.1.43208 WP_003410018.1.43236 WP_003410018.1.43246 WP_003410018.1.43255 WP_003410018.1.43266 WP_003410018.1.43269 WP_003410018.1.43273 WP_003410018.1.43296 WP_003410018.1.43306 WP_003410018.1.4335 WP_003410018.1.43368 WP_003410018.1.43395 WP_003410018.1.43457 WP_003410018.1.43462 WP_003410018.1.43475 WP_003410018.1.43557 WP_003410018.1.43578 WP_003410018.1.43643 WP_003410018.1.43664 WP_003410018.1.43686 WP_003410018.1.43706 WP_003410018.1.43716 WP_003410018.1.4377 WP_003410018.1.43781 WP_003410018.1.43794 WP_003410018.1.43815 WP_003410018.1.43846 WP_003410018.1.43861 WP_003410018.1.43863 WP_003410018.1.43866 WP_003410018.1.43872 WP_003410018.1.43885 WP_003410018.1.43897 WP_003410018.1.4390 WP_003410018.1.43902 WP_003410018.1.43921 WP_003410018.1.43936 WP_003410018.1.43937 WP_003410018.1.43960 WP_003410018.1.43965 WP_003410018.1.43993 WP_003410018.1.43996 WP_003410018.1.44 WP_003410018.1.44001 WP_003410018.1.44008 WP_003410018.1.44016 WP_003410018.1.44037 WP_003410018.1.44041 WP_003410018.1.44071 WP_003410018.1.44076 WP_003410018.1.44104 WP_003410018.1.44111 WP_003410018.1.44124 WP_003410018.1.44169 WP_003410018.1.44219 WP_003410018.1.44237 WP_003410018.1.44277 WP_003410018.1.44279 WP_003410018.1.44355 WP_003410018.1.44358 WP_003410018.1.44390 WP_003410018.1.44392 WP_003410018.1.4441 WP_003410018.1.44415 WP_003410018.1.44464 WP_003410018.1.44466 WP_003410018.1.44489 WP_003410018.1.44492 WP_003410018.1.44494 WP_003410018.1.44500 WP_003410018.1.44519 WP_003410018.1.44526 WP_003410018.1.44532 WP_003410018.1.44534 WP_003410018.1.44562 WP_003410018.1.44589 WP_003410018.1.44597 WP_003410018.1.44600 WP_003410018.1.44602 WP_003410018.1.4464 WP_003410018.1.44651 WP_003410018.1.44659 WP_003410018.1.44665 WP_003410018.1.44694 WP_003410018.1.44700 WP_003410018.1.44713 WP_003410018.1.44735 WP_003410018.1.44757 WP_003410018.1.4476 WP_003410018.1.44761 WP_003410018.1.44767 WP_003410018.1.44776 WP_003410018.1.44779 WP_003410018.1.44786 WP_003410018.1.44808 WP_003410018.1.44908 WP_003410018.1.44913 WP_003410018.1.4492 WP_003410018.1.44939 WP_003410018.1.44979 WP_003410018.1.44981 WP_003410018.1.45002 WP_003410018.1.45011 WP_003410018.1.45062 WP_003410018.1.45066 WP_003410018.1.45081 WP_003410018.1.45113 WP_003410018.1.45129 WP_003410018.1.45135 WP_003410018.1.45147 WP_003410018.1.45168 WP_003410018.1.4517 WP_003410018.1.45181 WP_003410018.1.45185 WP_003410018.1.45192 WP_003410018.1.45200 WP_003410018.1.45205 WP_003410018.1.45211 WP_003410018.1.45249 WP_003410018.1.4526 WP_003410018.1.45286 WP_003410018.1.45326 WP_003410018.1.45347 WP_003410018.1.45374 WP_003410018.1.45390 WP_003410018.1.454 WP_003410018.1.45407 WP_003410018.1.45451 WP_003410018.1.45453 WP_003410018.1.45460 WP_003410018.1.45463 WP_003410018.1.45470 WP_003410018.1.45474 WP_003410018.1.45491 WP_003410018.1.45510 WP_003410018.1.45563 WP_003410018.1.45584 WP_003410018.1.45590 WP_003410018.1.45619 WP_003410018.1.45626 WP_003410018.1.45631 WP_003410018.1.45666 WP_003410018.1.45697 WP_003410018.1.4571 WP_003410018.1.45731 WP_003410018.1.45743 WP_003410018.1.45765 WP_003410018.1.45776 WP_003410018.1.45783 WP_003410018.1.45805 WP_003410018.1.45815 WP_003410018.1.45849 WP_003410018.1.45867 WP_003410018.1.45884 WP_003410018.1.4590 WP_003410018.1.45923 WP_003410018.1.45926 WP_003410018.1.45963 WP_003410018.1.45989 WP_003410018.1.45992 WP_003410018.1.46025 WP_003410018.1.46083 WP_003410018.1.46090 WP_003410018.1.46092 WP_003410018.1.46100 WP_003410018.1.46101 WP_003410018.1.46103 WP_003410018.1.46107 WP_003410018.1.46127 WP_003410018.1.46128 WP_003410018.1.46129 WP_003410018.1.46141 WP_003410018.1.46150 WP_003410018.1.46201 WP_003410018.1.46226 WP_003410018.1.4624 WP_003410018.1.46253 WP_003410018.1.46268 WP_003410018.1.46300 WP_003410018.1.46313 WP_003410018.1.46336 WP_003410018.1.46365 WP_003410018.1.46370 WP_003410018.1.46381 WP_003410018.1.46402 WP_003410018.1.46411 WP_003410018.1.4644 WP_003410018.1.46442 WP_003410018.1.46453 WP_003410018.1.46463 WP_003410018.1.46478 WP_003410018.1.46492 WP_003410018.1.46521 WP_003410018.1.4653 WP_003410018.1.46532 WP_003410018.1.46539 WP_003410018.1.46568 WP_003410018.1.46585 WP_003410018.1.46609 WP_003410018.1.46613 WP_003410018.1.46625 WP_003410018.1.46642 WP_003410018.1.46647 WP_003410018.1.46674 WP_003410018.1.46724 WP_003410018.1.46758 WP_003410018.1.46773 WP_003410018.1.46777 WP_003410018.1.46786 WP_003410018.1.46792 WP_003410018.1.46847 WP_003410018.1.4687 WP_003410018.1.46897 WP_003410018.1.46936 WP_003410018.1.46980 WP_003410018.1.47011 WP_003410018.1.47012 WP_003410018.1.47066 WP_003410018.1.47077 WP_003410018.1.47083 WP_003410018.1.47106 WP_003410018.1.47142 WP_003410018.1.47147 WP_003410018.1.47166 WP_003410018.1.47178 WP_003410018.1.47179 WP_003410018.1.47194 WP_003410018.1.47207 WP_003410018.1.47210 WP_003410018.1.47261 WP_003410018.1.47262 WP_003410018.1.47402 WP_003410018.1.47423 WP_003410018.1.47467 WP_003410018.1.47502 WP_003410018.1.47511 WP_003410018.1.47537 WP_003410018.1.47540 WP_003410018.1.47568 WP_003410018.1.47572 WP_003410018.1.47588 WP_003410018.1.47636 WP_003410018.1.4764 WP_003410018.1.47653 WP_003410018.1.47679 WP_003410018.1.47681 WP_003410018.1.47690 WP_003410018.1.4771 WP_003410018.1.47743 WP_003410018.1.47754 WP_003410018.1.47773 WP_003410018.1.47776 WP_003410018.1.47780 WP_003410018.1.47805 WP_003410018.1.47832 WP_003410018.1.47847 WP_003410018.1.47858 WP_003410018.1.47861 WP_003410018.1.47868 WP_003410018.1.47899 WP_003410018.1.479 WP_003410018.1.47912 WP_003410018.1.47913 WP_003410018.1.47926 WP_003410018.1.4794 WP_003410018.1.47944 WP_003410018.1.47959 WP_003410018.1.47974 WP_003410018.1.47993 WP_003410018.1.48004 WP_003410018.1.48084 WP_003410018.1.48097 WP_003410018.1.48101 WP_003410018.1.48109 WP_003410018.1.4813 WP_003410018.1.48130 WP_003410018.1.48135 WP_003410018.1.48143 WP_003410018.1.48155 WP_003410018.1.48170 WP_003410018.1.48173 WP_003410018.1.48177 WP_003410018.1.48185 WP_003410018.1.48204 WP_003410018.1.48219 WP_003410018.1.4823 WP_003410018.1.48240 WP_003410018.1.48256 WP_003410018.1.48264 WP_003410018.1.48287 WP_003410018.1.48333 WP_003410018.1.48348 WP_003410018.1.48372 WP_003410018.1.48383 WP_003410018.1.48388 WP_003410018.1.48419 WP_003410018.1.48423 WP_003410018.1.48443 WP_003410018.1.48450 WP_003410018.1.48462 WP_003410018.1.48543 WP_003410018.1.48550 WP_003410018.1.48605 WP_003410018.1.48618 WP_003410018.1.4863 WP_003410018.1.48648 WP_003410018.1.48658 WP_003410018.1.48666 WP_003410018.1.48687 WP_003410018.1.48779 WP_003410018.1.4878 WP_003410018.1.48798 WP_003410018.1.48802 WP_003410018.1.48826 WP_003410018.1.48831 WP_003410018.1.48843 WP_003410018.1.48857 WP_003410018.1.4890 WP_003410018.1.48946 WP_003410018.1.48979 WP_003410018.1.49017 WP_003410018.1.49048 WP_003410018.1.49059 WP_003410018.1.4906 WP_003410018.1.4907 WP_003410018.1.49103 WP_003410018.1.49110 WP_003410018.1.49111 WP_003410018.1.49112 WP_003410018.1.4919 WP_003410018.1.49251 WP_003410018.1.49254 WP_003410018.1.49263 WP_003410018.1.49291 WP_003410018.1.49296 WP_003410018.1.49335 WP_003410018.1.49337 WP_003410018.1.49426 WP_003410018.1.49437 WP_003410018.1.49439 WP_003410018.1.49474 WP_003410018.1.49506 WP_003410018.1.49516 WP_003410018.1.49523 WP_003410018.1.49526 WP_003410018.1.49532 WP_003410018.1.49588 WP_003410018.1.4959 WP_003410018.1.49678 WP_003410018.1.49687 WP_003410018.1.49699 WP_003410018.1.4972 WP_003410018.1.49736 WP_003410018.1.49746 WP_003410018.1.49764 WP_003410018.1.49773 WP_003410018.1.49796 WP_003410018.1.49814 WP_003410018.1.49815 WP_003410018.1.49816 WP_003410018.1.49839 WP_003410018.1.49857 WP_003410018.1.49878 WP_003410018.1.49880 WP_003410018.1.49944 WP_003410018.1.4999 WP_003410018.1.49990 WP_003410018.1.50068 WP_003410018.1.50077 WP_003410018.1.5008 WP_003410018.1.50081 WP_003410018.1.50122 WP_003410018.1.50126 WP_003410018.1.50149 WP_003410018.1.50162 WP_003410018.1.5018 WP_003410018.1.50194 WP_003410018.1.50218 WP_003410018.1.50235 WP_003410018.1.50249 WP_003410018.1.50265 WP_003410018.1.50271 WP_003410018.1.50324 WP_003410018.1.50347 WP_003410018.1.50398 WP_003410018.1.50407 WP_003410018.1.50444 WP_003410018.1.50466 WP_003410018.1.50472 WP_003410018.1.5048 WP_003410018.1.50498 WP_003410018.1.5050 WP_003410018.1.50540 WP_003410018.1.50554 WP_003410018.1.50557 WP_003410018.1.50601 WP_003410018.1.50610 WP_003410018.1.50632 WP_003410018.1.50633 WP_003410018.1.50642 WP_003410018.1.50655 WP_003410018.1.50659 WP_003410018.1.50683 WP_003410018.1.50689 WP_003410018.1.50692 WP_003410018.1.50714 WP_003410018.1.50729 WP_003410018.1.50756 WP_003410018.1.50784 WP_003410018.1.50794 WP_003410018.1.50841 WP_003410018.1.50860 WP_003410018.1.50868 WP_003410018.1.50877 WP_003410018.1.5096 WP_003410018.1.50981 WP_003410018.1.50987 WP_003410018.1.51003 WP_003410018.1.51009 WP_003410018.1.51037 WP_003410018.1.51074 WP_003410018.1.51082 WP_003410018.1.51101 WP_003410018.1.51116 WP_003410018.1.51149 WP_003410018.1.51157 WP_003410018.1.51232 WP_003410018.1.51239 WP_003410018.1.51247 WP_003410018.1.51266 WP_003410018.1.51279 WP_003410018.1.51291 WP_003410018.1.51294 WP_003410018.1.51301 WP_003410018.1.51329 WP_003410018.1.51391 WP_003410018.1.51422 WP_003410018.1.51445 WP_003410018.1.51455 WP_003410018.1.51466 WP_003410018.1.51468 WP_003410018.1.51478 WP_003410018.1.51497 WP_003410018.1.51520 WP_003410018.1.51593 WP_003410018.1.51628 WP_003410018.1.5164 WP_003410018.1.51647 WP_003410018.1.51660 WP_003410018.1.51696 WP_003410018.1.51721 WP_003410018.1.51788 WP_003410018.1.51795 WP_003410018.1.51801 WP_003410018.1.51817 WP_003410018.1.51819 WP_003410018.1.51854 WP_003410018.1.51923 WP_003410018.1.51942 WP_003410018.1.51963 WP_003410018.1.51969 WP_003410018.1.52000 WP_003410018.1.52001 WP_003410018.1.52003 WP_003410018.1.52006 WP_003410018.1.52036 WP_003410018.1.52038 WP_003410018.1.52046 WP_003410018.1.52059 WP_003410018.1.52069 WP_003410018.1.52082 WP_003410018.1.52102 WP_003410018.1.52106 WP_003410018.1.52166 WP_003410018.1.52173 WP_003410018.1.52178 WP_003410018.1.52206 WP_003410018.1.52216 WP_003410018.1.52238 WP_003410018.1.52241 WP_003410018.1.52280 WP_003410018.1.52314 WP_003410018.1.52385 WP_003410018.1.52390 WP_003410018.1.524 WP_003410018.1.52460 WP_003410018.1.52485 WP_003410018.1.52486 WP_003410018.1.52504 WP_003410018.1.52522 WP_003410018.1.52531 WP_003410018.1.52533 WP_003410018.1.52545 WP_003410018.1.52553 WP_003410018.1.52563 WP_003410018.1.52564 WP_003410018.1.52574 WP_003410018.1.52641 WP_003410018.1.52673 WP_003410018.1.52674 WP_003410018.1.52708 WP_003410018.1.52713 WP_003410018.1.52761 WP_003410018.1.52778 WP_003410018.1.52791 WP_003410018.1.52797 WP_003410018.1.52818 WP_003410018.1.52872 WP_003410018.1.52873 WP_003410018.1.52891 WP_003410018.1.52892 WP_003410018.1.52909 WP_003410018.1.52970 WP_003410018.1.52998 WP_003410018.1.53053 WP_003410018.1.53056 WP_003410018.1.5306 WP_003410018.1.53088 WP_003410018.1.5309 WP_003410018.1.531 WP_003410018.1.53118 WP_003410018.1.53142 WP_003410018.1.53143 WP_003410018.1.53157 WP_003410018.1.53167 WP_003410018.1.53200 WP_003410018.1.53204 WP_003410018.1.53213 WP_003410018.1.53217 WP_003410018.1.53226 WP_003410018.1.53229 WP_003410018.1.53230 WP_003410018.1.53237 WP_003410018.1.53254 WP_003410018.1.53257 WP_003410018.1.5327 WP_003410018.1.53276 WP_003410018.1.53278 WP_003410018.1.533 WP_003410018.1.53302 WP_003410018.1.5334 WP_003410018.1.5335 WP_003410018.1.53353 WP_003410018.1.53381 WP_003410018.1.53413 WP_003410018.1.53458 WP_003410018.1.53460 WP_003410018.1.53480 WP_003410018.1.53517 WP_003410018.1.53522 WP_003410018.1.53525 WP_003410018.1.53526 WP_003410018.1.53553 WP_003410018.1.53606 WP_003410018.1.53609 WP_003410018.1.53628 WP_003410018.1.53643 WP_003410018.1.53679 WP_003410018.1.53730 WP_003410018.1.53742 WP_003410018.1.53743 WP_003410018.1.53754 WP_003410018.1.53775 WP_003410018.1.53803 WP_003410018.1.53818 WP_003410018.1.53822 WP_003410018.1.53853 WP_003410018.1.53865 WP_003410018.1.53888 WP_003410018.1.53900 WP_003410018.1.53912 WP_003410018.1.53914 WP_003410018.1.53952 WP_003410018.1.5398 WP_003410018.1.5408 WP_003410018.1.54089 WP_003410018.1.54093 WP_003410018.1.54099 WP_003410018.1.54112 WP_003410018.1.54125 WP_003410018.1.54141 WP_003410018.1.54162 WP_003410018.1.54179 WP_003410018.1.54206 WP_003410018.1.54218 WP_003410018.1.54225 WP_003410018.1.54227 WP_003410018.1.54241 WP_003410018.1.54245 WP_003410018.1.54260 WP_003410018.1.54275 WP_003410018.1.54280 WP_003410018.1.5429 WP_003410018.1.54314 WP_003410018.1.54347 WP_003410018.1.54351 WP_003410018.1.54370 WP_003410018.1.54428 WP_003410018.1.54449 WP_003410018.1.54494 WP_003410018.1.54502 WP_003410018.1.54514 WP_003410018.1.54519 WP_003410018.1.54531 WP_003410018.1.54537 WP_003410018.1.54553 WP_003410018.1.54555 WP_003410018.1.54575 WP_003410018.1.54633 WP_003410018.1.54686 WP_003410018.1.54687 WP_003410018.1.54705 WP_003410018.1.54730 WP_003410018.1.54732 WP_003410018.1.5475 WP_003410018.1.54797 WP_003410018.1.54807 WP_003410018.1.54836 WP_003410018.1.54838 WP_003410018.1.54860 WP_003410018.1.54888 WP_003410018.1.54897 WP_003410018.1.54905 WP_003410018.1.54909 WP_003410018.1.54937 WP_003410018.1.54939 WP_003410018.1.54944 WP_003410018.1.54945 WP_003410018.1.54953 WP_003410018.1.54964 WP_003410018.1.55022 WP_003410018.1.55023 WP_003410018.1.55051 WP_003410018.1.55072 WP_003410018.1.55088 WP_003410018.1.55106 WP_003410018.1.55126 WP_003410018.1.55128 WP_003410018.1.55140 WP_003410018.1.55150 WP_003410018.1.55210 WP_003410018.1.55227 WP_003410018.1.55248 WP_003410018.1.55257 WP_003410018.1.55258 WP_003410018.1.55267 WP_003410018.1.55279 WP_003410018.1.55307 WP_003410018.1.55326 WP_003410018.1.55328 WP_003410018.1.5533 WP_003410018.1.55345 WP_003410018.1.55396 WP_003410018.1.55398 WP_003410018.1.55441 WP_003410018.1.55459 WP_003410018.1.55501 WP_003410018.1.55504 WP_003410018.1.55578 WP_003410018.1.55626 WP_003410018.1.55641 WP_003410018.1.55723 WP_003410018.1.55735 WP_003410018.1.5574 WP_003410018.1.55772 WP_003410018.1.55802 WP_003410018.1.55807 WP_003410018.1.55819 WP_003410018.1.55821 WP_003410018.1.5583 WP_003410018.1.55849 WP_003410018.1.55856 WP_003410018.1.55860 WP_003410018.1.55882 WP_003410018.1.55883 WP_003410018.1.55894 WP_003410018.1.55902 WP_003410018.1.55908 WP_003410018.1.55909 WP_003410018.1.5591 WP_003410018.1.55961 WP_003410018.1.55977 WP_003410018.1.55983 WP_003410018.1.56028 WP_003410018.1.56057 WP_003410018.1.56060 WP_003410018.1.56107 WP_003410018.1.56132 WP_003410018.1.56163 WP_003410018.1.56167 WP_003410018.1.56178 WP_003410018.1.56287 WP_003410018.1.56292 WP_003410018.1.56327 WP_003410018.1.56341 WP_003410018.1.56359 WP_003410018.1.56365 WP_003410018.1.56443 WP_003410018.1.56473 WP_003410018.1.56478 WP_003410018.1.56500 WP_003410018.1.56517 WP_003410018.1.56534 WP_003410018.1.5656 WP_003410018.1.56577 WP_003410018.1.56593 WP_003410018.1.56625 WP_003410018.1.56637 WP_003410018.1.56670 WP_003410018.1.56697 WP_003410018.1.567 WP_003410018.1.56701 WP_003410018.1.56709 WP_003410018.1.56729 WP_003410018.1.56743 WP_003410018.1.56755 WP_003410018.1.56764 WP_003410018.1.56795 WP_003410018.1.5681 WP_003410018.1.56827 WP_003410018.1.56839 WP_003410018.1.56863 WP_003410018.1.56868 WP_003410018.1.56869 WP_003410018.1.56915 WP_003410018.1.56926 WP_003410018.1.56961 WP_003410018.1.56971 WP_003410018.1.56972 WP_003410018.1.57023 WP_003410018.1.57035 WP_003410018.1.57077 WP_003410018.1.57087 WP_003410018.1.57134 WP_003410018.1.57151 WP_003410018.1.57169 WP_003410018.1.57208 WP_003410018.1.57212 WP_003410018.1.57230 WP_003410018.1.5724 WP_003410018.1.5725 WP_003410018.1.5727 WP_003410018.1.57273 WP_003410018.1.573 WP_003410018.1.57314 WP_003410018.1.57326 WP_003410018.1.57328 WP_003410018.1.57331 WP_003410018.1.57340 WP_003410018.1.57352 WP_003410018.1.57380 WP_003410018.1.57430 WP_003410018.1.5744 WP_003410018.1.57440 WP_003410018.1.57461 WP_003410018.1.57469 WP_003410018.1.57489 WP_003410018.1.575 WP_003410018.1.57509 WP_003410018.1.57519 WP_003410018.1.57525 WP_003410018.1.57551 WP_003410018.1.5758 WP_003410018.1.57596 WP_003410018.1.57616 WP_003410018.1.57617 WP_003410018.1.57619 WP_003410018.1.57627 WP_003410018.1.57642 WP_003410018.1.57658 WP_003410018.1.57667 WP_003410018.1.57675 WP_003410018.1.57689 WP_003410018.1.57708 WP_003410018.1.57794 WP_003410018.1.57821 WP_003410018.1.57825 WP_003410018.1.57843 WP_003410018.1.57906 WP_003410018.1.57924 WP_003410018.1.57926 WP_003410018.1.57930 WP_003410018.1.57957 WP_003410018.1.57960 WP_003410018.1.57991 WP_003410018.1.58000 WP_003410018.1.58086 WP_003410018.1.58101 WP_003410018.1.58103 WP_003410018.1.58108 WP_003410018.1.5811 WP_003410018.1.58121 WP_003410018.1.58145 WP_003410018.1.58164 WP_003410018.1.58174 WP_003410018.1.582 WP_003410018.1.58202 WP_003410018.1.58209 WP_003410018.1.58215 WP_003410018.1.5824 WP_003410018.1.58250 WP_003410018.1.58259 WP_003410018.1.58288 WP_003410018.1.58303 WP_003410018.1.58311 WP_003410018.1.58330 WP_003410018.1.58359 WP_003410018.1.58386 WP_003410018.1.58393 WP_003410018.1.58431 WP_003410018.1.5844 WP_003410018.1.58457 WP_003410018.1.58488 WP_003410018.1.58518 WP_003410018.1.58534 WP_003410018.1.58559 WP_003410018.1.58567 WP_003410018.1.58573 WP_003410018.1.58602 WP_003410018.1.58619 WP_003410018.1.58630 WP_003410018.1.5865 WP_003410018.1.58671 WP_003410018.1.58690 WP_003410018.1.58702 WP_003410018.1.58743 WP_003410018.1.58754 WP_003410018.1.5879 WP_003410018.1.5881 WP_003410018.1.58824 WP_003410018.1.58848 WP_003410018.1.58857 WP_003410018.1.58891 WP_003410018.1.58892 WP_003410018.1.5890 WP_003410018.1.58921 WP_003410018.1.58930 WP_003410018.1.58939 WP_003410018.1.58941 WP_003410018.1.58953 WP_003410018.1.58961 WP_003410018.1.5898 WP_003410018.1.59025 WP_003410018.1.59029 WP_003410018.1.59085 WP_003410018.1.59088 WP_003410018.1.59112 WP_003410018.1.59130 WP_003410018.1.5914 WP_003410018.1.59147 WP_003410018.1.59166 WP_003410018.1.59205 WP_003410018.1.59237 WP_003410018.1.59240 WP_003410018.1.59253 WP_003410018.1.59254 WP_003410018.1.59262 WP_003410018.1.59270 WP_003410018.1.5928 WP_003410018.1.59304 WP_003410018.1.59305 WP_003410018.1.59309 WP_003410018.1.59326 WP_003410018.1.59328 WP_003410018.1.59333 WP_003410018.1.59338 WP_003410018.1.59388 WP_003410018.1.59428 WP_003410018.1.59487 WP_003410018.1.59561 WP_003410018.1.59677 WP_003410018.1.59722 WP_003410018.1.59727 WP_003410018.1.59732 WP_003410018.1.59738 WP_003410018.1.59750 WP_003410018.1.59757 WP_003410018.1.59761 WP_003410018.1.59808 WP_003410018.1.59850 WP_003410018.1.59856 WP_003410018.1.59860 WP_003410018.1.59861 WP_003410018.1.5987 WP_003410018.1.59878 WP_003410018.1.59888 WP_003410018.1.59952 WP_003410018.1.5996 WP_003410018.1.59961 WP_003410018.1.59974 WP_003410018.1.6000 WP_003410018.1.60007 WP_003410018.1.60016 WP_003410018.1.6003 WP_003410018.1.6007 WP_003410018.1.60091 WP_003410018.1.60121 WP_003410018.1.60125 WP_003410018.1.60135 WP_003410018.1.60139 WP_003410018.1.60152 WP_003410018.1.60171 WP_003410018.1.60197 WP_003410018.1.6020 WP_003410018.1.60205 WP_003410018.1.60207 WP_003410018.1.60215 WP_003410018.1.60217 WP_003410018.1.60267 WP_003410018.1.60288 WP_003410018.1.60301 WP_003410018.1.60305 WP_003410018.1.60312 WP_003410018.1.60313 WP_003410018.1.60314 WP_003410018.1.60367 WP_003410018.1.60376 WP_003410018.1.60403 WP_003410018.1.60413 WP_003410018.1.60421 WP_003410018.1.60451 WP_003410018.1.60460 WP_003410018.1.60479 WP_003410018.1.60512 WP_003410018.1.60573 WP_003410018.1.60583 WP_003410018.1.60632 WP_003410018.1.60657 WP_003410018.1.60687 WP_003410018.1.60689 WP_003410018.1.60727 WP_003410018.1.60738 WP_003410018.1.60763 WP_003410018.1.6077 WP_003410018.1.60791 WP_003410018.1.60834 WP_003410018.1.60870 WP_003410018.1.60878 WP_003410018.1.60879 WP_003410018.1.60913 WP_003410018.1.60978 WP_003410018.1.61000 WP_003410018.1.61001 WP_003410018.1.61012 WP_003410018.1.61014 WP_003410018.1.61015 WP_003410018.1.61037 WP_003410018.1.61052 WP_003410018.1.61065 WP_003410018.1.61100 WP_003410018.1.61138 WP_003410018.1.61142 WP_003410018.1.61198 WP_003410018.1.61234 WP_003410018.1.61256 WP_003410018.1.61314 WP_003410018.1.61321 WP_003410018.1.61326 WP_003410018.1.61328 WP_003410018.1.61368 WP_003410018.1.61391 WP_003410018.1.61406 WP_003410018.1.61409 WP_003410018.1.61420 WP_003410018.1.61422 WP_003410018.1.61425 WP_003410018.1.61428 WP_003410018.1.61469 WP_003410018.1.61494 WP_003410018.1.61522 WP_003410018.1.61552 WP_003410018.1.61557 WP_003410018.1.61567 WP_003410018.1.61571 WP_003410018.1.61573 WP_003410018.1.61584 WP_003410018.1.61586 WP_003410018.1.6159 WP_003410018.1.61592 WP_003410018.1.6160 WP_003410018.1.61614 WP_003410018.1.6163 WP_003410018.1.61655 WP_003410018.1.61665 WP_003410018.1.61669 WP_003410018.1.61682 WP_003410018.1.61692 WP_003410018.1.61719 WP_003410018.1.61728 WP_003410018.1.61750 WP_003410018.1.61754 WP_003410018.1.61755 WP_003410018.1.61757 WP_003410018.1.61778 WP_003410018.1.6179 WP_003410018.1.61793 WP_003410018.1.61842 WP_003410018.1.61850 WP_003410018.1.61862 WP_003410018.1.61865 WP_003410018.1.61868 WP_003410018.1.61911 WP_003410018.1.61925 WP_003410018.1.61953 WP_003410018.1.61979 WP_003410018.1.61986 WP_003410018.1.61987 WP_003410018.1.61998 WP_003410018.1.62021 WP_003410018.1.62087 WP_003410018.1.62089 WP_003410018.1.62101 WP_003410018.1.62104 WP_003410018.1.6211 WP_003410018.1.62132 WP_003410018.1.62162 WP_003410018.1.62225 WP_003410018.1.62230 WP_003410018.1.62238 WP_003410018.1.62249 WP_003410018.1.62281 WP_003410018.1.62307 WP_003410018.1.6231 WP_003410018.1.62359 WP_003410018.1.62360 WP_003410018.1.62379 WP_003410018.1.62395 WP_003410018.1.62408 WP_003410018.1.62449 WP_003410018.1.62468 WP_003410018.1.6248 WP_003410018.1.62508 WP_003410018.1.62565 WP_003410018.1.62594 WP_003410018.1.62606 WP_003410018.1.62616 WP_003410018.1.62666 WP_003410018.1.62687 WP_003410018.1.62730 WP_003410018.1.62738 WP_003410018.1.62761 WP_003410018.1.62766 WP_003410018.1.62786 WP_003410018.1.62813 WP_003410018.1.62839 WP_003410018.1.62841 WP_003410018.1.62909 WP_003410018.1.62936 WP_003410018.1.6294 WP_003410018.1.6295 WP_003410018.1.63007 WP_003410018.1.63019 WP_003410018.1.63032 WP_003410018.1.63037 WP_003410018.1.63066 WP_003410018.1.63072 WP_003410018.1.6308 WP_003410018.1.63081 WP_003410018.1.63096 WP_003410018.1.63106 WP_003410018.1.6314 WP_003410018.1.63144 WP_003410018.1.63154 WP_003410018.1.63160 WP_003410018.1.63161 WP_003410018.1.63166 WP_003410018.1.63175 WP_003410018.1.63194 WP_003410018.1.6322 WP_003410018.1.63222 WP_003410018.1.63247 WP_003410018.1.6328 WP_003410018.1.63291 WP_003410018.1.63312 WP_003410018.1.63317 WP_003410018.1.63331 WP_003410018.1.63373 WP_003410018.1.63384 WP_003410018.1.63403 WP_003410018.1.63424 WP_003410018.1.63428 WP_003410018.1.6345 WP_003410018.1.63464 WP_003410018.1.63483 WP_003410018.1.63502 WP_003410018.1.63504 WP_003410018.1.63522 WP_003410018.1.63530 WP_003410018.1.63538 WP_003410018.1.63564 WP_003410018.1.63567 WP_003410018.1.63596 WP_003410018.1.63600 WP_003410018.1.63623 WP_003410018.1.63624 WP_003410018.1.63625 WP_003410018.1.63627 WP_003410018.1.63654 WP_003410018.1.63662 WP_003410018.1.63711 WP_003410018.1.63734 WP_003410018.1.63807 WP_003410018.1.63819 WP_003410018.1.63844 WP_003410018.1.63888 WP_003410018.1.63913 WP_003410018.1.63915 WP_003410018.1.63961 WP_003410018.1.63970 WP_003410018.1.64000 WP_003410018.1.64027 WP_003410018.1.64058 WP_003410018.1.64065 WP_003410018.1.6407 WP_003410018.1.64082 WP_003410018.1.64091 WP_003410018.1.64102 WP_003410018.1.64104 WP_003410018.1.64119 WP_003410018.1.64169 WP_003410018.1.64219 WP_003410018.1.6422 WP_003410018.1.64222 WP_003410018.1.64223 WP_003410018.1.64235 WP_003410018.1.64249 WP_003410018.1.6427 WP_003410018.1.64278 WP_003410018.1.64287 WP_003410018.1.64414 WP_003410018.1.64419 WP_003410018.1.6443 WP_003410018.1.64463 WP_003410018.1.64480 WP_003410018.1.64497 WP_003410018.1.64506 WP_003410018.1.64511 WP_003410018.1.64513 WP_003410018.1.64514 WP_003410018.1.64515 WP_003410018.1.64522 WP_003410018.1.64526 WP_003410018.1.6456 WP_003410018.1.64567 WP_003410018.1.64588 WP_003410018.1.64589 WP_003410018.1.64594 WP_003410018.1.64595 WP_003410018.1.64608 WP_003410018.1.64619 WP_003410018.1.64629 WP_003410018.1.6464 WP_003410018.1.64664 WP_003410018.1.64669 WP_003410018.1.64672 WP_003410018.1.64680 WP_003410018.1.64682 WP_003410018.1.64727 WP_003410018.1.64729 WP_003410018.1.64776 WP_003410018.1.64802 WP_003410018.1.64832 WP_003410018.1.6486 WP_003410018.1.64870 WP_003410018.1.64898 WP_003410018.1.64922 WP_003410018.1.64924 WP_003410018.1.6493 WP_003410018.1.64937 WP_003410018.1.64966 WP_003410018.1.64973 WP_003410018.1.65001 WP_003410018.1.65026 WP_003410018.1.65053 WP_003410018.1.65070 WP_003410018.1.65079 WP_003410018.1.65102 WP_003410018.1.65157 WP_003410018.1.65181 WP_003410018.1.65212 WP_003410018.1.6523 WP_003410018.1.65253 WP_003410018.1.65289 WP_003410018.1.65291 WP_003410018.1.65315 WP_003410018.1.65329 WP_003410018.1.65359 WP_003410018.1.6536 WP_003410018.1.65386 WP_003410018.1.65414 WP_003410018.1.65416 WP_003410018.1.65433 WP_003410018.1.65455 WP_003410018.1.65467 WP_003410018.1.65529 WP_003410018.1.65539 WP_003410018.1.65612 WP_003410018.1.65623 WP_003410018.1.65635 WP_003410018.1.65637 WP_003410018.1.65648 WP_003410018.1.65683 WP_003410018.1.65686 WP_003410018.1.65688 WP_003410018.1.65733 WP_003410018.1.65746 WP_003410018.1.65747 WP_003410018.1.65759 WP_003410018.1.65816 WP_003410018.1.65830 WP_003410018.1.65858 WP_003410018.1.65862 WP_003410018.1.65869 WP_003410018.1.65929 WP_003410018.1.65932 WP_003410018.1.65958 WP_003410018.1.65974 WP_003410018.1.66004 WP_003410018.1.66013 WP_003410018.1.6606 WP_003410018.1.66089 WP_003410018.1.66149 WP_003410018.1.66151 WP_003410018.1.66229 WP_003410018.1.66293 WP_003410018.1.66297 WP_003410018.1.66323 WP_003410018.1.66325 WP_003410018.1.6633 WP_003410018.1.66334 WP_003410018.1.66355 WP_003410018.1.66367 WP_003410018.1.66394 WP_003410018.1.66396 WP_003410018.1.66451 WP_003410018.1.66455 WP_003410018.1.66457 WP_003410018.1.66460 WP_003410018.1.66464 WP_003410018.1.66466 WP_003410018.1.66487 WP_003410018.1.66504 WP_003410018.1.66544 WP_003410018.1.66558 WP_003410018.1.66580 WP_003410018.1.66582 WP_003410018.1.66612 WP_003410018.1.66615 WP_003410018.1.66617 WP_003410018.1.66635 WP_003410018.1.66656 WP_003410018.1.66663 WP_003410018.1.66675 WP_003410018.1.66715 WP_003410018.1.66718 WP_003410018.1.66762 WP_003410018.1.66776 WP_003410018.1.66808 WP_003410018.1.66817 WP_003410018.1.66819 WP_003410018.1.66826 WP_003410018.1.66830 WP_003410018.1.66842 WP_003410018.1.66878 WP_003410018.1.66880 WP_003410018.1.66893 WP_003410018.1.66961 WP_003410018.1.67005 WP_003410018.1.6704 WP_003410018.1.67044 WP_003410018.1.67061 WP_003410018.1.67089 WP_003410018.1.67098 WP_003410018.1.67146 WP_003410018.1.67170 WP_003410018.1.67197 WP_003410018.1.67198 WP_003410018.1.6720 WP_003410018.1.67207 WP_003410018.1.67218 WP_003410018.1.67220 WP_003410018.1.67225 WP_003410018.1.67231 WP_003410018.1.6724 WP_003410018.1.67257 WP_003410018.1.67298 WP_003410018.1.67324 WP_003410018.1.67332 WP_003410018.1.67346 WP_003410018.1.67354 WP_003410018.1.67360 WP_003410018.1.67381 WP_003410018.1.67417 WP_003410018.1.67453 WP_003410018.1.67459 WP_003410018.1.6746 WP_003410018.1.67473 WP_003410018.1.67481 WP_003410018.1.67482 WP_003410018.1.67496 WP_003410018.1.67499 WP_003410018.1.67516 WP_003410018.1.67523 WP_003410018.1.67536 WP_003410018.1.67575 WP_003410018.1.67587 WP_003410018.1.67598 WP_003410018.1.67600 WP_003410018.1.67602 WP_003410018.1.67630 WP_003410018.1.67679 WP_003410018.1.67692 WP_003410018.1.67744 WP_003410018.1.6775 WP_003410018.1.67750 WP_003410018.1.6777 WP_003410018.1.67809 WP_003410018.1.67816 WP_003410018.1.67844 WP_003410018.1.67848 WP_003410018.1.67870 WP_003410018.1.67888 WP_003410018.1.67915 WP_003410018.1.67945 WP_003410018.1.67949 WP_003410018.1.67980 WP_003410018.1.67982 WP_003410018.1.68022 WP_003410018.1.68029 WP_003410018.1.68037 WP_003410018.1.68038 WP_003410018.1.68045 WP_003410018.1.68057 WP_003410018.1.68083 WP_003410018.1.68088 WP_003410018.1.68106 WP_003410018.1.68110 WP_003410018.1.68153 WP_003410018.1.68164 WP_003410018.1.68193 WP_003410018.1.68212 WP_003410018.1.68227 WP_003410018.1.68243 WP_003410018.1.6825 WP_003410018.1.68297 WP_003410018.1.68309 WP_003410018.1.68325 WP_003410018.1.68329 WP_003410018.1.68340 WP_003410018.1.68388 WP_003410018.1.68429 WP_003410018.1.6843 WP_003410018.1.68433 WP_003410018.1.68444 WP_003410018.1.68465 WP_003410018.1.68484 WP_003410018.1.68518 WP_003410018.1.68569 WP_003410018.1.68576 WP_003410018.1.68580 WP_003410018.1.68586 WP_003410018.1.68623 WP_003410018.1.68624 WP_003410018.1.68637 WP_003410018.1.68646 WP_003410018.1.68667 WP_003410018.1.68669 WP_003410018.1.68672 WP_003410018.1.68684 WP_003410018.1.68704 WP_003410018.1.68708 WP_003410018.1.6872 WP_003410018.1.68734 WP_003410018.1.68748 WP_003410018.1.68754 WP_003410018.1.6876 WP_003410018.1.68761 WP_003410018.1.68763 WP_003410018.1.68766 WP_003410018.1.68774 WP_003410018.1.68796 WP_003410018.1.68832 WP_003410018.1.68859 WP_003410018.1.68876 WP_003410018.1.68906 WP_003410018.1.68916 WP_003410018.1.68923 WP_003410018.1.68945 WP_003410018.1.6896 WP_003410018.1.68981 WP_003410018.1.68984 WP_003410018.1.68997 WP_003410018.1.69008 WP_003410018.1.69076 WP_003410018.1.69079 WP_003410018.1.6908 WP_003410018.1.69082 WP_003410018.1.69178 WP_003410018.1.69181 WP_003410018.1.69208 WP_003410018.1.69231 WP_003410018.1.69256 WP_003410018.1.69311 WP_003410018.1.69315 WP_003410018.1.69322 WP_003410018.1.69342 WP_003410018.1.6935 WP_003410018.1.6936 WP_003410018.1.69369 WP_003410018.1.69374 WP_003410018.1.69398 WP_003410018.1.69401 WP_003410018.1.69426 WP_003410018.1.69427 WP_003410018.1.69429 WP_003410018.1.6949 WP_003410018.1.6951 WP_003410018.1.69511 WP_003410018.1.69528 WP_003410018.1.69547 WP_003410018.1.69573 WP_003410018.1.69581 WP_003410018.1.6960 WP_003410018.1.69617 WP_003410018.1.69634 WP_003410018.1.69647 WP_003410018.1.69659 WP_003410018.1.69673 WP_003410018.1.69682 WP_003410018.1.69684 WP_003410018.1.69686 WP_003410018.1.69707 WP_003410018.1.69709 WP_003410018.1.69723 WP_003410018.1.69736 WP_003410018.1.69778 WP_003410018.1.69800 WP_003410018.1.69802 WP_003410018.1.69845 WP_003410018.1.69870 WP_003410018.1.69873 WP_003410018.1.69898 WP_003410018.1.69913 WP_003410018.1.69925 WP_003410018.1.69931 WP_003410018.1.69938 WP_003410018.1.69955 WP_003410018.1.69957 WP_003410018.1.69990 WP_003410018.1.70 WP_003410018.1.70000 WP_003410018.1.70017 WP_003410018.1.70032 WP_003410018.1.70055 WP_003410018.1.70062 WP_003410018.1.70072 WP_003410018.1.70132 WP_003410018.1.7022 WP_003410018.1.70227 WP_003410018.1.70255 WP_003410018.1.70271 WP_003410018.1.70274 WP_003410018.1.7029 WP_003410018.1.70325 WP_003410018.1.70328 WP_003410018.1.70356 WP_003410018.1.70364 WP_003410018.1.70368 WP_003410018.1.70418 WP_003410018.1.70422 WP_003410018.1.70435 WP_003410018.1.70444 WP_003410018.1.70463 WP_003410018.1.70471 WP_003410018.1.70480 WP_003410018.1.70494 WP_003410018.1.70498 WP_003410018.1.70505 WP_003410018.1.70525 WP_003410018.1.70573 WP_003410018.1.70577 WP_003410018.1.70610 WP_003410018.1.70615 WP_003410018.1.70618 WP_003410018.1.70622 WP_003410018.1.70626 WP_003410018.1.70668 WP_003410018.1.70699 WP_003410018.1.70704 WP_003410018.1.70729 WP_003410018.1.70757 WP_003410018.1.70782 WP_003410018.1.70796 WP_003410018.1.70834 WP_003410018.1.7084 WP_003410018.1.70840 WP_003410018.1.70864 WP_003410018.1.70871 WP_003410018.1.70915 WP_003410018.1.70955 WP_003410018.1.70958 WP_003410018.1.70964 WP_003410018.1.70976 WP_003410018.1.71015 WP_003410018.1.71026 WP_003410018.1.71063 WP_003410018.1.71076 WP_003410018.1.71083 WP_003410018.1.7111 WP_003410018.1.71118 WP_003410018.1.71128 WP_003410018.1.7113 WP_003410018.1.71187 WP_003410018.1.71191 WP_003410018.1.71255 WP_003410018.1.71258 WP_003410018.1.71259 WP_003410018.1.71289 WP_003410018.1.71326 WP_003410018.1.71329 WP_003410018.1.71331 WP_003410018.1.71344 WP_003410018.1.71390 WP_003410018.1.71399 WP_003410018.1.71414 WP_003410018.1.71440 WP_003410018.1.71457 WP_003410018.1.7146 WP_003410018.1.71464 WP_003410018.1.71490 WP_003410018.1.71492 WP_003410018.1.71509 WP_003410018.1.71516 WP_003410018.1.71517 WP_003410018.1.71527 WP_003410018.1.71532 WP_003410018.1.71545 WP_003410018.1.71546 WP_003410018.1.71569 WP_003410018.1.71604 WP_003410018.1.71621 WP_003410018.1.71630 WP_003410018.1.71638 WP_003410018.1.71654 WP_003410018.1.71665 WP_003410018.1.71683 WP_003410018.1.71701 WP_003410018.1.71718 WP_003410018.1.71731 WP_003410018.1.71778 WP_003410018.1.71803 WP_003410018.1.71820 WP_003410018.1.71847 WP_003410018.1.7185 WP_003410018.1.71851 WP_003410018.1.71871 WP_003410018.1.71909 WP_003410018.1.71957 WP_003410018.1.71970 WP_003410018.1.72061 WP_003410018.1.72062 WP_003410018.1.72072 WP_003410018.1.72111 WP_003410018.1.72122 WP_003410018.1.72128 WP_003410018.1.7216 WP_003410018.1.72168 WP_003410018.1.72179 WP_003410018.1.72209 WP_003410018.1.72218 WP_003410018.1.72219 WP_003410018.1.72227 WP_003410018.1.7224 WP_003410018.1.72268 WP_003410018.1.72332 WP_003410018.1.72380 WP_003410018.1.72401 WP_003410018.1.72441 WP_003410018.1.72451 WP_003410018.1.72452 WP_003410018.1.72457 WP_003410018.1.72459 WP_003410018.1.72460 WP_003410018.1.72466 WP_003410018.1.72487 WP_003410018.1.72488 WP_003410018.1.72492 WP_003410018.1.72543 WP_003410018.1.7256 WP_003410018.1.72576 WP_003410018.1.72578 WP_003410018.1.72585 WP_003410018.1.72591 WP_003410018.1.72592 WP_003410018.1.72640 WP_003410018.1.7266 WP_003410018.1.72661 WP_003410018.1.72739 WP_003410018.1.72744 WP_003410018.1.72755 WP_003410018.1.72759 WP_003410018.1.72784 WP_003410018.1.72792 WP_003410018.1.72831 WP_003410018.1.72852 WP_003410018.1.72853 WP_003410018.1.72879 WP_003410018.1.72880 WP_003410018.1.72938 WP_003410018.1.72954 WP_003410018.1.72957 WP_003410018.1.72959 WP_003410018.1.72973 WP_003410018.1.7298 WP_003410018.1.72982 WP_003410018.1.72988 WP_003410018.1.72993 WP_003410018.1.73006 WP_003410018.1.73013 WP_003410018.1.73025 WP_003410018.1.73028 WP_003410018.1.73042 WP_003410018.1.73045 WP_003410018.1.73092 WP_003410018.1.7312 WP_003410018.1.73127 WP_003410018.1.73134 WP_003410018.1.73150 WP_003410018.1.73154 WP_003410018.1.73182 WP_003410018.1.7321 WP_003410018.1.73310 WP_003410018.1.73315 WP_003410018.1.73365 WP_003410018.1.73391 WP_003410018.1.73404 WP_003410018.1.73436 WP_003410018.1.73445 WP_003410018.1.73453 WP_003410018.1.73465 WP_003410018.1.73466 WP_003410018.1.73470 WP_003410018.1.73471 WP_003410018.1.73478 WP_003410018.1.73482 WP_003410018.1.73532 WP_003410018.1.73550 WP_003410018.1.73564 WP_003410018.1.73623 WP_003410018.1.73629 WP_003410018.1.73644 WP_003410018.1.7366 WP_003410018.1.73661 WP_003410018.1.7368 WP_003410018.1.73723 WP_003410018.1.73744 WP_003410018.1.73750 WP_003410018.1.73760 WP_003410018.1.73774 WP_003410018.1.7379 WP_003410018.1.73813 WP_003410018.1.73840 WP_003410018.1.73876 WP_003410018.1.7389 WP_003410018.1.73986 WP_003410018.1.74016 WP_003410018.1.74039 WP_003410018.1.74083 WP_003410018.1.74101 WP_003410018.1.74107 WP_003410018.1.74120 WP_003410018.1.74129 WP_003410018.1.74144 WP_003410018.1.7417 WP_003410018.1.74190 WP_003410018.1.74210 WP_003410018.1.7423 WP_003410018.1.74259 WP_003410018.1.74262 WP_003410018.1.74269 WP_003410018.1.74282 WP_003410018.1.74291 WP_003410018.1.74296 WP_003410018.1.74304 WP_003410018.1.7432 WP_003410018.1.74347 WP_003410018.1.7436 WP_003410018.1.74378 WP_003410018.1.74382 WP_003410018.1.74395 WP_003410018.1.74400 WP_003410018.1.74401 WP_003410018.1.74432 WP_003410018.1.74442 WP_003410018.1.74477 WP_003410018.1.74487 WP_003410018.1.74499 WP_003410018.1.74504 WP_003410018.1.74511 WP_003410018.1.74523 WP_003410018.1.74525 WP_003410018.1.74551 WP_003410018.1.74555 WP_003410018.1.74628 WP_003410018.1.74641 WP_003410018.1.74653 WP_003410018.1.74660 WP_003410018.1.74683 WP_003410018.1.7469 WP_003410018.1.74725 WP_003410018.1.74760 WP_003410018.1.74809 WP_003410018.1.74820 WP_003410018.1.74870 WP_003410018.1.74881 WP_003410018.1.74888 WP_003410018.1.74952 WP_003410018.1.7496 WP_003410018.1.74988 WP_003410018.1.75043 WP_003410018.1.75045 WP_003410018.1.75055 WP_003410018.1.75078 WP_003410018.1.75081 WP_003410018.1.75120 WP_003410018.1.75188 WP_003410018.1.75202 WP_003410018.1.75234 WP_003410018.1.75239 WP_003410018.1.75250 WP_003410018.1.75263 WP_003410018.1.75281 WP_003410018.1.75342 WP_003410018.1.7535 WP_003410018.1.75376 WP_003410018.1.75391 WP_003410018.1.75395 WP_003410018.1.75441 WP_003410018.1.75510 WP_003410018.1.75581 WP_003410018.1.75598 WP_003410018.1.75635 WP_003410018.1.75645 WP_003410018.1.75665 WP_003410018.1.75671 WP_003410018.1.75741 WP_003410018.1.75749 WP_003410018.1.75772 WP_003410018.1.75774 WP_003410018.1.75811 WP_003410018.1.75833 WP_003410018.1.7585 WP_003410018.1.75864 WP_003410018.1.75868 WP_003410018.1.75878 WP_003410018.1.75927 WP_003410018.1.75946 WP_003410018.1.75968 WP_003410018.1.75974 WP_003410018.1.76007 WP_003410018.1.76016 WP_003410018.1.76032 WP_003410018.1.76037 WP_003410018.1.7604 WP_003410018.1.76045 WP_003410018.1.76052 WP_003410018.1.76058 WP_003410018.1.76064 WP_003410018.1.76110 WP_003410018.1.76126 WP_003410018.1.76133 WP_003410018.1.76138 WP_003410018.1.76157 WP_003410018.1.76172 WP_003410018.1.76177 WP_003410018.1.76183 WP_003410018.1.76209 WP_003410018.1.76272 WP_003410018.1.76277 WP_003410018.1.76280 WP_003410018.1.76281 WP_003410018.1.76291 WP_003410018.1.76297 WP_003410018.1.76360 WP_003410018.1.76379 WP_003410018.1.76403 WP_003410018.1.76413 WP_003410018.1.76414 WP_003410018.1.76436 WP_003410018.1.76442 WP_003410018.1.76456 WP_003410018.1.76521 WP_003410018.1.76533 WP_003410018.1.76616 WP_003410018.1.76625 WP_003410018.1.76629 WP_003410018.1.76635 WP_003410018.1.76638 WP_003410018.1.76639 WP_003410018.1.76640 WP_003410018.1.76644 WP_003410018.1.76677 WP_003410018.1.76678 WP_003410018.1.76679 WP_003410018.1.76734 WP_003410018.1.76744 WP_003410018.1.76750 WP_003410018.1.76754 WP_003410018.1.76757 WP_003410018.1.76781 WP_003410018.1.76824 WP_003410018.1.76835 WP_003410018.1.76873 WP_003410018.1.76881 WP_003410018.1.76888 WP_003410018.1.76900 WP_003410018.1.7691 WP_003410018.1.76947 WP_003410018.1.76954 WP_003410018.1.76963 WP_003410018.1.76976 WP_003410018.1.770 WP_003410018.1.77008 WP_003410018.1.77021 WP_003410018.1.77056 WP_003410018.1.77065 WP_003410018.1.77075 WP_003410018.1.77093 WP_003410018.1.77107 WP_003410018.1.77115 WP_003410018.1.77118 WP_003410018.1.77125 WP_003410018.1.77141 WP_003410018.1.77142 WP_003410018.1.77166 WP_003410018.1.77250 WP_003410018.1.77252 WP_003410018.1.77266 WP_003410018.1.77280 WP_003410018.1.77285 WP_003410018.1.77348 WP_003410018.1.77351 WP_003410018.1.77352 WP_003410018.1.77361 WP_003410018.1.774 WP_003410018.1.7740 WP_003410018.1.77404 WP_003410018.1.77463 WP_003410018.1.77474 WP_003410018.1.7748 WP_003410018.1.77484 WP_003410018.1.77491 WP_003410018.1.77499 WP_003410018.1.77510 WP_003410018.1.77530 WP_003410018.1.77554 WP_003410018.1.77559 WP_003410018.1.77599 WP_003410018.1.77605 WP_003410018.1.7762 WP_003410018.1.77627 WP_003410018.1.77649 WP_003410018.1.7766 WP_003410018.1.77667 WP_003410018.1.77704 WP_003410018.1.77706 WP_003410018.1.77726 WP_003410018.1.77774 WP_003410018.1.7778 WP_003410018.1.77790 WP_003410018.1.77820 WP_003410018.1.77843 WP_003410018.1.77855 WP_003410018.1.77865 WP_003410018.1.77868 WP_003410018.1.77879 WP_003410018.1.77890 WP_003410018.1.77911 WP_003410018.1.77931 WP_003410018.1.77984 WP_003410018.1.78020 WP_003410018.1.78024 WP_003410018.1.78075 WP_003410018.1.78084 WP_003410018.1.78086 WP_003410018.1.7809 WP_003410018.1.78098 WP_003410018.1.78105 WP_003410018.1.78113 WP_003410018.1.78136 WP_003410018.1.78162 WP_003410018.1.7817 WP_003410018.1.78200 WP_003410018.1.78216 WP_003410018.1.78236 WP_003410018.1.78238 WP_003410018.1.78322 WP_003410018.1.78338 WP_003410018.1.7836 WP_003410018.1.78360 WP_003410018.1.78386 WP_003410018.1.78429 WP_003410018.1.78435 WP_003410018.1.7844 WP_003410018.1.78459 WP_003410018.1.78488 WP_003410018.1.7849 WP_003410018.1.78499 WP_003410018.1.785 WP_003410018.1.78516 WP_003410018.1.78524 WP_003410018.1.78526 WP_003410018.1.78538 WP_003410018.1.78544 WP_003410018.1.78545 WP_003410018.1.78547 WP_003410018.1.78574 WP_003410018.1.78580 WP_003410018.1.7860 WP_003410018.1.78620 WP_003410018.1.78646 WP_003410018.1.78648 WP_003410018.1.78649 WP_003410018.1.78655 WP_003410018.1.78657 WP_003410018.1.78659 WP_003410018.1.7869 WP_003410018.1.78692 WP_003410018.1.78766 WP_003410018.1.78776 WP_003410018.1.78778 WP_003410018.1.78788 WP_003410018.1.78790 WP_003410018.1.78793 WP_003410018.1.78848 WP_003410018.1.78860 WP_003410018.1.7887 WP_003410018.1.78932 WP_003410018.1.78969 WP_003410018.1.78977 WP_003410018.1.78980 WP_003410018.1.79005 WP_003410018.1.79016 WP_003410018.1.79033 WP_003410018.1.79064 WP_003410018.1.79066 WP_003410018.1.79068 WP_003410018.1.79077 WP_003410018.1.79095 WP_003410018.1.79112 WP_003410018.1.79122 WP_003410018.1.79145 WP_003410018.1.79152 WP_003410018.1.79163 WP_003410018.1.79182 WP_003410018.1.79198 WP_003410018.1.79213 WP_003410018.1.79218 WP_003410018.1.79268 WP_003410018.1.79273 WP_003410018.1.79278 WP_003410018.1.79290 WP_003410018.1.79319 WP_003410018.1.79325 WP_003410018.1.79326 WP_003410018.1.7933 WP_003410018.1.79330 WP_003410018.1.79339 WP_003410018.1.79394 WP_003410018.1.79399 WP_003410018.1.79413 WP_003410018.1.79422 WP_003410018.1.79445 WP_003410018.1.79447 WP_003410018.1.79455 WP_003410018.1.79471 WP_003410018.1.79480 WP_003410018.1.79482 WP_003410018.1.79488 WP_003410018.1.79500 WP_003410018.1.79502 WP_003410018.1.79508 WP_003410018.1.79514 WP_003410018.1.79561 WP_003410018.1.79565 WP_003410018.1.79578 WP_003410018.1.79588 WP_003410018.1.79598 WP_003410018.1.79615 WP_003410018.1.79684 WP_003410018.1.79698 WP_003410018.1.797 WP_003410018.1.79744 WP_003410018.1.79784 WP_003410018.1.79802 WP_003410018.1.79806 WP_003410018.1.79819 WP_003410018.1.79826 WP_003410018.1.79828 WP_003410018.1.79851 WP_003410018.1.79853 WP_003410018.1.79863 WP_003410018.1.79881 WP_003410018.1.79885 WP_003410018.1.79898 WP_003410018.1.7990 WP_003410018.1.79900 WP_003410018.1.79913 WP_003410018.1.79918 WP_003410018.1.79947 WP_003410018.1.79948 WP_003410018.1.7995 WP_003410018.1.7997 WP_003410018.1.80004 WP_003410018.1.80015 WP_003410018.1.80022 WP_003410018.1.80030 WP_003410018.1.80054 WP_003410018.1.80084 WP_003410018.1.80099 WP_003410018.1.80129 WP_003410018.1.80177 WP_003410018.1.80234 WP_003410018.1.8026 WP_003410018.1.80275 WP_003410018.1.8029 WP_003410018.1.80299 WP_003410018.1.80300 WP_003410018.1.80304 WP_003410018.1.80326 WP_003410018.1.80351 WP_003410018.1.8037 WP_003410018.1.80370 WP_003410018.1.80387 WP_003410018.1.80399 WP_003410018.1.8044 WP_003410018.1.80451 WP_003410018.1.80458 WP_003410018.1.80461 WP_003410018.1.80490 WP_003410018.1.80503 WP_003410018.1.80507 WP_003410018.1.80552 WP_003410018.1.80576 WP_003410018.1.80588 WP_003410018.1.80599 WP_003410018.1.8060 WP_003410018.1.80624 WP_003410018.1.80636 WP_003410018.1.80669 WP_003410018.1.80673 WP_003410018.1.80711 WP_003410018.1.80714 WP_003410018.1.80743 WP_003410018.1.80784 WP_003410018.1.80815 WP_003410018.1.80853 WP_003410018.1.80918 WP_003410018.1.8093 WP_003410018.1.80967 WP_003410018.1.8097 WP_003410018.1.80988 WP_003410018.1.81007 WP_003410018.1.81013 WP_003410018.1.8105 WP_003410018.1.81059 WP_003410018.1.81063 WP_003410018.1.81066 WP_003410018.1.81075 WP_003410018.1.81091 WP_003410018.1.81119 WP_003410018.1.81125 WP_003410018.1.81136 WP_003410018.1.8114 WP_003410018.1.81189 WP_003410018.1.81192 WP_003410018.1.812 WP_003410018.1.81230 WP_003410018.1.81249 WP_003410018.1.81250 WP_003410018.1.81264 WP_003410018.1.81287 WP_003410018.1.81297 WP_003410018.1.8138 WP_003410018.1.81407 WP_003410018.1.8143 WP_003410018.1.81439 WP_003410018.1.81465 WP_003410018.1.81505 WP_003410018.1.81529 WP_003410018.1.81538 WP_003410018.1.81541 WP_003410018.1.81560 WP_003410018.1.81561 WP_003410018.1.81567 WP_003410018.1.81583 WP_003410018.1.81686 WP_003410018.1.81712 WP_003410018.1.81720 WP_003410018.1.81774 WP_003410018.1.81788 WP_003410018.1.81809 WP_003410018.1.81850 WP_003410018.1.81883 WP_003410018.1.81891 WP_003410018.1.81911 WP_003410018.1.81918 WP_003410018.1.82011 WP_003410018.1.82048 WP_003410018.1.82069 WP_003410018.1.82071 WP_003410018.1.82108 WP_003410018.1.82136 WP_003410018.1.82142 WP_003410018.1.8215 WP_003410018.1.82158 WP_003410018.1.8217 WP_003410018.1.82210 WP_003410018.1.82228 WP_003410018.1.82236 WP_003410018.1.82251 WP_003410018.1.82271 WP_003410018.1.82305 WP_003410018.1.82307 WP_003410018.1.82309 WP_003410018.1.82317 WP_003410018.1.8232 WP_003410018.1.82346 WP_003410018.1.82374 WP_003410018.1.82385 WP_003410018.1.82429 WP_003410018.1.82460 WP_003410018.1.82462 WP_003410018.1.82483 WP_003410018.1.82494 WP_003410018.1.82531 WP_003410018.1.82546 WP_003410018.1.82547 WP_003410018.1.82549 WP_003410018.1.82577 WP_003410018.1.82592 WP_003410018.1.82597 WP_003410018.1.82598 WP_003410018.1.82625 WP_003410018.1.82642 WP_003410018.1.82651 WP_003410018.1.82653 WP_003410018.1.82681 WP_003410018.1.82685 WP_003410018.1.8271 WP_003410018.1.82712 WP_003410018.1.8273 WP_003410018.1.82743 WP_003410018.1.82757 WP_003410018.1.82803 WP_003410018.1.82836 WP_003410018.1.82860 WP_003410018.1.82871 WP_003410018.1.82892 WP_003410018.1.82935 WP_003410018.1.82957 WP_003410018.1.82973 WP_003410018.1.82981 WP_003410018.1.82983 WP_003410018.1.83004 WP_003410018.1.83009 WP_003410018.1.83044 WP_003410018.1.83065 WP_003410018.1.83074 WP_003410018.1.83110 WP_003410018.1.83149 WP_003410018.1.83159 WP_003410018.1.8317 WP_003410018.1.83173 WP_003410018.1.83181 WP_003410018.1.83182 WP_003410018.1.83191 WP_003410018.1.83197 WP_003410018.1.83212 WP_003410018.1.8326 WP_003410018.1.83262 WP_003410018.1.83268 WP_003410018.1.83273 WP_003410018.1.83309 WP_003410018.1.83332 WP_003410018.1.83334 WP_003410018.1.83341 WP_003410018.1.83349 WP_003410018.1.8335 WP_003410018.1.83353 WP_003410018.1.83367 WP_003410018.1.83380 WP_003410018.1.83381 WP_003410018.1.83389 WP_003410018.1.83408 WP_003410018.1.83409 WP_003410018.1.83435 WP_003410018.1.83470 WP_003410018.1.83524 WP_003410018.1.83526 WP_003410018.1.83589 WP_003410018.1.83601 WP_003410018.1.83611 WP_003410018.1.83638 WP_003410018.1.83648 WP_003410018.1.83656 WP_003410018.1.83667 WP_003410018.1.83689 WP_003410018.1.83692 WP_003410018.1.83704 WP_003410018.1.83705 WP_003410018.1.83793 WP_003410018.1.83794 WP_003410018.1.83802 WP_003410018.1.83805 WP_003410018.1.83839 WP_003410018.1.83850 WP_003410018.1.83920 WP_003410018.1.83929 WP_003410018.1.83975 WP_003410018.1.83991 WP_003410018.1.8400 WP_003410018.1.84027 WP_003410018.1.8404 WP_003410018.1.84057 WP_003410018.1.84070 WP_003410018.1.8409 WP_003410018.1.84112 WP_003410018.1.84146 WP_003410018.1.8415 WP_003410018.1.84176 WP_003410018.1.84186 WP_003410018.1.84192 WP_003410018.1.84228 WP_003410018.1.8424 WP_003410018.1.84244 WP_003410018.1.84259 WP_003410018.1.8426 WP_003410018.1.84277 WP_003410018.1.84287 WP_003410018.1.8434 WP_003410018.1.84388 WP_003410018.1.84408 WP_003410018.1.84409 WP_003410018.1.84438 WP_003410018.1.84460 WP_003410018.1.84488 WP_003410018.1.84504 WP_003410018.1.84525 WP_003410018.1.84620 WP_003410018.1.84641 WP_003410018.1.84655 WP_003410018.1.84666 WP_003410018.1.84670 WP_003410018.1.84739 WP_003410018.1.84748 WP_003410018.1.84766 WP_003410018.1.84772 WP_003410018.1.84774 WP_003410018.1.848 WP_003410018.1.84812 WP_003410018.1.84836 WP_003410018.1.84839 WP_003410018.1.84846 WP_003410018.1.84873 WP_003410018.1.84911 WP_003410018.1.84938 WP_003410018.1.84973 WP_003410018.1.84981 WP_003410018.1.84985 WP_003410018.1.8503 WP_003410018.1.85038 WP_003410018.1.85041 WP_003410018.1.85043 WP_003410018.1.8505 WP_003410018.1.85074 WP_003410018.1.8509 WP_003410018.1.8512 WP_003410018.1.85148 WP_003410018.1.8518 WP_003410018.1.8522 WP_003410018.1.85242 WP_003410018.1.85276 WP_003410018.1.85281 WP_003410018.1.85284 WP_003410018.1.85314 WP_003410018.1.85319 WP_003410018.1.85330 WP_003410018.1.85341 WP_003410018.1.85346 WP_003410018.1.8535 WP_003410018.1.85363 WP_003410018.1.85371 WP_003410018.1.85377 WP_003410018.1.85387 WP_003410018.1.85399 WP_003410018.1.85458 WP_003410018.1.8546 WP_003410018.1.85464 WP_003410018.1.85478 WP_003410018.1.85480 WP_003410018.1.85488 WP_003410018.1.85495 WP_003410018.1.85551 WP_003410018.1.85577 WP_003410018.1.85597 WP_003410018.1.85599 WP_003410018.1.85610 WP_003410018.1.8563 WP_003410018.1.85648 WP_003410018.1.85679 WP_003410018.1.85704 WP_003410018.1.85717 WP_003410018.1.85727 WP_003410018.1.85737 WP_003410018.1.85763 WP_003410018.1.85808 WP_003410018.1.85819 WP_003410018.1.85820 WP_003410018.1.85823 WP_003410018.1.85832 WP_003410018.1.8586 WP_003410018.1.85872 WP_003410018.1.85894 WP_003410018.1.85909 WP_003410018.1.85913 WP_003410018.1.85953 WP_003410018.1.85986 WP_003410018.1.86000 WP_003410018.1.86024 WP_003410018.1.86025 WP_003410018.1.86032 WP_003410018.1.86048 WP_003410018.1.86052 WP_003410018.1.86067 WP_003410018.1.86103 WP_003410018.1.86122 WP_003410018.1.86124 WP_003410018.1.86160 WP_003410018.1.86164 WP_003410018.1.86168 WP_003410018.1.86190 WP_003410018.1.86204 WP_003410018.1.86208 WP_003410018.1.86235 WP_003410018.1.86249 WP_003410018.1.86260 WP_003410018.1.86290 WP_003410018.1.863 WP_003410018.1.86327 WP_003410018.1.86334 WP_003410018.1.86337 WP_003410018.1.86368 WP_003410018.1.86377 WP_003410018.1.86425 WP_003410018.1.86459 WP_003410018.1.8649 WP_003410018.1.86499 WP_003410018.1.86561 WP_003410018.1.86568 WP_003410018.1.86575 WP_003410018.1.86584 WP_003410018.1.86605 WP_003410018.1.86648 WP_003410018.1.8666 WP_003410018.1.86684 WP_003410018.1.86705 WP_003410018.1.86718 WP_003410018.1.86725 WP_003410018.1.86766 WP_003410018.1.86801 WP_003410018.1.86814 WP_003410018.1.86820 WP_003410018.1.86825 WP_003410018.1.86834 WP_003410018.1.8685 WP_003410018.1.86851 WP_003410018.1.86855 WP_003410018.1.86867 WP_003410018.1.86883 WP_003410018.1.8689 WP_003410018.1.86892 WP_003410018.1.86933 WP_003410018.1.86941 WP_003410018.1.86950 WP_003410018.1.86963 WP_003410018.1.86979 WP_003410018.1.8700 WP_003410018.1.87001 WP_003410018.1.87002 WP_003410018.1.87031 WP_003410018.1.87116 WP_003410018.1.87117 WP_003410018.1.8714 WP_003410018.1.87162 WP_003410018.1.87178 WP_003410018.1.87191 WP_003410018.1.87201 WP_003410018.1.87209 WP_003410018.1.87240 WP_003410018.1.87275 WP_003410018.1.8733 WP_003410018.1.87345 WP_003410018.1.87369 WP_003410018.1.8737 WP_003410018.1.87401 WP_003410018.1.87404 WP_003410018.1.87406 WP_003410018.1.87409 WP_003410018.1.87444 WP_003410018.1.87446 WP_003410018.1.87459 WP_003410018.1.87472 WP_003410018.1.87489 WP_003410018.1.87494 WP_003410018.1.87496 WP_003410018.1.87582 WP_003410018.1.87588 WP_003410018.1.87617 WP_003410018.1.87619 WP_003410018.1.87620 WP_003410018.1.87634 WP_003410018.1.87643 WP_003410018.1.8765 WP_003410018.1.87650 WP_003410018.1.87654 WP_003410018.1.87658 WP_003410018.1.87665 WP_003410018.1.87676 WP_003410018.1.87677 WP_003410018.1.87684 WP_003410018.1.87692 WP_003410018.1.87707 WP_003410018.1.87732 WP_003410018.1.87784 WP_003410018.1.87796 WP_003410018.1.87809 WP_003410018.1.87827 WP_003410018.1.87831 WP_003410018.1.87835 WP_003410018.1.87837 WP_003410018.1.87866 WP_003410018.1.8789 WP_003410018.1.87911 WP_003410018.1.87924 WP_003410018.1.87951 WP_003410018.1.87955 WP_003410018.1.87956 WP_003410018.1.87991 WP_003410018.1.88 WP_003410018.1.88002 WP_003410018.1.88037 WP_003410018.1.88039 WP_003410018.1.88077 WP_003410018.1.88121 WP_003410018.1.88180 WP_003410018.1.88191 WP_003410018.1.88205 WP_003410018.1.88217 WP_003410018.1.88219 WP_003410018.1.88245 WP_003410018.1.88253 WP_003410018.1.88294 WP_003410018.1.88315 WP_003410018.1.88316 WP_003410018.1.88320 WP_003410018.1.88338 WP_003410018.1.8840 WP_003410018.1.88437 WP_003410018.1.88453 WP_003410018.1.88469 WP_003410018.1.88489 WP_003410018.1.88521 WP_003410018.1.88530 WP_003410018.1.88537 WP_003410018.1.88541 WP_003410018.1.88592 WP_003410018.1.88616 WP_003410018.1.88618 WP_003410018.1.8862 WP_003410018.1.88625 WP_003410018.1.88632 WP_003410018.1.88634 WP_003410018.1.88649 WP_003410018.1.8870 WP_003410018.1.88737 WP_003410018.1.88756 WP_003410018.1.888 WP_003410018.1.88824 WP_003410018.1.88886 WP_003410018.1.88965 WP_003410018.1.88985 WP_003410018.1.8902 WP_003410018.1.89025 WP_003410018.1.89041 WP_003410018.1.89046 WP_003410018.1.89082 WP_003410018.1.89162 WP_003410018.1.89168 WP_003410018.1.8917 WP_003410018.1.89193 WP_003410018.1.89205 WP_003410018.1.89207 WP_003410018.1.89225 WP_003410018.1.8925 WP_003410018.1.89277 WP_003410018.1.89286 WP_003410018.1.89293 WP_003410018.1.89320 WP_003410018.1.8935 WP_003410018.1.89371 WP_003410018.1.89378 WP_003410018.1.89392 WP_003410018.1.89406 WP_003410018.1.8943 WP_003410018.1.89451 WP_003410018.1.89453 WP_003410018.1.89473 WP_003410018.1.89475 WP_003410018.1.895 WP_003410018.1.89513 WP_003410018.1.89517 WP_003410018.1.8954 WP_003410018.1.89567 WP_003410018.1.8957 WP_003410018.1.89572 WP_003410018.1.89589 WP_003410018.1.89607 WP_003410018.1.89613 WP_003410018.1.89625 WP_003410018.1.89648 WP_003410018.1.8967 WP_003410018.1.89670 WP_003410018.1.89676 WP_003410018.1.89729 WP_003410018.1.89762 WP_003410018.1.8977 WP_003410018.1.89802 WP_003410018.1.89808 WP_003410018.1.8982 WP_003410018.1.89829 WP_003410018.1.89831 WP_003410018.1.89844 WP_003410018.1.89849 WP_003410018.1.8989 WP_003410018.1.89901 WP_003410018.1.89903 WP_003410018.1.89909 WP_003410018.1.8992 WP_003410018.1.89922 WP_003410018.1.89926 WP_003410018.1.89963 WP_003410018.1.89971 WP_003410018.1.8998 WP_003410018.1.89987 WP_003410018.1.900 WP_003410018.1.90048 WP_003410018.1.9007 WP_003410018.1.90080 WP_003410018.1.90130 WP_003410018.1.90134 WP_003410018.1.90137 WP_003410018.1.90157 WP_003410018.1.90184 WP_003410018.1.90199 WP_003410018.1.90231 WP_003410018.1.90308 WP_003410018.1.90322 WP_003410018.1.90328 WP_003410018.1.90372 WP_003410018.1.90439 WP_003410018.1.90481 WP_003410018.1.90499 WP_003410018.1.9050 WP_003410018.1.90527 WP_003410018.1.90560 WP_003410018.1.90612 WP_003410018.1.90640 WP_003410018.1.90672 WP_003410018.1.90691 WP_003410018.1.90711 WP_003410018.1.90722 WP_003410018.1.9075 WP_003410018.1.90756 WP_003410018.1.90767 WP_003410018.1.90771 WP_003410018.1.90785 WP_003410018.1.90788 WP_003410018.1.90800 WP_003410018.1.90810 WP_003410018.1.90816 WP_003410018.1.90819 WP_003410018.1.9082 WP_003410018.1.90831 WP_003410018.1.90884 WP_003410018.1.90899 WP_003410018.1.90906 WP_003410018.1.90958 WP_003410018.1.90976 WP_003410018.1.90977 WP_003410018.1.90987 WP_003410018.1.9102 WP_003410018.1.91026 WP_003410018.1.91032 WP_003410018.1.91043 WP_003410018.1.91053 WP_003410018.1.91082 WP_003410018.1.91106 WP_003410018.1.91112 WP_003410018.1.91144 WP_003410018.1.91151 WP_003410018.1.91157 WP_003410018.1.91167 WP_003410018.1.91169 WP_003410018.1.91192 WP_003410018.1.91207 WP_003410018.1.91208 WP_003410018.1.91211 WP_003410018.1.91214 WP_003410018.1.91230 WP_003410018.1.91244 WP_003410018.1.91251 WP_003410018.1.91260 WP_003410018.1.91265 WP_003410018.1.9128 WP_003410018.1.91284 WP_003410018.1.91303 WP_003410018.1.91322 WP_003410018.1.91352 WP_003410018.1.91386 WP_003410018.1.9139 WP_003410018.1.91398 WP_003410018.1.91411 WP_003410018.1.91430 WP_003410018.1.91436 WP_003410018.1.91483 WP_003410018.1.91496 WP_003410018.1.91507 WP_003410018.1.91508 WP_003410018.1.91576 WP_003410018.1.91589 WP_003410018.1.91694 WP_003410018.1.91695 WP_003410018.1.91713 WP_003410018.1.91716 WP_003410018.1.91717 WP_003410018.1.91728 WP_003410018.1.91743 WP_003410018.1.91759 WP_003410018.1.91784 WP_003410018.1.91785 WP_003410018.1.91786 WP_003410018.1.91802 WP_003410018.1.91822 WP_003410018.1.91828 WP_003410018.1.9189 WP_003410018.1.91896 WP_003410018.1.91915 WP_003410018.1.91931 WP_003410018.1.91937 WP_003410018.1.91944 WP_003410018.1.91953 WP_003410018.1.91957 WP_003410018.1.91976 WP_003410018.1.91978 WP_003410018.1.92021 WP_003410018.1.92083 WP_003410018.1.92127 WP_003410018.1.92144 WP_003410018.1.92150 WP_003410018.1.92153 WP_003410018.1.92190 WP_003410018.1.92192 WP_003410018.1.92200 WP_003410018.1.92220 WP_003410018.1.92221 WP_003410018.1.92222 WP_003410018.1.92273 WP_003410018.1.92289 WP_003410018.1.9229 WP_003410018.1.92294 WP_003410018.1.92300 WP_003410018.1.92317 WP_003410018.1.92334 WP_003410018.1.92345 WP_003410018.1.92356 WP_003410018.1.92364 WP_003410018.1.92380 WP_003410018.1.92416 WP_003410018.1.92447 WP_003410018.1.92467 WP_003410018.1.92471 WP_003410018.1.92490 WP_003410018.1.92508 WP_003410018.1.9251 WP_003410018.1.92511 WP_003410018.1.92523 WP_003410018.1.92527 WP_003410018.1.92536 WP_003410018.1.92597 WP_003410018.1.92603 WP_003410018.1.92606 WP_003410018.1.92610 WP_003410018.1.92613 WP_003410018.1.9263 WP_003410018.1.9265 WP_003410018.1.92650 WP_003410018.1.92660 WP_003410018.1.92677 WP_003410018.1.92685 WP_003410018.1.92689 WP_003410018.1.92690 WP_003410018.1.92706 WP_003410018.1.92714 WP_003410018.1.92736 WP_003410018.1.9274 WP_003410018.1.92752 WP_003410018.1.92760 WP_003410018.1.92777 WP_003410018.1.92803 WP_003410018.1.92833 WP_003410018.1.92856 WP_003410018.1.92881 WP_003410018.1.92892 WP_003410018.1.92907 WP_003410018.1.92908 WP_003410018.1.92917 WP_003410018.1.92996 WP_003410018.1.93006 WP_003410018.1.93008 WP_003410018.1.93009 WP_003410018.1.93015 WP_003410018.1.93043 WP_003410018.1.93083 WP_003410018.1.93097 WP_003410018.1.93137 WP_003410018.1.93192 WP_003410018.1.93199 WP_003410018.1.93212 WP_003410018.1.93234 WP_003410018.1.93245 WP_003410018.1.93257 WP_003410018.1.93265 WP_003410018.1.93297 WP_003410018.1.93320 WP_003410018.1.93328 WP_003410018.1.93337 WP_003410018.1.93343 WP_003410018.1.93349 WP_003410018.1.93363 WP_003410018.1.93377 WP_003410018.1.9338 WP_003410018.1.93407 WP_003410018.1.93419 WP_003410018.1.93426 WP_003410018.1.9344 WP_003410018.1.93443 WP_003410018.1.93447 WP_003410018.1.93487 WP_003410018.1.93495 WP_003410018.1.93499 WP_003410018.1.93516 WP_003410018.1.93536 WP_003410018.1.93544 WP_003410018.1.93560 WP_003410018.1.93564 WP_003410018.1.9357 WP_003410018.1.93573 WP_003410018.1.93588 WP_003410018.1.9363 WP_003410018.1.93645 WP_003410018.1.93649 WP_003410018.1.93659 WP_003410018.1.93677 WP_003410018.1.9368 WP_003410018.1.93689 WP_003410018.1.93693 WP_003410018.1.93698 WP_003410018.1.93706 WP_003410018.1.9371 WP_003410018.1.93792 WP_003410018.1.93823 WP_003410018.1.93871 WP_003410018.1.9388 WP_003410018.1.93894 WP_003410018.1.93903 WP_003410018.1.93907 WP_003410018.1.93913 WP_003410018.1.93950 WP_003410018.1.93953 WP_003410018.1.93954 WP_003410018.1.93988 WP_003410018.1.9407 WP_003410018.1.94143 WP_003410018.1.94154 WP_003410018.1.94184 WP_003410018.1.94204 WP_003410018.1.94205 WP_003410018.1.94226 WP_003410018.1.94231 WP_003410018.1.94256 WP_003410018.1.94261 WP_003410018.1.94281 WP_003410018.1.94292 WP_003410018.1.94297 WP_003410018.1.9431 WP_003410018.1.94326 WP_003410018.1.94339 WP_003410018.1.94392 WP_003410018.1.94421 WP_003410018.1.94456 WP_003410018.1.94470 WP_003410018.1.94480 WP_003410018.1.94495 WP_003410018.1.94511 WP_003410018.1.94512 WP_003410018.1.94525 WP_003410018.1.94528 WP_003410018.1.94564 WP_003410018.1.946 WP_003410018.1.94602 WP_003410018.1.94623 WP_003410018.1.94629 WP_003410018.1.9465 WP_003410018.1.94673 WP_003410018.1.94714 WP_003410018.1.94730 WP_003410018.1.94736 WP_003410018.1.94776 WP_003410018.1.9478 WP_003410018.1.94834 WP_003410018.1.94852 WP_003410018.1.94872 WP_003410018.1.9488 WP_003410018.1.94902 WP_003410018.1.94979 WP_003410018.1.94994 WP_003410018.1.94996 WP_003410018.1.94998 WP_003410018.1.95007 WP_003410018.1.95010 WP_003410018.1.95015 WP_003410018.1.95034 WP_003410018.1.95068 WP_003410018.1.95081 WP_003410018.1.95082 WP_003410018.1.9509 WP_003410018.1.95096 WP_003410018.1.95112 WP_003410018.1.9514 WP_003410018.1.95179 WP_003410018.1.95188 WP_003410018.1.95190 WP_003410018.1.95234 WP_003410018.1.95241 WP_003410018.1.95257 WP_003410018.1.95279 WP_003410018.1.9531 WP_003410018.1.95344 WP_003410018.1.9535 WP_003410018.1.95370 WP_003410018.1.95392 WP_003410018.1.95416 WP_003410018.1.95417 WP_003410018.1.95454 WP_003410018.1.95455 WP_003410018.1.95491 WP_003410018.1.95497 WP_003410018.1.95508 WP_003410018.1.95509 WP_003410018.1.95529 WP_003410018.1.95556 WP_003410018.1.95557 WP_003410018.1.95565 WP_003410018.1.95580 WP_003410018.1.95585 WP_003410018.1.95643 WP_003410018.1.95679 WP_003410018.1.95685 WP_003410018.1.957 WP_003410018.1.95724 WP_003410018.1.95727 WP_003410018.1.95730 WP_003410018.1.95735 WP_003410018.1.95758 WP_003410018.1.95772 WP_003410018.1.95797 WP_003410018.1.95839 WP_003410018.1.9585 WP_003410018.1.9590 WP_003410018.1.95902 WP_003410018.1.95908 WP_003410018.1.95926 WP_003410018.1.95953 WP_003410018.1.95958 WP_003410018.1.95964 WP_003410018.1.95973 WP_003410018.1.96006 WP_003410018.1.9602 WP_003410018.1.96036 WP_003410018.1.96062 WP_003410018.1.96065 WP_003410018.1.96098 WP_003410018.1.96146 WP_003410018.1.96166 WP_003410018.1.96171 WP_003410018.1.96182 WP_003410018.1.96204 WP_003410018.1.96230 WP_003410018.1.96235 WP_003410018.1.96242 WP_003410018.1.96245 WP_003410018.1.96254 WP_003410018.1.96259 WP_003410018.1.96318 WP_003410018.1.96345 WP_003410018.1.96360 WP_003410018.1.96373 WP_003410018.1.96456 WP_003410018.1.96486 WP_003410018.1.96560 WP_003410018.1.96569 WP_003410018.1.96573 WP_003410018.1.96575 WP_003410018.1.96576 WP_003410018.1.96611 WP_003410018.1.96621 WP_003410018.1.9667 WP_003410018.1.96681 WP_003410018.1.96726 WP_003410018.1.96733 WP_003410018.1.96742 WP_003410018.1.96754 WP_003410018.1.9678 WP_003410018.1.9685 WP_003410018.1.97008 WP_003410018.1.97056 WP_003410018.1.97084 WP_003410018.1.97096 WP_003410018.1.97099 WP_003410018.1.97108 WP_003410018.1.97113 WP_003410018.1.97122 WP_003410018.1.97127 WP_003410018.1.97129 WP_003410018.1.97136 WP_003410018.1.9716 WP_003410018.1.97176 WP_003410018.1.97222 WP_003410018.1.97223 WP_003410018.1.97237 WP_003410018.1.97242 WP_003410018.1.97270 WP_003410018.1.97283 WP_003410018.1.97296 WP_003410018.1.97325 WP_003410018.1.97330 WP_003410018.1.97366 WP_003410018.1.97376 WP_003410018.1.97380 WP_003410018.1.9739 WP_003410018.1.97462 WP_003410018.1.97517 WP_003410018.1.97519 WP_003410018.1.97535 WP_003410018.1.97540 WP_003410018.1.97545 WP_003410018.1.97546 WP_003410018.1.97550 WP_003410018.1.97568 WP_003410018.1.97577 WP_003410018.1.97584 WP_003410018.1.9759 WP_003410018.1.97591 WP_003410018.1.97596 WP_003410018.1.97609 WP_003410018.1.97618 WP_003410018.1.9763 WP_003410018.1.97669 WP_003410018.1.97673 WP_003410018.1.97700 WP_003410018.1.97701 WP_003410018.1.9773 WP_003410018.1.97730 WP_003410018.1.97740 WP_003410018.1.97754 WP_003410018.1.97797 WP_003410018.1.9782 WP_003410018.1.9784 WP_003410018.1.97888 WP_003410018.1.9790 WP_003410018.1.9795 WP_003410018.1.97951 WP_003410018.1.97958 WP_003410018.1.97966 WP_003410018.1.97977 WP_003410018.1.97979 WP_003410018.1.97995 WP_003410018.1.98018 WP_003410018.1.98034 WP_003410018.1.98052 WP_003410018.1.98071 WP_003410018.1.98072 WP_003410018.1.98113 WP_003410018.1.98128 WP_003410018.1.98181 WP_003410018.1.98188 WP_003410018.1.98213 WP_003410018.1.98225 WP_003410018.1.98291 WP_003410018.1.98335 WP_003410018.1.98350 WP_003410018.1.98395 WP_003410018.1.98441 WP_003410018.1.98443 WP_003410018.1.98462 WP_003410018.1.9848 WP_003410018.1.98482 WP_003410018.1.98486 WP_003410018.1.98488 WP_003410018.1.98503 WP_003410018.1.98516 WP_003410018.1.98524 WP_003410018.1.98536 WP_003410018.1.98541 WP_003410018.1.98566 WP_003410018.1.98576 WP_003410018.1.98590 WP_003410018.1.98599 WP_003410018.1.98629 WP_003410018.1.98645 WP_003410018.1.98646 WP_003410018.1.98649 WP_003410018.1.98656 WP_003410018.1.9867 WP_003410018.1.98674 WP_003410018.1.98697 WP_003410018.1.98701 WP_003410018.1.98739 WP_003410018.1.98749 WP_003410018.1.98770 WP_003410018.1.98777 WP_003410018.1.98778 WP_003410018.1.98802 WP_003410018.1.98850 WP_003410018.1.98906 WP_003410018.1.98935 WP_003410018.1.98948 WP_003410018.1.98953 WP_003410018.1.98984 WP_003410018.1.99000 WP_003410018.1.99023 WP_003410018.1.99030 WP_003410018.1.99037 WP_003410018.1.99055 WP_003410018.1.99062 WP_003410018.1.99086 WP_003410018.1.99115 WP_003410018.1.99117 WP_003410018.1.99161 WP_003410018.1.99176 WP_003410018.1.99205 WP_003410018.1.99211 WP_003410018.1.99216 WP_003410018.1.99222 WP_003410018.1.99251 WP_003410018.1.99269 WP_003410018.1.99294 WP_003410018.1.99312 WP_003410018.1.99315 WP_003410018.1.99316 WP_003410018.1.99322 WP_003410018.1.99328 WP_003410018.1.99365 WP_003410018.1.99368 WP_003410018.1.99379 WP_003410018.1.99396 WP_003410018.1.99402 WP_003410018.1.99404 WP_003410018.1.99419 WP_003410018.1.99438 WP_003410018.1.99460 WP_003410018.1.99468 WP_003410018.1.99473 WP_003410018.1.99513 WP_003410018.1.99529 WP_003410018.1.99548 WP_003410018.1.99572 WP_003410018.1.99575 WP_003410018.1.99578 WP_003410018.1.99605 WP_003410018.1.99609 WP_003410018.1.99617 WP_003410018.1.99635 WP_003410018.1.99650 WP_003410018.1.99672 WP_003410018.1.99701 WP_003410018.1.99711 WP_003410018.1.99716 WP_003410018.1.99740 WP_003410018.1.99745 WP_003410018.1.99749 WP_003410018.1.9976 WP_003410018.1.99798 WP_003410018.1.99817 WP_003410018.1.99832 WP_003410018.1.99847 WP_003410018.1.99852 WP_003410018.1.99886 WP_003410018.1.99897 WP_003410018.1.99899 WP_003410018.1.99915 WP_003410018.1.9993 WP_003410018.1.99982 WP_003410018.1.99991 gi|148661808|ref|YP_001283331.1| gi|148823209|ref|YP_001287963.1| gi|15841476|ref|NP_336513.1| 233413.Mb2017c 336982.TBFG_12026 410289.BCG_2011c 419947.MRA_2010 478434.TBMG_01992 561275.JTY_2006 83331.MT2050 83332.Rv1994c gi|253798954|ref|YP_003031955.1| gi|449064042|ref|YP_007431125.1| gi|121637878|ref|YP_978101.1| gi|378771721|ref|YP_005171454.1| gi|479055956|ref|YP_007351762.1| gi|15609131|ref|NP_216510.1| gi|383307810|ref|YP_005360621.1| gi|506926489|ref|YP_008006939.1| 2jsc_A 2jsc_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]