SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740646|ref|YP_002161960.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740646|ref|YP_002161960.1|
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.36e-17
Family MarR-like transcriptional regulators 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197740646|ref|YP_002161960.1|
Sequence length 143
Comment hypothetical protein TBHG_01968 [Mycobacterium tuberculosis str. Haarlem]
Sequence
MSDEIARLVADVFELAGLLRRSGEVVAAREGHTQARWQLLSVVSDRALTVPQAARRLGVT
RQGVQRVANDLVVCGLAELRHNPDHRTSPLLVLTENGRRVLQAITERAIVVNNRLADAVD
PAALQATRDSLRRMIVALKAERP
Download sequence
Identical sequences A0A045IUL2 A0A0H3LEH5 A0A0H3MEF4 A0A0K2HWV0 A0A197J295 A0A1A9E810 A0A1S1B8Z1 A5U436 F8LZQ0 G0TM02 I6X2Y5 M8CMC8 P64928 P9WLM4 P9WLM5 R4MHR4
gi|479055973|ref|YP_007351779.1| gi|339632048|ref|YP_004723690.1| gi|383307825|ref|YP_005360636.1| gi|378771738|ref|YP_005171471.1| gi|525674656|ref|YP_008226113.1| gi|385991366|ref|YP_005909664.1| gi|392432401|ref|YP_006473445.1| gi|506926507|ref|YP_008006957.1| gi|197740646|ref|YP_002161960.1| gi|148661825|ref|YP_001283348.1| gi|506926507|ref|YP_008006957.1| gi|494700439|ref|YP_007965921.1| gi|253798937|ref|YP_003031938.1| gi|494696399|ref|YP_007961902.1| 233413.Mb2034c 336982.TBFG_12043 410289.BCG_2028c 419947.MRA_2027 478434.TBMG_01975 561275.JTY_2023 83331.MT2066 83332.Rv2011c gi|392386661|ref|YP_005308290.1| gi|15609148|ref|NP_216527.1| gi|340627020|ref|YP_004745472.1| gi|15841493|ref|NP_336530.1| gi|479314934|ref|YP_007854986.1| gi|148823226|ref|YP_001287980.1| gi|471337973|ref|YP_007610686.1| gi|433627115|ref|YP_007260744.1| gi|385998788|ref|YP_005917086.1| gi|375296187|ref|YP_005100454.1| Rv2011c gi|31793191|ref|NP_855684.1| gi|433642165|ref|YP_007287924.1| gi|433635055|ref|YP_007268682.1| gi|15609148|ref|NP_216527.1| gi|121637895|ref|YP_978118.1| gi|224990389|ref|YP_002645076.1| gi|449064059|ref|YP_007431142.1| NP_216527.1.84033 WP_003410078.1.100000 WP_003410078.1.100021 WP_003410078.1.100069 WP_003410078.1.100087 WP_003410078.1.10015 WP_003410078.1.100208 WP_003410078.1.100216 WP_003410078.1.10022 WP_003410078.1.100255 WP_003410078.1.100260 WP_003410078.1.100270 WP_003410078.1.100279 WP_003410078.1.100286 WP_003410078.1.100308 WP_003410078.1.100309 WP_003410078.1.100318 WP_003410078.1.100337 WP_003410078.1.100338 WP_003410078.1.10037 WP_003410078.1.100383 WP_003410078.1.100396 WP_003410078.1.1004 WP_003410078.1.100401 WP_003410078.1.100459 WP_003410078.1.100460 WP_003410078.1.100552 WP_003410078.1.100581 WP_003410078.1.100600 WP_003410078.1.100625 WP_003410078.1.10064 WP_003410078.1.100666 WP_003410078.1.100671 WP_003410078.1.100677 WP_003410078.1.100682 WP_003410078.1.100697 WP_003410078.1.100703 WP_003410078.1.100716 WP_003410078.1.100722 WP_003410078.1.100754 WP_003410078.1.100757 WP_003410078.1.100772 WP_003410078.1.1008 WP_003410078.1.100812 WP_003410078.1.100845 WP_003410078.1.100866 WP_003410078.1.10088 WP_003410078.1.100889 WP_003410078.1.10090 WP_003410078.1.100910 WP_003410078.1.100915 WP_003410078.1.100918 WP_003410078.1.100935 WP_003410078.1.100984 WP_003410078.1.100992 WP_003410078.1.100998 WP_003410078.1.101 WP_003410078.1.101025 WP_003410078.1.101028 WP_003410078.1.10104 WP_003410078.1.101048 WP_003410078.1.101054 WP_003410078.1.101075 WP_003410078.1.101143 WP_003410078.1.10116 WP_003410078.1.10117 WP_003410078.1.101209 WP_003410078.1.10125 WP_003410078.1.101290 WP_003410078.1.101323 WP_003410078.1.101324 WP_003410078.1.101350 WP_003410078.1.101367 WP_003410078.1.101398 WP_003410078.1.101403 WP_003410078.1.101421 WP_003410078.1.10144 WP_003410078.1.101442 WP_003410078.1.10145 WP_003410078.1.101452 WP_003410078.1.101456 WP_003410078.1.101481 WP_003410078.1.101493 WP_003410078.1.101496 WP_003410078.1.101525 WP_003410078.1.101533 WP_003410078.1.101535 WP_003410078.1.101553 WP_003410078.1.101558 WP_003410078.1.10156 WP_003410078.1.101573 WP_003410078.1.101576 WP_003410078.1.10159 WP_003410078.1.101592 WP_003410078.1.101604 WP_003410078.1.101607 WP_003410078.1.101622 WP_003410078.1.101644 WP_003410078.1.101659 WP_003410078.1.101671 WP_003410078.1.101687 WP_003410078.1.101698 WP_003410078.1.10170 WP_003410078.1.101722 WP_003410078.1.101733 WP_003410078.1.101743 WP_003410078.1.101753 WP_003410078.1.101754 WP_003410078.1.101764 WP_003410078.1.101773 WP_003410078.1.101795 WP_003410078.1.101797 WP_003410078.1.101798 WP_003410078.1.101802 WP_003410078.1.101826 WP_003410078.1.101836 WP_003410078.1.101858 WP_003410078.1.101859 WP_003410078.1.101862 WP_003410078.1.101888 WP_003410078.1.101894 WP_003410078.1.101899 WP_003410078.1.1019 WP_003410078.1.101925 WP_003410078.1.10193 WP_003410078.1.101996 WP_003410078.1.102 WP_003410078.1.102008 WP_003410078.1.102017 WP_003410078.1.102053 WP_003410078.1.102055 WP_003410078.1.102063 WP_003410078.1.102099 WP_003410078.1.1021 WP_003410078.1.10211 WP_003410078.1.102119 WP_003410078.1.102121 WP_003410078.1.102143 WP_003410078.1.10216 WP_003410078.1.10224 WP_003410078.1.10253 WP_003410078.1.10262 WP_003410078.1.10272 WP_003410078.1.10277 WP_003410078.1.1033 WP_003410078.1.10350 WP_003410078.1.10362 WP_003410078.1.10366 WP_003410078.1.10376 WP_003410078.1.10396 WP_003410078.1.10410 WP_003410078.1.10414 WP_003410078.1.10421 WP_003410078.1.10430 WP_003410078.1.1044 WP_003410078.1.10440 WP_003410078.1.10445 WP_003410078.1.10471 WP_003410078.1.10472 WP_003410078.1.10489 WP_003410078.1.105 WP_003410078.1.10523 WP_003410078.1.10545 WP_003410078.1.1057 WP_003410078.1.10594 WP_003410078.1.10603 WP_003410078.1.10606 WP_003410078.1.10615 WP_003410078.1.10623 WP_003410078.1.10635 WP_003410078.1.10643 WP_003410078.1.10648 WP_003410078.1.10662 WP_003410078.1.10709 WP_003410078.1.10735 WP_003410078.1.10740 WP_003410078.1.10756 WP_003410078.1.1078 WP_003410078.1.10791 WP_003410078.1.10799 WP_003410078.1.10825 WP_003410078.1.10848 WP_003410078.1.10863 WP_003410078.1.10879 WP_003410078.1.10912 WP_003410078.1.10916 WP_003410078.1.10923 WP_003410078.1.10927 WP_003410078.1.1095 WP_003410078.1.10956 WP_003410078.1.10958 WP_003410078.1.10962 WP_003410078.1.10980 WP_003410078.1.10981 WP_003410078.1.10993 WP_003410078.1.1100 WP_003410078.1.11040 WP_003410078.1.11061 WP_003410078.1.11070 WP_003410078.1.11141 WP_003410078.1.11171 WP_003410078.1.11175 WP_003410078.1.11176 WP_003410078.1.11222 WP_003410078.1.11236 WP_003410078.1.11329 WP_003410078.1.1133 WP_003410078.1.11342 WP_003410078.1.11373 WP_003410078.1.11376 WP_003410078.1.11390 WP_003410078.1.11402 WP_003410078.1.11481 WP_003410078.1.11487 WP_003410078.1.11489 WP_003410078.1.11491 WP_003410078.1.11514 WP_003410078.1.11587 WP_003410078.1.11589 WP_003410078.1.11596 WP_003410078.1.11604 WP_003410078.1.11610 WP_003410078.1.11697 WP_003410078.1.11707 WP_003410078.1.11752 WP_003410078.1.11758 WP_003410078.1.11761 WP_003410078.1.11775 WP_003410078.1.11804 WP_003410078.1.11822 WP_003410078.1.11826 WP_003410078.1.11856 WP_003410078.1.11898 WP_003410078.1.11906 WP_003410078.1.11939 WP_003410078.1.11960 WP_003410078.1.11961 WP_003410078.1.11972 WP_003410078.1.11984 WP_003410078.1.120 WP_003410078.1.12001 WP_003410078.1.12049 WP_003410078.1.12052 WP_003410078.1.12100 WP_003410078.1.12116 WP_003410078.1.12130 WP_003410078.1.12133 WP_003410078.1.12161 WP_003410078.1.12165 WP_003410078.1.12184 WP_003410078.1.12187 WP_003410078.1.12190 WP_003410078.1.12216 WP_003410078.1.12265 WP_003410078.1.12275 WP_003410078.1.12293 WP_003410078.1.12294 WP_003410078.1.123 WP_003410078.1.1231 WP_003410078.1.12314 WP_003410078.1.12327 WP_003410078.1.12338 WP_003410078.1.1236 WP_003410078.1.12371 WP_003410078.1.12372 WP_003410078.1.12389 WP_003410078.1.12406 WP_003410078.1.1241 WP_003410078.1.12421 WP_003410078.1.12424 WP_003410078.1.12446 WP_003410078.1.12464 WP_003410078.1.12479 WP_003410078.1.12519 WP_003410078.1.12523 WP_003410078.1.12526 WP_003410078.1.1255 WP_003410078.1.12550 WP_003410078.1.12551 WP_003410078.1.12563 WP_003410078.1.12611 WP_003410078.1.12669 WP_003410078.1.1267 WP_003410078.1.12672 WP_003410078.1.12692 WP_003410078.1.1271 WP_003410078.1.12710 WP_003410078.1.12768 WP_003410078.1.1279 WP_003410078.1.12794 WP_003410078.1.12801 WP_003410078.1.12804 WP_003410078.1.12821 WP_003410078.1.12841 WP_003410078.1.12854 WP_003410078.1.12871 WP_003410078.1.12901 WP_003410078.1.12941 WP_003410078.1.12947 WP_003410078.1.12957 WP_003410078.1.12972 WP_003410078.1.13028 WP_003410078.1.13043 WP_003410078.1.13086 WP_003410078.1.13087 WP_003410078.1.13090 WP_003410078.1.13096 WP_003410078.1.13163 WP_003410078.1.13175 WP_003410078.1.13183 WP_003410078.1.132 WP_003410078.1.13249 WP_003410078.1.13282 WP_003410078.1.13284 WP_003410078.1.13296 WP_003410078.1.13298 WP_003410078.1.13302 WP_003410078.1.13306 WP_003410078.1.13312 WP_003410078.1.13313 WP_003410078.1.13321 WP_003410078.1.13345 WP_003410078.1.13358 WP_003410078.1.13370 WP_003410078.1.13375 WP_003410078.1.1338 WP_003410078.1.13420 WP_003410078.1.13433 WP_003410078.1.13435 WP_003410078.1.13438 WP_003410078.1.13461 WP_003410078.1.13466 WP_003410078.1.13489 WP_003410078.1.13526 WP_003410078.1.13551 WP_003410078.1.13561 WP_003410078.1.13564 WP_003410078.1.13579 WP_003410078.1.13647 WP_003410078.1.13667 WP_003410078.1.13687 WP_003410078.1.13697 WP_003410078.1.13719 WP_003410078.1.13763 WP_003410078.1.1377 WP_003410078.1.13774 WP_003410078.1.13786 WP_003410078.1.13793 WP_003410078.1.13794 WP_003410078.1.13817 WP_003410078.1.13834 WP_003410078.1.13866 WP_003410078.1.13880 WP_003410078.1.13899 WP_003410078.1.13909 WP_003410078.1.13910 WP_003410078.1.13919 WP_003410078.1.13920 WP_003410078.1.13952 WP_003410078.1.13953 WP_003410078.1.13962 WP_003410078.1.1398 WP_003410078.1.13988 WP_003410078.1.14027 WP_003410078.1.14046 WP_003410078.1.14115 WP_003410078.1.1415 WP_003410078.1.14152 WP_003410078.1.14158 WP_003410078.1.14162 WP_003410078.1.14175 WP_003410078.1.14178 WP_003410078.1.14194 WP_003410078.1.14195 WP_003410078.1.14208 WP_003410078.1.14238 WP_003410078.1.14266 WP_003410078.1.14273 WP_003410078.1.14303 WP_003410078.1.14306 WP_003410078.1.14307 WP_003410078.1.14310 WP_003410078.1.14341 WP_003410078.1.14382 WP_003410078.1.14416 WP_003410078.1.14428 WP_003410078.1.14441 WP_003410078.1.14469 WP_003410078.1.14477 WP_003410078.1.14504 WP_003410078.1.14514 WP_003410078.1.1452 WP_003410078.1.14527 WP_003410078.1.1454 WP_003410078.1.14544 WP_003410078.1.14548 WP_003410078.1.14551 WP_003410078.1.14561 WP_003410078.1.14573 WP_003410078.1.1462 WP_003410078.1.14658 WP_003410078.1.14667 WP_003410078.1.14668 WP_003410078.1.14675 WP_003410078.1.14694 WP_003410078.1.14695 WP_003410078.1.14709 WP_003410078.1.14766 WP_003410078.1.14783 WP_003410078.1.14865 WP_003410078.1.14872 WP_003410078.1.14905 WP_003410078.1.14926 WP_003410078.1.14951 WP_003410078.1.14955 WP_003410078.1.15003 WP_003410078.1.15009 WP_003410078.1.15028 WP_003410078.1.15040 WP_003410078.1.15052 WP_003410078.1.15072 WP_003410078.1.15089 WP_003410078.1.1509 WP_003410078.1.15126 WP_003410078.1.15131 WP_003410078.1.15168 WP_003410078.1.15172 WP_003410078.1.15174 WP_003410078.1.15187 WP_003410078.1.15196 WP_003410078.1.15210 WP_003410078.1.15216 WP_003410078.1.15217 WP_003410078.1.1523 WP_003410078.1.15232 WP_003410078.1.15238 WP_003410078.1.15240 WP_003410078.1.15253 WP_003410078.1.15267 WP_003410078.1.1527 WP_003410078.1.15292 WP_003410078.1.15299 WP_003410078.1.15302 WP_003410078.1.15322 WP_003410078.1.1534 WP_003410078.1.15345 WP_003410078.1.15365 WP_003410078.1.15372 WP_003410078.1.15386 WP_003410078.1.15387 WP_003410078.1.15442 WP_003410078.1.15447 WP_003410078.1.15449 WP_003410078.1.15477 WP_003410078.1.15481 WP_003410078.1.15492 WP_003410078.1.15511 WP_003410078.1.15512 WP_003410078.1.15558 WP_003410078.1.15559 WP_003410078.1.15566 WP_003410078.1.15599 WP_003410078.1.1560 WP_003410078.1.15611 WP_003410078.1.1563 WP_003410078.1.15633 WP_003410078.1.15643 WP_003410078.1.15688 WP_003410078.1.15755 WP_003410078.1.15763 WP_003410078.1.15774 WP_003410078.1.1578 WP_003410078.1.15780 WP_003410078.1.15827 WP_003410078.1.15834 WP_003410078.1.15842 WP_003410078.1.15848 WP_003410078.1.15853 WP_003410078.1.15870 WP_003410078.1.15877 WP_003410078.1.15893 WP_003410078.1.15896 WP_003410078.1.15926 WP_003410078.1.15933 WP_003410078.1.15946 WP_003410078.1.15958 WP_003410078.1.15973 WP_003410078.1.15987 WP_003410078.1.15993 WP_003410078.1.16009 WP_003410078.1.16025 WP_003410078.1.16043 WP_003410078.1.16055 WP_003410078.1.16066 WP_003410078.1.16069 WP_003410078.1.16077 WP_003410078.1.16106 WP_003410078.1.16108 WP_003410078.1.16110 WP_003410078.1.16130 WP_003410078.1.16136 WP_003410078.1.16139 WP_003410078.1.16141 WP_003410078.1.16143 WP_003410078.1.1630 WP_003410078.1.16318 WP_003410078.1.1632 WP_003410078.1.16327 WP_003410078.1.16334 WP_003410078.1.16341 WP_003410078.1.16374 WP_003410078.1.16384 WP_003410078.1.16386 WP_003410078.1.164 WP_003410078.1.1642 WP_003410078.1.16421 WP_003410078.1.16424 WP_003410078.1.16426 WP_003410078.1.16431 WP_003410078.1.1644 WP_003410078.1.16442 WP_003410078.1.16448 WP_003410078.1.16451 WP_003410078.1.16476 WP_003410078.1.16494 WP_003410078.1.1652 WP_003410078.1.16549 WP_003410078.1.16560 WP_003410078.1.16598 WP_003410078.1.16609 WP_003410078.1.16619 WP_003410078.1.16620 WP_003410078.1.16622 WP_003410078.1.16637 WP_003410078.1.1669 WP_003410078.1.16707 WP_003410078.1.16724 WP_003410078.1.16731 WP_003410078.1.16743 WP_003410078.1.1683 WP_003410078.1.16837 WP_003410078.1.16852 WP_003410078.1.16937 WP_003410078.1.16940 WP_003410078.1.16950 WP_003410078.1.16959 WP_003410078.1.16968 WP_003410078.1.1697 WP_003410078.1.16973 WP_003410078.1.16977 WP_003410078.1.16987 WP_003410078.1.17005 WP_003410078.1.17006 WP_003410078.1.17010 WP_003410078.1.17015 WP_003410078.1.17019 WP_003410078.1.17039 WP_003410078.1.17041 WP_003410078.1.17052 WP_003410078.1.17057 WP_003410078.1.17062 WP_003410078.1.1707 WP_003410078.1.17094 WP_003410078.1.17130 WP_003410078.1.17138 WP_003410078.1.17147 WP_003410078.1.17167 WP_003410078.1.17224 WP_003410078.1.17251 WP_003410078.1.17288 WP_003410078.1.17304 WP_003410078.1.17314 WP_003410078.1.17345 WP_003410078.1.17381 WP_003410078.1.17391 WP_003410078.1.17412 WP_003410078.1.1743 WP_003410078.1.17440 WP_003410078.1.17466 WP_003410078.1.17477 WP_003410078.1.17483 WP_003410078.1.17505 WP_003410078.1.17527 WP_003410078.1.17535 WP_003410078.1.17540 WP_003410078.1.17553 WP_003410078.1.17558 WP_003410078.1.17599 WP_003410078.1.17635 WP_003410078.1.17655 WP_003410078.1.17679 WP_003410078.1.1768 WP_003410078.1.17687 WP_003410078.1.17700 WP_003410078.1.17710 WP_003410078.1.17713 WP_003410078.1.17722 WP_003410078.1.17746 WP_003410078.1.17788 WP_003410078.1.17798 WP_003410078.1.17803 WP_003410078.1.17816 WP_003410078.1.17821 WP_003410078.1.17830 WP_003410078.1.17868 WP_003410078.1.17878 WP_003410078.1.1792 WP_003410078.1.17923 WP_003410078.1.1795 WP_003410078.1.17955 WP_003410078.1.17973 WP_003410078.1.18009 WP_003410078.1.18013 WP_003410078.1.18033 WP_003410078.1.18057 WP_003410078.1.18065 WP_003410078.1.18070 WP_003410078.1.18116 WP_003410078.1.18120 WP_003410078.1.18126 WP_003410078.1.1817 WP_003410078.1.18170 WP_003410078.1.18216 WP_003410078.1.18240 WP_003410078.1.18257 WP_003410078.1.18297 WP_003410078.1.18306 WP_003410078.1.18364 WP_003410078.1.18399 WP_003410078.1.18411 WP_003410078.1.18444 WP_003410078.1.18448 WP_003410078.1.18467 WP_003410078.1.18476 WP_003410078.1.18522 WP_003410078.1.18580 WP_003410078.1.18582 WP_003410078.1.18587 WP_003410078.1.186 WP_003410078.1.18601 WP_003410078.1.18639 WP_003410078.1.18646 WP_003410078.1.18647 WP_003410078.1.1868 WP_003410078.1.18694 WP_003410078.1.18710 WP_003410078.1.18751 WP_003410078.1.18781 WP_003410078.1.18793 WP_003410078.1.18804 WP_003410078.1.18816 WP_003410078.1.18823 WP_003410078.1.18838 WP_003410078.1.18849 WP_003410078.1.18856 WP_003410078.1.18945 WP_003410078.1.1898 WP_003410078.1.19005 WP_003410078.1.19056 WP_003410078.1.19063 WP_003410078.1.19066 WP_003410078.1.19071 WP_003410078.1.19085 WP_003410078.1.19094 WP_003410078.1.19144 WP_003410078.1.19159 WP_003410078.1.19193 WP_003410078.1.19231 WP_003410078.1.19243 WP_003410078.1.19264 WP_003410078.1.19295 WP_003410078.1.19307 WP_003410078.1.19326 WP_003410078.1.1933 WP_003410078.1.19364 WP_003410078.1.19382 WP_003410078.1.19400 WP_003410078.1.19426 WP_003410078.1.19429 WP_003410078.1.19464 WP_003410078.1.19480 WP_003410078.1.19512 WP_003410078.1.19553 WP_003410078.1.19564 WP_003410078.1.19568 WP_003410078.1.19572 WP_003410078.1.19595 WP_003410078.1.19596 WP_003410078.1.19600 WP_003410078.1.19630 WP_003410078.1.1967 WP_003410078.1.19694 WP_003410078.1.1970 WP_003410078.1.19707 WP_003410078.1.19742 WP_003410078.1.19785 WP_003410078.1.19820 WP_003410078.1.19868 WP_003410078.1.19874 WP_003410078.1.19890 WP_003410078.1.19900 WP_003410078.1.19922 WP_003410078.1.19936 WP_003410078.1.19946 WP_003410078.1.19949 WP_003410078.1.19964 WP_003410078.1.20007 WP_003410078.1.20028 WP_003410078.1.2003 WP_003410078.1.20037 WP_003410078.1.20039 WP_003410078.1.20082 WP_003410078.1.20085 WP_003410078.1.20097 WP_003410078.1.20116 WP_003410078.1.20130 WP_003410078.1.20140 WP_003410078.1.20141 WP_003410078.1.20142 WP_003410078.1.20158 WP_003410078.1.20239 WP_003410078.1.20243 WP_003410078.1.20259 WP_003410078.1.20262 WP_003410078.1.20268 WP_003410078.1.20272 WP_003410078.1.20273 WP_003410078.1.20280 WP_003410078.1.20294 WP_003410078.1.20300 WP_003410078.1.20309 WP_003410078.1.20322 WP_003410078.1.2037 WP_003410078.1.20372 WP_003410078.1.20381 WP_003410078.1.204 WP_003410078.1.20427 WP_003410078.1.20432 WP_003410078.1.20457 WP_003410078.1.20459 WP_003410078.1.20460 WP_003410078.1.20542 WP_003410078.1.20578 WP_003410078.1.20608 WP_003410078.1.20624 WP_003410078.1.20628 WP_003410078.1.2066 WP_003410078.1.20707 WP_003410078.1.20722 WP_003410078.1.20729 WP_003410078.1.20742 WP_003410078.1.20751 WP_003410078.1.20776 WP_003410078.1.20843 WP_003410078.1.20850 WP_003410078.1.2086 WP_003410078.1.20868 WP_003410078.1.20876 WP_003410078.1.20897 WP_003410078.1.20898 WP_003410078.1.2090 WP_003410078.1.20911 WP_003410078.1.20916 WP_003410078.1.20921 WP_003410078.1.20926 WP_003410078.1.20927 WP_003410078.1.20951 WP_003410078.1.20970 WP_003410078.1.2104 WP_003410078.1.21070 WP_003410078.1.21127 WP_003410078.1.21135 WP_003410078.1.21173 WP_003410078.1.21187 WP_003410078.1.212 WP_003410078.1.2120 WP_003410078.1.21218 WP_003410078.1.21219 WP_003410078.1.2123 WP_003410078.1.21231 WP_003410078.1.21234 WP_003410078.1.2126 WP_003410078.1.21307 WP_003410078.1.2131 WP_003410078.1.21311 WP_003410078.1.21321 WP_003410078.1.21365 WP_003410078.1.2137 WP_003410078.1.21392 WP_003410078.1.21397 WP_003410078.1.21403 WP_003410078.1.21415 WP_003410078.1.21418 WP_003410078.1.21430 WP_003410078.1.21434 WP_003410078.1.21444 WP_003410078.1.21468 WP_003410078.1.21498 WP_003410078.1.21509 WP_003410078.1.21513 WP_003410078.1.21560 WP_003410078.1.21565 WP_003410078.1.21586 WP_003410078.1.21591 WP_003410078.1.21594 WP_003410078.1.21602 WP_003410078.1.21615 WP_003410078.1.21638 WP_003410078.1.21639 WP_003410078.1.21655 WP_003410078.1.21658 WP_003410078.1.2168 WP_003410078.1.2174 WP_003410078.1.21741 WP_003410078.1.21742 WP_003410078.1.21777 WP_003410078.1.21786 WP_003410078.1.21795 WP_003410078.1.218 WP_003410078.1.21826 WP_003410078.1.21829 WP_003410078.1.21840 WP_003410078.1.21843 WP_003410078.1.21872 WP_003410078.1.21873 WP_003410078.1.2188 WP_003410078.1.21882 WP_003410078.1.21906 WP_003410078.1.21912 WP_003410078.1.2194 WP_003410078.1.21941 WP_003410078.1.21956 WP_003410078.1.21958 WP_003410078.1.21960 WP_003410078.1.21971 WP_003410078.1.21973 WP_003410078.1.21983 WP_003410078.1.22003 WP_003410078.1.22013 WP_003410078.1.22025 WP_003410078.1.22036 WP_003410078.1.22075 WP_003410078.1.22092 WP_003410078.1.2212 WP_003410078.1.22127 WP_003410078.1.22140 WP_003410078.1.22233 WP_003410078.1.22255 WP_003410078.1.22277 WP_003410078.1.22305 WP_003410078.1.22348 WP_003410078.1.22356 WP_003410078.1.22366 WP_003410078.1.2238 WP_003410078.1.22380 WP_003410078.1.22437 WP_003410078.1.22438 WP_003410078.1.22445 WP_003410078.1.22490 WP_003410078.1.22511 WP_003410078.1.22524 WP_003410078.1.2253 WP_003410078.1.22585 WP_003410078.1.22589 WP_003410078.1.22606 WP_003410078.1.22608 WP_003410078.1.22609 WP_003410078.1.22618 WP_003410078.1.2262 WP_003410078.1.22624 WP_003410078.1.22629 WP_003410078.1.22647 WP_003410078.1.22664 WP_003410078.1.22665 WP_003410078.1.22670 WP_003410078.1.22674 WP_003410078.1.22680 WP_003410078.1.22725 WP_003410078.1.22728 WP_003410078.1.22733 WP_003410078.1.22737 WP_003410078.1.2275 WP_003410078.1.22754 WP_003410078.1.22797 WP_003410078.1.22800 WP_003410078.1.22804 WP_003410078.1.22829 WP_003410078.1.22840 WP_003410078.1.22844 WP_003410078.1.22963 WP_003410078.1.22970 WP_003410078.1.22996 WP_003410078.1.22997 WP_003410078.1.22999 WP_003410078.1.23015 WP_003410078.1.23032 WP_003410078.1.231 WP_003410078.1.23101 WP_003410078.1.2312 WP_003410078.1.23140 WP_003410078.1.23153 WP_003410078.1.23171 WP_003410078.1.23199 WP_003410078.1.2320 WP_003410078.1.23204 WP_003410078.1.23216 WP_003410078.1.23229 WP_003410078.1.23233 WP_003410078.1.2326 WP_003410078.1.23272 WP_003410078.1.23289 WP_003410078.1.2329 WP_003410078.1.23308 WP_003410078.1.23316 WP_003410078.1.23321 WP_003410078.1.23325 WP_003410078.1.2339 WP_003410078.1.23406 WP_003410078.1.23438 WP_003410078.1.23445 WP_003410078.1.23447 WP_003410078.1.23452 WP_003410078.1.23461 WP_003410078.1.2349 WP_003410078.1.23496 WP_003410078.1.23497 WP_003410078.1.23506 WP_003410078.1.23530 WP_003410078.1.23539 WP_003410078.1.23546 WP_003410078.1.23551 WP_003410078.1.23573 WP_003410078.1.23583 WP_003410078.1.23588 WP_003410078.1.23628 WP_003410078.1.23677 WP_003410078.1.23683 WP_003410078.1.23692 WP_003410078.1.23694 WP_003410078.1.23699 WP_003410078.1.2371 WP_003410078.1.23803 WP_003410078.1.23807 WP_003410078.1.23825 WP_003410078.1.23832 WP_003410078.1.2384 WP_003410078.1.23843 WP_003410078.1.23863 WP_003410078.1.2387 WP_003410078.1.23894 WP_003410078.1.23993 WP_003410078.1.2400 WP_003410078.1.24007 WP_003410078.1.24008 WP_003410078.1.24046 WP_003410078.1.24057 WP_003410078.1.24113 WP_003410078.1.24119 WP_003410078.1.24128 WP_003410078.1.24140 WP_003410078.1.24176 WP_003410078.1.24190 WP_003410078.1.24202 WP_003410078.1.24244 WP_003410078.1.24261 WP_003410078.1.24284 WP_003410078.1.24294 WP_003410078.1.24357 WP_003410078.1.24396 WP_003410078.1.24414 WP_003410078.1.24423 WP_003410078.1.2443 WP_003410078.1.24446 WP_003410078.1.24461 WP_003410078.1.24500 WP_003410078.1.24507 WP_003410078.1.24509 WP_003410078.1.24529 WP_003410078.1.24553 WP_003410078.1.24599 WP_003410078.1.24629 WP_003410078.1.24638 WP_003410078.1.24648 WP_003410078.1.2466 WP_003410078.1.24767 WP_003410078.1.24824 WP_003410078.1.24831 WP_003410078.1.24840 WP_003410078.1.24848 WP_003410078.1.24857 WP_003410078.1.2487 WP_003410078.1.24893 WP_003410078.1.24907 WP_003410078.1.24933 WP_003410078.1.24956 WP_003410078.1.24958 WP_003410078.1.24985 WP_003410078.1.2499 WP_003410078.1.25004 WP_003410078.1.2505 WP_003410078.1.25051 WP_003410078.1.2507 WP_003410078.1.25096 WP_003410078.1.25103 WP_003410078.1.25129 WP_003410078.1.25171 WP_003410078.1.25184 WP_003410078.1.25247 WP_003410078.1.25252 WP_003410078.1.25278 WP_003410078.1.25283 WP_003410078.1.25309 WP_003410078.1.25313 WP_003410078.1.25342 WP_003410078.1.25343 WP_003410078.1.25367 WP_003410078.1.25393 WP_003410078.1.25406 WP_003410078.1.25435 WP_003410078.1.25437 WP_003410078.1.25445 WP_003410078.1.25455 WP_003410078.1.25473 WP_003410078.1.25504 WP_003410078.1.25513 WP_003410078.1.25542 WP_003410078.1.25579 WP_003410078.1.25594 WP_003410078.1.25606 WP_003410078.1.25645 WP_003410078.1.2566 WP_003410078.1.25673 WP_003410078.1.25674 WP_003410078.1.25693 WP_003410078.1.25699 WP_003410078.1.25727 WP_003410078.1.25736 WP_003410078.1.25738 WP_003410078.1.25756 WP_003410078.1.25759 WP_003410078.1.2580 WP_003410078.1.25813 WP_003410078.1.25853 WP_003410078.1.25854 WP_003410078.1.25874 WP_003410078.1.25885 WP_003410078.1.25892 WP_003410078.1.25906 WP_003410078.1.25914 WP_003410078.1.25916 WP_003410078.1.2594 WP_003410078.1.25954 WP_003410078.1.25965 WP_003410078.1.25972 WP_003410078.1.26017 WP_003410078.1.26032 WP_003410078.1.26038 WP_003410078.1.26072 WP_003410078.1.26089 WP_003410078.1.26097 WP_003410078.1.26098 WP_003410078.1.26108 WP_003410078.1.26118 WP_003410078.1.26126 WP_003410078.1.2614 WP_003410078.1.26168 WP_003410078.1.26182 WP_003410078.1.26190 WP_003410078.1.2620 WP_003410078.1.26234 WP_003410078.1.26243 WP_003410078.1.26265 WP_003410078.1.26267 WP_003410078.1.26292 WP_003410078.1.26310 WP_003410078.1.26328 WP_003410078.1.26349 WP_003410078.1.26366 WP_003410078.1.26374 WP_003410078.1.26407 WP_003410078.1.26412 WP_003410078.1.26454 WP_003410078.1.26464 WP_003410078.1.2653 WP_003410078.1.26571 WP_003410078.1.2659 WP_003410078.1.26597 WP_003410078.1.26603 WP_003410078.1.26629 WP_003410078.1.26651 WP_003410078.1.26702 WP_003410078.1.26707 WP_003410078.1.26710 WP_003410078.1.26719 WP_003410078.1.26737 WP_003410078.1.26738 WP_003410078.1.26745 WP_003410078.1.26756 WP_003410078.1.2676 WP_003410078.1.2677 WP_003410078.1.26779 WP_003410078.1.26780 WP_003410078.1.26798 WP_003410078.1.26854 WP_003410078.1.26868 WP_003410078.1.26876 WP_003410078.1.26888 WP_003410078.1.26914 WP_003410078.1.26945 WP_003410078.1.26959 WP_003410078.1.26969 WP_003410078.1.26984 WP_003410078.1.26992 WP_003410078.1.27004 WP_003410078.1.27017 WP_003410078.1.27045 WP_003410078.1.27074 WP_003410078.1.27075 WP_003410078.1.27128 WP_003410078.1.27130 WP_003410078.1.27139 WP_003410078.1.27152 WP_003410078.1.27162 WP_003410078.1.27164 WP_003410078.1.27193 WP_003410078.1.27235 WP_003410078.1.27254 WP_003410078.1.27278 WP_003410078.1.27343 WP_003410078.1.27352 WP_003410078.1.27369 WP_003410078.1.27391 WP_003410078.1.27398 WP_003410078.1.27402 WP_003410078.1.27410 WP_003410078.1.27411 WP_003410078.1.27449 WP_003410078.1.27460 WP_003410078.1.27463 WP_003410078.1.2749 WP_003410078.1.27492 WP_003410078.1.27528 WP_003410078.1.27541 WP_003410078.1.27576 WP_003410078.1.27582 WP_003410078.1.27596 WP_003410078.1.2766 WP_003410078.1.277 WP_003410078.1.27724 WP_003410078.1.27730 WP_003410078.1.27736 WP_003410078.1.27743 WP_003410078.1.27750 WP_003410078.1.27771 WP_003410078.1.27779 WP_003410078.1.27795 WP_003410078.1.27803 WP_003410078.1.27819 WP_003410078.1.27835 WP_003410078.1.27915 WP_003410078.1.27935 WP_003410078.1.27962 WP_003410078.1.28053 WP_003410078.1.28092 WP_003410078.1.28106 WP_003410078.1.28131 WP_003410078.1.28142 WP_003410078.1.28159 WP_003410078.1.2816 WP_003410078.1.28161 WP_003410078.1.28192 WP_003410078.1.28202 WP_003410078.1.28241 WP_003410078.1.28242 WP_003410078.1.28251 WP_003410078.1.28255 WP_003410078.1.28269 WP_003410078.1.28276 WP_003410078.1.28293 WP_003410078.1.28331 WP_003410078.1.28367 WP_003410078.1.28378 WP_003410078.1.28391 WP_003410078.1.2842 WP_003410078.1.28448 WP_003410078.1.2847 WP_003410078.1.28471 WP_003410078.1.28493 WP_003410078.1.28497 WP_003410078.1.28530 WP_003410078.1.28545 WP_003410078.1.28561 WP_003410078.1.28567 WP_003410078.1.28585 WP_003410078.1.286 WP_003410078.1.28610 WP_003410078.1.28617 WP_003410078.1.28634 WP_003410078.1.28642 WP_003410078.1.28671 WP_003410078.1.28682 WP_003410078.1.28698 WP_003410078.1.28703 WP_003410078.1.28739 WP_003410078.1.28758 WP_003410078.1.28781 WP_003410078.1.28787 WP_003410078.1.28827 WP_003410078.1.28839 WP_003410078.1.28847 WP_003410078.1.28850 WP_003410078.1.28851 WP_003410078.1.28865 WP_003410078.1.28897 WP_003410078.1.28914 WP_003410078.1.28935 WP_003410078.1.28936 WP_003410078.1.28939 WP_003410078.1.28943 WP_003410078.1.28952 WP_003410078.1.28975 WP_003410078.1.2899 WP_003410078.1.29000 WP_003410078.1.2901 WP_003410078.1.29028 WP_003410078.1.29033 WP_003410078.1.29058 WP_003410078.1.29078 WP_003410078.1.29102 WP_003410078.1.29115 WP_003410078.1.2916 WP_003410078.1.29217 WP_003410078.1.29223 WP_003410078.1.29234 WP_003410078.1.29264 WP_003410078.1.29275 WP_003410078.1.29339 WP_003410078.1.29348 WP_003410078.1.29364 WP_003410078.1.29367 WP_003410078.1.2938 WP_003410078.1.29399 WP_003410078.1.29426 WP_003410078.1.2944 WP_003410078.1.29449 WP_003410078.1.29450 WP_003410078.1.29452 WP_003410078.1.2949 WP_003410078.1.29510 WP_003410078.1.29515 WP_003410078.1.29525 WP_003410078.1.2953 WP_003410078.1.29559 WP_003410078.1.29587 WP_003410078.1.2959 WP_003410078.1.29592 WP_003410078.1.29599 WP_003410078.1.29611 WP_003410078.1.29632 WP_003410078.1.29649 WP_003410078.1.2965 WP_003410078.1.29659 WP_003410078.1.2969 WP_003410078.1.29696 WP_003410078.1.29698 WP_003410078.1.29718 WP_003410078.1.29742 WP_003410078.1.29745 WP_003410078.1.29747 WP_003410078.1.29769 WP_003410078.1.29825 WP_003410078.1.29830 WP_003410078.1.29847 WP_003410078.1.29861 WP_003410078.1.29869 WP_003410078.1.29883 WP_003410078.1.29890 WP_003410078.1.299 WP_003410078.1.29931 WP_003410078.1.29960 WP_003410078.1.3004 WP_003410078.1.30040 WP_003410078.1.30074 WP_003410078.1.30097 WP_003410078.1.30101 WP_003410078.1.30106 WP_003410078.1.30114 WP_003410078.1.30126 WP_003410078.1.30131 WP_003410078.1.30138 WP_003410078.1.30139 WP_003410078.1.30145 WP_003410078.1.30211 WP_003410078.1.30224 WP_003410078.1.30235 WP_003410078.1.30237 WP_003410078.1.3027 WP_003410078.1.30279 WP_003410078.1.30282 WP_003410078.1.30283 WP_003410078.1.30288 WP_003410078.1.30291 WP_003410078.1.30363 WP_003410078.1.30374 WP_003410078.1.30404 WP_003410078.1.3043 WP_003410078.1.30433 WP_003410078.1.30438 WP_003410078.1.30462 WP_003410078.1.30464 WP_003410078.1.30468 WP_003410078.1.30500 WP_003410078.1.3057 WP_003410078.1.30574 WP_003410078.1.30628 WP_003410078.1.30641 WP_003410078.1.30642 WP_003410078.1.30661 WP_003410078.1.30669 WP_003410078.1.30683 WP_003410078.1.30699 WP_003410078.1.30709 WP_003410078.1.30713 WP_003410078.1.30716 WP_003410078.1.30719 WP_003410078.1.30730 WP_003410078.1.30732 WP_003410078.1.30736 WP_003410078.1.30745 WP_003410078.1.30760 WP_003410078.1.30791 WP_003410078.1.308 WP_003410078.1.30807 WP_003410078.1.30818 WP_003410078.1.30824 WP_003410078.1.30848 WP_003410078.1.30877 WP_003410078.1.30888 WP_003410078.1.30901 WP_003410078.1.30903 WP_003410078.1.30912 WP_003410078.1.30913 WP_003410078.1.30914 WP_003410078.1.30919 WP_003410078.1.30977 WP_003410078.1.3100 WP_003410078.1.31002 WP_003410078.1.3101 WP_003410078.1.31034 WP_003410078.1.31047 WP_003410078.1.31070 WP_003410078.1.31074 WP_003410078.1.31102 WP_003410078.1.31127 WP_003410078.1.31184 WP_003410078.1.31199 WP_003410078.1.31226 WP_003410078.1.31230 WP_003410078.1.31233 WP_003410078.1.31263 WP_003410078.1.31264 WP_003410078.1.31270 WP_003410078.1.31287 WP_003410078.1.31290 WP_003410078.1.31304 WP_003410078.1.31346 WP_003410078.1.31348 WP_003410078.1.31354 WP_003410078.1.31390 WP_003410078.1.31414 WP_003410078.1.31417 WP_003410078.1.31428 WP_003410078.1.3143 WP_003410078.1.31458 WP_003410078.1.31483 WP_003410078.1.3149 WP_003410078.1.31498 WP_003410078.1.31507 WP_003410078.1.31537 WP_003410078.1.31548 WP_003410078.1.31573 WP_003410078.1.316 WP_003410078.1.31629 WP_003410078.1.31666 WP_003410078.1.31693 WP_003410078.1.31703 WP_003410078.1.31744 WP_003410078.1.31770 WP_003410078.1.31776 WP_003410078.1.31783 WP_003410078.1.318 WP_003410078.1.3184 WP_003410078.1.31840 WP_003410078.1.31880 WP_003410078.1.31911 WP_003410078.1.31930 WP_003410078.1.31932 WP_003410078.1.31955 WP_003410078.1.31985 WP_003410078.1.31991 WP_003410078.1.31995 WP_003410078.1.32004 WP_003410078.1.32039 WP_003410078.1.3204 WP_003410078.1.32045 WP_003410078.1.32071 WP_003410078.1.32098 WP_003410078.1.32132 WP_003410078.1.32157 WP_003410078.1.32164 WP_003410078.1.32179 WP_003410078.1.32198 WP_003410078.1.32297 WP_003410078.1.32317 WP_003410078.1.32383 WP_003410078.1.32400 WP_003410078.1.32403 WP_003410078.1.32416 WP_003410078.1.32421 WP_003410078.1.32433 WP_003410078.1.32461 WP_003410078.1.32482 WP_003410078.1.32503 WP_003410078.1.32556 WP_003410078.1.32562 WP_003410078.1.32569 WP_003410078.1.32592 WP_003410078.1.32620 WP_003410078.1.32647 WP_003410078.1.32653 WP_003410078.1.32654 WP_003410078.1.3268 WP_003410078.1.32695 WP_003410078.1.32706 WP_003410078.1.32716 WP_003410078.1.32738 WP_003410078.1.32752 WP_003410078.1.32780 WP_003410078.1.32781 WP_003410078.1.32793 WP_003410078.1.32799 WP_003410078.1.32822 WP_003410078.1.32833 WP_003410078.1.32862 WP_003410078.1.32880 WP_003410078.1.32897 WP_003410078.1.32909 WP_003410078.1.32935 WP_003410078.1.32974 WP_003410078.1.33007 WP_003410078.1.3302 WP_003410078.1.33028 WP_003410078.1.33035 WP_003410078.1.33044 WP_003410078.1.33054 WP_003410078.1.33082 WP_003410078.1.33141 WP_003410078.1.33148 WP_003410078.1.33155 WP_003410078.1.33168 WP_003410078.1.3321 WP_003410078.1.33215 WP_003410078.1.3325 WP_003410078.1.3327 WP_003410078.1.33278 WP_003410078.1.33288 WP_003410078.1.33305 WP_003410078.1.3331 WP_003410078.1.33319 WP_003410078.1.3333 WP_003410078.1.33393 WP_003410078.1.33403 WP_003410078.1.33452 WP_003410078.1.33467 WP_003410078.1.33477 WP_003410078.1.3349 WP_003410078.1.33519 WP_003410078.1.33542 WP_003410078.1.33601 WP_003410078.1.33602 WP_003410078.1.33633 WP_003410078.1.33646 WP_003410078.1.33673 WP_003410078.1.3369 WP_003410078.1.33705 WP_003410078.1.33762 WP_003410078.1.33783 WP_003410078.1.33789 WP_003410078.1.3383 WP_003410078.1.33832 WP_003410078.1.33839 WP_003410078.1.33848 WP_003410078.1.3387 WP_003410078.1.33886 WP_003410078.1.33895 WP_003410078.1.33906 WP_003410078.1.33912 WP_003410078.1.33954 WP_003410078.1.3399 WP_003410078.1.34042 WP_003410078.1.3405 WP_003410078.1.34055 WP_003410078.1.34056 WP_003410078.1.34065 WP_003410078.1.3408 WP_003410078.1.34090 WP_003410078.1.34109 WP_003410078.1.34111 WP_003410078.1.34131 WP_003410078.1.34153 WP_003410078.1.34163 WP_003410078.1.34181 WP_003410078.1.34197 WP_003410078.1.34198 WP_003410078.1.34215 WP_003410078.1.34219 WP_003410078.1.34255 WP_003410078.1.34260 WP_003410078.1.34275 WP_003410078.1.343 WP_003410078.1.34347 WP_003410078.1.34358 WP_003410078.1.34392 WP_003410078.1.344 WP_003410078.1.34428 WP_003410078.1.3443 WP_003410078.1.34435 WP_003410078.1.34446 WP_003410078.1.34499 WP_003410078.1.34505 WP_003410078.1.34516 WP_003410078.1.34529 WP_003410078.1.34551 WP_003410078.1.34563 WP_003410078.1.34576 WP_003410078.1.34581 WP_003410078.1.34588 WP_003410078.1.34596 WP_003410078.1.34599 WP_003410078.1.34639 WP_003410078.1.34673 WP_003410078.1.34724 WP_003410078.1.34740 WP_003410078.1.34755 WP_003410078.1.34777 WP_003410078.1.34783 WP_003410078.1.34841 WP_003410078.1.34908 WP_003410078.1.34919 WP_003410078.1.3492 WP_003410078.1.34933 WP_003410078.1.34945 WP_003410078.1.34946 WP_003410078.1.34954 WP_003410078.1.34960 WP_003410078.1.34961 WP_003410078.1.34963 WP_003410078.1.34965 WP_003410078.1.34968 WP_003410078.1.35023 WP_003410078.1.35069 WP_003410078.1.35072 WP_003410078.1.35078 WP_003410078.1.35146 WP_003410078.1.35156 WP_003410078.1.35160 WP_003410078.1.35162 WP_003410078.1.35173 WP_003410078.1.35176 WP_003410078.1.3520 WP_003410078.1.35213 WP_003410078.1.35221 WP_003410078.1.35246 WP_003410078.1.35278 WP_003410078.1.35301 WP_003410078.1.35311 WP_003410078.1.35312 WP_003410078.1.35317 WP_003410078.1.35319 WP_003410078.1.35363 WP_003410078.1.35382 WP_003410078.1.35385 WP_003410078.1.35396 WP_003410078.1.35397 WP_003410078.1.35426 WP_003410078.1.35439 WP_003410078.1.35455 WP_003410078.1.3548 WP_003410078.1.35484 WP_003410078.1.35492 WP_003410078.1.3553 WP_003410078.1.35553 WP_003410078.1.35555 WP_003410078.1.35561 WP_003410078.1.35602 WP_003410078.1.35610 WP_003410078.1.35635 WP_003410078.1.35657 WP_003410078.1.35680 WP_003410078.1.35687 WP_003410078.1.35689 WP_003410078.1.35707 WP_003410078.1.35732 WP_003410078.1.35754 WP_003410078.1.35770 WP_003410078.1.35771 WP_003410078.1.35780 WP_003410078.1.35805 WP_003410078.1.35811 WP_003410078.1.35821 WP_003410078.1.3584 WP_003410078.1.35848 WP_003410078.1.35864 WP_003410078.1.35874 WP_003410078.1.35897 WP_003410078.1.35899 WP_003410078.1.35923 WP_003410078.1.3593 WP_003410078.1.35954 WP_003410078.1.36005 WP_003410078.1.36014 WP_003410078.1.36023 WP_003410078.1.36051 WP_003410078.1.36053 WP_003410078.1.36075 WP_003410078.1.36089 WP_003410078.1.36097 WP_003410078.1.36098 WP_003410078.1.36116 WP_003410078.1.36145 WP_003410078.1.36156 WP_003410078.1.36205 WP_003410078.1.36228 WP_003410078.1.36246 WP_003410078.1.36252 WP_003410078.1.36260 WP_003410078.1.36270 WP_003410078.1.36271 WP_003410078.1.36303 WP_003410078.1.36309 WP_003410078.1.36315 WP_003410078.1.36319 WP_003410078.1.36321 WP_003410078.1.36326 WP_003410078.1.3634 WP_003410078.1.36356 WP_003410078.1.36357 WP_003410078.1.3636 WP_003410078.1.36385 WP_003410078.1.36399 WP_003410078.1.36436 WP_003410078.1.36465 WP_003410078.1.36469 WP_003410078.1.36473 WP_003410078.1.36485 WP_003410078.1.36508 WP_003410078.1.36540 WP_003410078.1.36561 WP_003410078.1.36571 WP_003410078.1.36573 WP_003410078.1.36578 WP_003410078.1.36585 WP_003410078.1.36597 WP_003410078.1.36614 WP_003410078.1.36657 WP_003410078.1.36674 WP_003410078.1.36720 WP_003410078.1.36727 WP_003410078.1.36733 WP_003410078.1.36785 WP_003410078.1.36810 WP_003410078.1.36844 WP_003410078.1.36851 WP_003410078.1.36862 WP_003410078.1.36893 WP_003410078.1.36901 WP_003410078.1.36921 WP_003410078.1.36935 WP_003410078.1.36941 WP_003410078.1.3695 WP_003410078.1.36951 WP_003410078.1.36968 WP_003410078.1.3700 WP_003410078.1.37004 WP_003410078.1.37012 WP_003410078.1.37071 WP_003410078.1.37088 WP_003410078.1.37131 WP_003410078.1.37157 WP_003410078.1.37175 WP_003410078.1.37188 WP_003410078.1.37213 WP_003410078.1.37229 WP_003410078.1.3724 WP_003410078.1.37277 WP_003410078.1.37305 WP_003410078.1.37330 WP_003410078.1.37389 WP_003410078.1.37400 WP_003410078.1.37440 WP_003410078.1.37459 WP_003410078.1.37468 WP_003410078.1.37475 WP_003410078.1.37484 WP_003410078.1.37601 WP_003410078.1.37612 WP_003410078.1.37632 WP_003410078.1.37643 WP_003410078.1.37655 WP_003410078.1.37660 WP_003410078.1.37674 WP_003410078.1.37700 WP_003410078.1.37701 WP_003410078.1.37709 WP_003410078.1.37711 WP_003410078.1.37721 WP_003410078.1.37722 WP_003410078.1.37747 WP_003410078.1.37765 WP_003410078.1.37772 WP_003410078.1.37804 WP_003410078.1.37809 WP_003410078.1.37859 WP_003410078.1.37877 WP_003410078.1.37943 WP_003410078.1.37950 WP_003410078.1.37973 WP_003410078.1.37975 WP_003410078.1.37983 WP_003410078.1.38 WP_003410078.1.38002 WP_003410078.1.3802 WP_003410078.1.38039 WP_003410078.1.38040 WP_003410078.1.38067 WP_003410078.1.38068 WP_003410078.1.38135 WP_003410078.1.38138 WP_003410078.1.38144 WP_003410078.1.38158 WP_003410078.1.38159 WP_003410078.1.38210 WP_003410078.1.38233 WP_003410078.1.38240 WP_003410078.1.38299 WP_003410078.1.38332 WP_003410078.1.38347 WP_003410078.1.38354 WP_003410078.1.38380 WP_003410078.1.38384 WP_003410078.1.38389 WP_003410078.1.38398 WP_003410078.1.38402 WP_003410078.1.38418 WP_003410078.1.38421 WP_003410078.1.38466 WP_003410078.1.38477 WP_003410078.1.38483 WP_003410078.1.3849 WP_003410078.1.38530 WP_003410078.1.38535 WP_003410078.1.38539 WP_003410078.1.38594 WP_003410078.1.38601 WP_003410078.1.38611 WP_003410078.1.38638 WP_003410078.1.38639 WP_003410078.1.38646 WP_003410078.1.38648 WP_003410078.1.38654 WP_003410078.1.38659 WP_003410078.1.38660 WP_003410078.1.38666 WP_003410078.1.38671 WP_003410078.1.38672 WP_003410078.1.38677 WP_003410078.1.38750 WP_003410078.1.38772 WP_003410078.1.38812 WP_003410078.1.38821 WP_003410078.1.38844 WP_003410078.1.38863 WP_003410078.1.38865 WP_003410078.1.38873 WP_003410078.1.3889 WP_003410078.1.38894 WP_003410078.1.38909 WP_003410078.1.38939 WP_003410078.1.38974 WP_003410078.1.38975 WP_003410078.1.38991 WP_003410078.1.39025 WP_003410078.1.39070 WP_003410078.1.39072 WP_003410078.1.39095 WP_003410078.1.39106 WP_003410078.1.39165 WP_003410078.1.39174 WP_003410078.1.39176 WP_003410078.1.39178 WP_003410078.1.39190 WP_003410078.1.39201 WP_003410078.1.39207 WP_003410078.1.39211 WP_003410078.1.39236 WP_003410078.1.39239 WP_003410078.1.39252 WP_003410078.1.39288 WP_003410078.1.39295 WP_003410078.1.39306 WP_003410078.1.39359 WP_003410078.1.39364 WP_003410078.1.39400 WP_003410078.1.39447 WP_003410078.1.3945 WP_003410078.1.39450 WP_003410078.1.39455 WP_003410078.1.3949 WP_003410078.1.39521 WP_003410078.1.39560 WP_003410078.1.39592 WP_003410078.1.39593 WP_003410078.1.396 WP_003410078.1.39616 WP_003410078.1.39654 WP_003410078.1.39657 WP_003410078.1.39661 WP_003410078.1.39674 WP_003410078.1.39678 WP_003410078.1.3968 WP_003410078.1.39694 WP_003410078.1.3971 WP_003410078.1.39718 WP_003410078.1.39728 WP_003410078.1.39739 WP_003410078.1.39748 WP_003410078.1.39751 WP_003410078.1.39759 WP_003410078.1.39801 WP_003410078.1.39804 WP_003410078.1.39848 WP_003410078.1.39877 WP_003410078.1.39925 WP_003410078.1.3994 WP_003410078.1.39959 WP_003410078.1.3996 WP_003410078.1.39960 WP_003410078.1.3997 WP_003410078.1.39980 WP_003410078.1.40000 WP_003410078.1.40028 WP_003410078.1.4003 WP_003410078.1.40094 WP_003410078.1.40096 WP_003410078.1.40150 WP_003410078.1.40156 WP_003410078.1.40186 WP_003410078.1.40276 WP_003410078.1.40277 WP_003410078.1.40323 WP_003410078.1.40336 WP_003410078.1.40353 WP_003410078.1.4036 WP_003410078.1.40372 WP_003410078.1.40402 WP_003410078.1.40413 WP_003410078.1.40440 WP_003410078.1.40446 WP_003410078.1.40451 WP_003410078.1.40455 WP_003410078.1.40523 WP_003410078.1.40543 WP_003410078.1.40641 WP_003410078.1.40646 WP_003410078.1.40651 WP_003410078.1.40653 WP_003410078.1.4067 WP_003410078.1.40705 WP_003410078.1.40723 WP_003410078.1.40731 WP_003410078.1.40735 WP_003410078.1.40795 WP_003410078.1.40799 WP_003410078.1.40852 WP_003410078.1.40876 WP_003410078.1.40881 WP_003410078.1.40922 WP_003410078.1.40948 WP_003410078.1.4095 WP_003410078.1.40956 WP_003410078.1.40957 WP_003410078.1.40964 WP_003410078.1.4097 WP_003410078.1.410 WP_003410078.1.41000 WP_003410078.1.41055 WP_003410078.1.41108 WP_003410078.1.41123 WP_003410078.1.41177 WP_003410078.1.41202 WP_003410078.1.41219 WP_003410078.1.41231 WP_003410078.1.41249 WP_003410078.1.4127 WP_003410078.1.41296 WP_003410078.1.41355 WP_003410078.1.41376 WP_003410078.1.41430 WP_003410078.1.41447 WP_003410078.1.41469 WP_003410078.1.41504 WP_003410078.1.41553 WP_003410078.1.41564 WP_003410078.1.41583 WP_003410078.1.41616 WP_003410078.1.41632 WP_003410078.1.41635 WP_003410078.1.41636 WP_003410078.1.41648 WP_003410078.1.41660 WP_003410078.1.41685 WP_003410078.1.41695 WP_003410078.1.41704 WP_003410078.1.4171 WP_003410078.1.41719 WP_003410078.1.41733 WP_003410078.1.41744 WP_003410078.1.41774 WP_003410078.1.41803 WP_003410078.1.41820 WP_003410078.1.41828 WP_003410078.1.41829 WP_003410078.1.41860 WP_003410078.1.41912 WP_003410078.1.41921 WP_003410078.1.41933 WP_003410078.1.41944 WP_003410078.1.42043 WP_003410078.1.42075 WP_003410078.1.42078 WP_003410078.1.42094 WP_003410078.1.42112 WP_003410078.1.4212 WP_003410078.1.42122 WP_003410078.1.42134 WP_003410078.1.42183 WP_003410078.1.42188 WP_003410078.1.42201 WP_003410078.1.42202 WP_003410078.1.42208 WP_003410078.1.42247 WP_003410078.1.42255 WP_003410078.1.42273 WP_003410078.1.42304 WP_003410078.1.42309 WP_003410078.1.42370 WP_003410078.1.42385 WP_003410078.1.42400 WP_003410078.1.42409 WP_003410078.1.42414 WP_003410078.1.42417 WP_003410078.1.42430 WP_003410078.1.42461 WP_003410078.1.42465 WP_003410078.1.42467 WP_003410078.1.42473 WP_003410078.1.42474 WP_003410078.1.4248 WP_003410078.1.42494 WP_003410078.1.42519 WP_003410078.1.42524 WP_003410078.1.42534 WP_003410078.1.4255 WP_003410078.1.42562 WP_003410078.1.42568 WP_003410078.1.42570 WP_003410078.1.42618 WP_003410078.1.42660 WP_003410078.1.42695 WP_003410078.1.42704 WP_003410078.1.42705 WP_003410078.1.42722 WP_003410078.1.42777 WP_003410078.1.42782 WP_003410078.1.42835 WP_003410078.1.42839 WP_003410078.1.42842 WP_003410078.1.42905 WP_003410078.1.42916 WP_003410078.1.42930 WP_003410078.1.42971 WP_003410078.1.43005 WP_003410078.1.43009 WP_003410078.1.43053 WP_003410078.1.43082 WP_003410078.1.43087 WP_003410078.1.43098 WP_003410078.1.43208 WP_003410078.1.43236 WP_003410078.1.43246 WP_003410078.1.43255 WP_003410078.1.43266 WP_003410078.1.43269 WP_003410078.1.43273 WP_003410078.1.43296 WP_003410078.1.43306 WP_003410078.1.4335 WP_003410078.1.43368 WP_003410078.1.43395 WP_003410078.1.43457 WP_003410078.1.43462 WP_003410078.1.43475 WP_003410078.1.43478 WP_003410078.1.43484 WP_003410078.1.43557 WP_003410078.1.43578 WP_003410078.1.43588 WP_003410078.1.43643 WP_003410078.1.43664 WP_003410078.1.43684 WP_003410078.1.43686 WP_003410078.1.43706 WP_003410078.1.43716 WP_003410078.1.4377 WP_003410078.1.43781 WP_003410078.1.43794 WP_003410078.1.43815 WP_003410078.1.43846 WP_003410078.1.43861 WP_003410078.1.43863 WP_003410078.1.43866 WP_003410078.1.43885 WP_003410078.1.43897 WP_003410078.1.4390 WP_003410078.1.43902 WP_003410078.1.43921 WP_003410078.1.43936 WP_003410078.1.43937 WP_003410078.1.43960 WP_003410078.1.43965 WP_003410078.1.4399 WP_003410078.1.43993 WP_003410078.1.43996 WP_003410078.1.44 WP_003410078.1.44001 WP_003410078.1.44008 WP_003410078.1.44016 WP_003410078.1.44033 WP_003410078.1.44037 WP_003410078.1.44041 WP_003410078.1.44070 WP_003410078.1.44071 WP_003410078.1.44076 WP_003410078.1.44104 WP_003410078.1.44111 WP_003410078.1.44124 WP_003410078.1.44169 WP_003410078.1.44219 WP_003410078.1.44237 WP_003410078.1.44279 WP_003410078.1.44336 WP_003410078.1.44355 WP_003410078.1.44358 WP_003410078.1.4438 WP_003410078.1.44390 WP_003410078.1.44392 WP_003410078.1.4441 WP_003410078.1.44415 WP_003410078.1.44464 WP_003410078.1.44466 WP_003410078.1.44489 WP_003410078.1.44492 WP_003410078.1.44494 WP_003410078.1.44500 WP_003410078.1.44519 WP_003410078.1.44526 WP_003410078.1.44532 WP_003410078.1.44534 WP_003410078.1.44562 WP_003410078.1.44589 WP_003410078.1.44597 WP_003410078.1.44600 WP_003410078.1.44602 WP_003410078.1.44615 WP_003410078.1.4464 WP_003410078.1.44651 WP_003410078.1.44659 WP_003410078.1.44665 WP_003410078.1.44694 WP_003410078.1.44700 WP_003410078.1.44713 WP_003410078.1.44735 WP_003410078.1.44740 WP_003410078.1.44757 WP_003410078.1.4476 WP_003410078.1.44761 WP_003410078.1.44767 WP_003410078.1.44776 WP_003410078.1.44779 WP_003410078.1.44786 WP_003410078.1.44808 WP_003410078.1.44864 WP_003410078.1.44901 WP_003410078.1.44908 WP_003410078.1.44913 WP_003410078.1.4492 WP_003410078.1.44939 WP_003410078.1.44979 WP_003410078.1.44981 WP_003410078.1.45002 WP_003410078.1.45011 WP_003410078.1.4504 WP_003410078.1.45062 WP_003410078.1.45066 WP_003410078.1.45081 WP_003410078.1.45113 WP_003410078.1.45129 WP_003410078.1.45135 WP_003410078.1.45147 WP_003410078.1.45168 WP_003410078.1.4517 WP_003410078.1.45181 WP_003410078.1.45185 WP_003410078.1.45192 WP_003410078.1.45200 WP_003410078.1.45205 WP_003410078.1.45211 WP_003410078.1.45249 WP_003410078.1.4526 WP_003410078.1.45286 WP_003410078.1.45326 WP_003410078.1.45347 WP_003410078.1.45390 WP_003410078.1.454 WP_003410078.1.45407 WP_003410078.1.45451 WP_003410078.1.45453 WP_003410078.1.45460 WP_003410078.1.45463 WP_003410078.1.45470 WP_003410078.1.45474 WP_003410078.1.45491 WP_003410078.1.45510 WP_003410078.1.45563 WP_003410078.1.45584 WP_003410078.1.45590 WP_003410078.1.45619 WP_003410078.1.45626 WP_003410078.1.45631 WP_003410078.1.45666 WP_003410078.1.45697 WP_003410078.1.4571 WP_003410078.1.45731 WP_003410078.1.45743 WP_003410078.1.45765 WP_003410078.1.45776 WP_003410078.1.45783 WP_003410078.1.45805 WP_003410078.1.45815 WP_003410078.1.45849 WP_003410078.1.45867 WP_003410078.1.45884 WP_003410078.1.4590 WP_003410078.1.45923 WP_003410078.1.45926 WP_003410078.1.45963 WP_003410078.1.45989 WP_003410078.1.45992 WP_003410078.1.46025 WP_003410078.1.46083 WP_003410078.1.46090 WP_003410078.1.46092 WP_003410078.1.46100 WP_003410078.1.46101 WP_003410078.1.46103 WP_003410078.1.46107 WP_003410078.1.46127 WP_003410078.1.46128 WP_003410078.1.46129 WP_003410078.1.46141 WP_003410078.1.46150 WP_003410078.1.46201 WP_003410078.1.46226 WP_003410078.1.4624 WP_003410078.1.46253 WP_003410078.1.46268 WP_003410078.1.46285 WP_003410078.1.46300 WP_003410078.1.46313 WP_003410078.1.46336 WP_003410078.1.46365 WP_003410078.1.46370 WP_003410078.1.46381 WP_003410078.1.46402 WP_003410078.1.46411 WP_003410078.1.4644 WP_003410078.1.46442 WP_003410078.1.46453 WP_003410078.1.46463 WP_003410078.1.46478 WP_003410078.1.46492 WP_003410078.1.46521 WP_003410078.1.4653 WP_003410078.1.46532 WP_003410078.1.46539 WP_003410078.1.46568 WP_003410078.1.46585 WP_003410078.1.46609 WP_003410078.1.46613 WP_003410078.1.46625 WP_003410078.1.46642 WP_003410078.1.46647 WP_003410078.1.46674 WP_003410078.1.46724 WP_003410078.1.46758 WP_003410078.1.46773 WP_003410078.1.46777 WP_003410078.1.46786 WP_003410078.1.46792 WP_003410078.1.46847 WP_003410078.1.46851 WP_003410078.1.4687 WP_003410078.1.46897 WP_003410078.1.46936 WP_003410078.1.46980 WP_003410078.1.47011 WP_003410078.1.47066 WP_003410078.1.47077 WP_003410078.1.47083 WP_003410078.1.47106 WP_003410078.1.47142 WP_003410078.1.47147 WP_003410078.1.47166 WP_003410078.1.47178 WP_003410078.1.47179 WP_003410078.1.47194 WP_003410078.1.47207 WP_003410078.1.47210 WP_003410078.1.47261 WP_003410078.1.47262 WP_003410078.1.47402 WP_003410078.1.47423 WP_003410078.1.47467 WP_003410078.1.47502 WP_003410078.1.4751 WP_003410078.1.47511 WP_003410078.1.47537 WP_003410078.1.47540 WP_003410078.1.47568 WP_003410078.1.47572 WP_003410078.1.47588 WP_003410078.1.47636 WP_003410078.1.4764 WP_003410078.1.47653 WP_003410078.1.47679 WP_003410078.1.47681 WP_003410078.1.47690 WP_003410078.1.4771 WP_003410078.1.47717 WP_003410078.1.47743 WP_003410078.1.47754 WP_003410078.1.47773 WP_003410078.1.47776 WP_003410078.1.47780 WP_003410078.1.47805 WP_003410078.1.47832 WP_003410078.1.47847 WP_003410078.1.47858 WP_003410078.1.47861 WP_003410078.1.47868 WP_003410078.1.47893 WP_003410078.1.47899 WP_003410078.1.479 WP_003410078.1.47912 WP_003410078.1.47913 WP_003410078.1.47926 WP_003410078.1.4794 WP_003410078.1.47943 WP_003410078.1.47959 WP_003410078.1.47974 WP_003410078.1.47993 WP_003410078.1.48004 WP_003410078.1.48039 WP_003410078.1.48050 WP_003410078.1.48084 WP_003410078.1.48097 WP_003410078.1.48101 WP_003410078.1.48109 WP_003410078.1.4813 WP_003410078.1.48130 WP_003410078.1.48135 WP_003410078.1.48143 WP_003410078.1.48152 WP_003410078.1.48155 WP_003410078.1.48170 WP_003410078.1.48173 WP_003410078.1.48177 WP_003410078.1.48185 WP_003410078.1.48204 WP_003410078.1.48219 WP_003410078.1.4823 WP_003410078.1.48240 WP_003410078.1.48256 WP_003410078.1.48264 WP_003410078.1.48287 WP_003410078.1.48330 WP_003410078.1.48333 WP_003410078.1.48348 WP_003410078.1.48354 WP_003410078.1.48372 WP_003410078.1.48383 WP_003410078.1.48388 WP_003410078.1.48419 WP_003410078.1.48423 WP_003410078.1.48443 WP_003410078.1.48450 WP_003410078.1.48462 WP_003410078.1.48543 WP_003410078.1.48550 WP_003410078.1.48605 WP_003410078.1.48618 WP_003410078.1.4863 WP_003410078.1.48648 WP_003410078.1.48658 WP_003410078.1.48666 WP_003410078.1.48687 WP_003410078.1.48779 WP_003410078.1.4878 WP_003410078.1.48798 WP_003410078.1.48802 WP_003410078.1.48826 WP_003410078.1.48831 WP_003410078.1.48843 WP_003410078.1.48857 WP_003410078.1.4890 WP_003410078.1.48946 WP_003410078.1.48979 WP_003410078.1.49017 WP_003410078.1.49048 WP_003410078.1.49059 WP_003410078.1.4906 WP_003410078.1.4907 WP_003410078.1.49103 WP_003410078.1.49110 WP_003410078.1.49111 WP_003410078.1.49112 WP_003410078.1.4919 WP_003410078.1.49251 WP_003410078.1.49254 WP_003410078.1.49263 WP_003410078.1.49291 WP_003410078.1.49296 WP_003410078.1.49335 WP_003410078.1.49337 WP_003410078.1.49419 WP_003410078.1.49426 WP_003410078.1.49437 WP_003410078.1.49439 WP_003410078.1.49474 WP_003410078.1.49506 WP_003410078.1.49516 WP_003410078.1.49523 WP_003410078.1.49526 WP_003410078.1.49532 WP_003410078.1.49588 WP_003410078.1.4959 WP_003410078.1.49678 WP_003410078.1.49687 WP_003410078.1.49699 WP_003410078.1.49709 WP_003410078.1.4971 WP_003410078.1.4972 WP_003410078.1.49736 WP_003410078.1.49746 WP_003410078.1.49764 WP_003410078.1.49773 WP_003410078.1.49796 WP_003410078.1.49814 WP_003410078.1.49815 WP_003410078.1.49816 WP_003410078.1.49839 WP_003410078.1.49857 WP_003410078.1.49878 WP_003410078.1.49880 WP_003410078.1.49944 WP_003410078.1.4999 WP_003410078.1.49990 WP_003410078.1.50068 WP_003410078.1.50077 WP_003410078.1.5008 WP_003410078.1.50081 WP_003410078.1.50122 WP_003410078.1.50126 WP_003410078.1.50149 WP_003410078.1.50162 WP_003410078.1.5018 WP_003410078.1.50194 WP_003410078.1.50218 WP_003410078.1.50235 WP_003410078.1.50249 WP_003410078.1.50265 WP_003410078.1.50271 WP_003410078.1.50324 WP_003410078.1.50347 WP_003410078.1.50372 WP_003410078.1.50398 WP_003410078.1.50407 WP_003410078.1.50444 WP_003410078.1.50466 WP_003410078.1.50472 WP_003410078.1.5048 WP_003410078.1.50498 WP_003410078.1.5050 WP_003410078.1.50540 WP_003410078.1.50554 WP_003410078.1.50557 WP_003410078.1.50601 WP_003410078.1.50610 WP_003410078.1.50632 WP_003410078.1.50633 WP_003410078.1.50642 WP_003410078.1.50655 WP_003410078.1.50659 WP_003410078.1.50683 WP_003410078.1.50689 WP_003410078.1.50692 WP_003410078.1.50714 WP_003410078.1.50729 WP_003410078.1.50756 WP_003410078.1.50784 WP_003410078.1.50794 WP_003410078.1.50841 WP_003410078.1.50860 WP_003410078.1.50868 WP_003410078.1.50877 WP_003410078.1.5096 WP_003410078.1.50981 WP_003410078.1.50987 WP_003410078.1.51003 WP_003410078.1.51009 WP_003410078.1.51037 WP_003410078.1.51074 WP_003410078.1.51082 WP_003410078.1.51101 WP_003410078.1.51116 WP_003410078.1.51149 WP_003410078.1.51156 WP_003410078.1.51157 WP_003410078.1.51213 WP_003410078.1.51232 WP_003410078.1.51239 WP_003410078.1.51247 WP_003410078.1.51266 WP_003410078.1.51279 WP_003410078.1.51291 WP_003410078.1.51294 WP_003410078.1.51301 WP_003410078.1.51329 WP_003410078.1.51391 WP_003410078.1.51422 WP_003410078.1.51445 WP_003410078.1.51455 WP_003410078.1.51466 WP_003410078.1.51468 WP_003410078.1.51478 WP_003410078.1.51497 WP_003410078.1.51520 WP_003410078.1.51593 WP_003410078.1.51628 WP_003410078.1.5164 WP_003410078.1.51647 WP_003410078.1.51696 WP_003410078.1.51721 WP_003410078.1.51788 WP_003410078.1.51795 WP_003410078.1.51801 WP_003410078.1.51817 WP_003410078.1.51819 WP_003410078.1.51854 WP_003410078.1.51923 WP_003410078.1.51942 WP_003410078.1.51948 WP_003410078.1.51963 WP_003410078.1.51969 WP_003410078.1.52000 WP_003410078.1.52001 WP_003410078.1.52003 WP_003410078.1.52006 WP_003410078.1.52036 WP_003410078.1.52038 WP_003410078.1.52046 WP_003410078.1.52059 WP_003410078.1.52069 WP_003410078.1.52082 WP_003410078.1.52102 WP_003410078.1.52106 WP_003410078.1.52166 WP_003410078.1.52168 WP_003410078.1.52173 WP_003410078.1.52178 WP_003410078.1.52206 WP_003410078.1.52216 WP_003410078.1.52238 WP_003410078.1.52241 WP_003410078.1.52280 WP_003410078.1.52314 WP_003410078.1.52385 WP_003410078.1.52390 WP_003410078.1.524 WP_003410078.1.52460 WP_003410078.1.52485 WP_003410078.1.52486 WP_003410078.1.52495 WP_003410078.1.52504 WP_003410078.1.52531 WP_003410078.1.52533 WP_003410078.1.52545 WP_003410078.1.52553 WP_003410078.1.52563 WP_003410078.1.52564 WP_003410078.1.52574 WP_003410078.1.52641 WP_003410078.1.52673 WP_003410078.1.52674 WP_003410078.1.52708 WP_003410078.1.52713 WP_003410078.1.52761 WP_003410078.1.52778 WP_003410078.1.52791 WP_003410078.1.52797 WP_003410078.1.52818 WP_003410078.1.52872 WP_003410078.1.52873 WP_003410078.1.52891 WP_003410078.1.52892 WP_003410078.1.52909 WP_003410078.1.52970 WP_003410078.1.52998 WP_003410078.1.53053 WP_003410078.1.5306 WP_003410078.1.53088 WP_003410078.1.5309 WP_003410078.1.531 WP_003410078.1.53117 WP_003410078.1.53118 WP_003410078.1.53142 WP_003410078.1.53143 WP_003410078.1.53157 WP_003410078.1.53167 WP_003410078.1.53200 WP_003410078.1.53204 WP_003410078.1.53213 WP_003410078.1.53217 WP_003410078.1.53226 WP_003410078.1.53229 WP_003410078.1.53230 WP_003410078.1.53237 WP_003410078.1.53254 WP_003410078.1.53257 WP_003410078.1.5327 WP_003410078.1.53276 WP_003410078.1.53278 WP_003410078.1.533 WP_003410078.1.53302 WP_003410078.1.53306 WP_003410078.1.5335 WP_003410078.1.53353 WP_003410078.1.53381 WP_003410078.1.53413 WP_003410078.1.53458 WP_003410078.1.53460 WP_003410078.1.53480 WP_003410078.1.53517 WP_003410078.1.53522 WP_003410078.1.53525 WP_003410078.1.53526 WP_003410078.1.53553 WP_003410078.1.53606 WP_003410078.1.53609 WP_003410078.1.53628 WP_003410078.1.53643 WP_003410078.1.53667 WP_003410078.1.53679 WP_003410078.1.53715 WP_003410078.1.53730 WP_003410078.1.53742 WP_003410078.1.53743 WP_003410078.1.53754 WP_003410078.1.53775 WP_003410078.1.53787 WP_003410078.1.53803 WP_003410078.1.53818 WP_003410078.1.53822 WP_003410078.1.53853 WP_003410078.1.53865 WP_003410078.1.53888 WP_003410078.1.53900 WP_003410078.1.53912 WP_003410078.1.53914 WP_003410078.1.53952 WP_003410078.1.53973 WP_003410078.1.5398 WP_003410078.1.5408 WP_003410078.1.54089 WP_003410078.1.54093 WP_003410078.1.54099 WP_003410078.1.54112 WP_003410078.1.54125 WP_003410078.1.54141 WP_003410078.1.54162 WP_003410078.1.54179 WP_003410078.1.54206 WP_003410078.1.54218 WP_003410078.1.54225 WP_003410078.1.54227 WP_003410078.1.54232 WP_003410078.1.54241 WP_003410078.1.54245 WP_003410078.1.54247 WP_003410078.1.54260 WP_003410078.1.54275 WP_003410078.1.54280 WP_003410078.1.5429 WP_003410078.1.54294 WP_003410078.1.54314 WP_003410078.1.54347 WP_003410078.1.54351 WP_003410078.1.54370 WP_003410078.1.54428 WP_003410078.1.54449 WP_003410078.1.54494 WP_003410078.1.54502 WP_003410078.1.54514 WP_003410078.1.54519 WP_003410078.1.5452 WP_003410078.1.54531 WP_003410078.1.54537 WP_003410078.1.54553 WP_003410078.1.54555 WP_003410078.1.54575 WP_003410078.1.54633 WP_003410078.1.54686 WP_003410078.1.54687 WP_003410078.1.54705 WP_003410078.1.54730 WP_003410078.1.54732 WP_003410078.1.5475 WP_003410078.1.54797 WP_003410078.1.54807 WP_003410078.1.54836 WP_003410078.1.54838 WP_003410078.1.54860 WP_003410078.1.54888 WP_003410078.1.54897 WP_003410078.1.54905 WP_003410078.1.54909 WP_003410078.1.54937 WP_003410078.1.54939 WP_003410078.1.54944 WP_003410078.1.54945 WP_003410078.1.54953 WP_003410078.1.54964 WP_003410078.1.55015 WP_003410078.1.55022 WP_003410078.1.55023 WP_003410078.1.55051 WP_003410078.1.55072 WP_003410078.1.55088 WP_003410078.1.55106 WP_003410078.1.55126 WP_003410078.1.55128 WP_003410078.1.55140 WP_003410078.1.55150 WP_003410078.1.55210 WP_003410078.1.55227 WP_003410078.1.55248 WP_003410078.1.55257 WP_003410078.1.55258 WP_003410078.1.55267 WP_003410078.1.55279 WP_003410078.1.55307 WP_003410078.1.55326 WP_003410078.1.55328 WP_003410078.1.5533 WP_003410078.1.55345 WP_003410078.1.55396 WP_003410078.1.55398 WP_003410078.1.55441 WP_003410078.1.55459 WP_003410078.1.55501 WP_003410078.1.55504 WP_003410078.1.55578 WP_003410078.1.55626 WP_003410078.1.55641 WP_003410078.1.5569 WP_003410078.1.55723 WP_003410078.1.55735 WP_003410078.1.5574 WP_003410078.1.55772 WP_003410078.1.55802 WP_003410078.1.55807 WP_003410078.1.55819 WP_003410078.1.55821 WP_003410078.1.5583 WP_003410078.1.55849 WP_003410078.1.55856 WP_003410078.1.55860 WP_003410078.1.55882 WP_003410078.1.55883 WP_003410078.1.55894 WP_003410078.1.55902 WP_003410078.1.55908 WP_003410078.1.55909 WP_003410078.1.5591 WP_003410078.1.55961 WP_003410078.1.55977 WP_003410078.1.55983 WP_003410078.1.56028 WP_003410078.1.56057 WP_003410078.1.56060 WP_003410078.1.56107 WP_003410078.1.56132 WP_003410078.1.56163 WP_003410078.1.56167 WP_003410078.1.56178 WP_003410078.1.56287 WP_003410078.1.56292 WP_003410078.1.56327 WP_003410078.1.56341 WP_003410078.1.56359 WP_003410078.1.56365 WP_003410078.1.56394 WP_003410078.1.56443 WP_003410078.1.56473 WP_003410078.1.56478 WP_003410078.1.56500 WP_003410078.1.56517 WP_003410078.1.56534 WP_003410078.1.5656 WP_003410078.1.56577 WP_003410078.1.56593 WP_003410078.1.56637 WP_003410078.1.56670 WP_003410078.1.56697 WP_003410078.1.567 WP_003410078.1.56701 WP_003410078.1.56709 WP_003410078.1.56729 WP_003410078.1.56743 WP_003410078.1.56755 WP_003410078.1.56764 WP_003410078.1.56769 WP_003410078.1.56770 WP_003410078.1.56795 WP_003410078.1.5681 WP_003410078.1.56827 WP_003410078.1.56839 WP_003410078.1.56863 WP_003410078.1.56868 WP_003410078.1.56869 WP_003410078.1.56915 WP_003410078.1.56926 WP_003410078.1.56961 WP_003410078.1.56971 WP_003410078.1.57023 WP_003410078.1.57035 WP_003410078.1.57077 WP_003410078.1.57094 WP_003410078.1.57134 WP_003410078.1.57151 WP_003410078.1.57169 WP_003410078.1.57212 WP_003410078.1.57230 WP_003410078.1.5724 WP_003410078.1.5725 WP_003410078.1.5727 WP_003410078.1.57273 WP_003410078.1.573 WP_003410078.1.57314 WP_003410078.1.57326 WP_003410078.1.57328 WP_003410078.1.57331 WP_003410078.1.57340 WP_003410078.1.57351 WP_003410078.1.57352 WP_003410078.1.57380 WP_003410078.1.57430 WP_003410078.1.5744 WP_003410078.1.57440 WP_003410078.1.5745 WP_003410078.1.57461 WP_003410078.1.57469 WP_003410078.1.57489 WP_003410078.1.575 WP_003410078.1.57509 WP_003410078.1.57519 WP_003410078.1.57525 WP_003410078.1.57551 WP_003410078.1.5758 WP_003410078.1.57596 WP_003410078.1.57604 WP_003410078.1.57616 WP_003410078.1.57617 WP_003410078.1.57619 WP_003410078.1.57627 WP_003410078.1.57642 WP_003410078.1.57658 WP_003410078.1.57667 WP_003410078.1.57675 WP_003410078.1.57689 WP_003410078.1.57708 WP_003410078.1.57794 WP_003410078.1.57821 WP_003410078.1.57825 WP_003410078.1.57843 WP_003410078.1.57906 WP_003410078.1.57924 WP_003410078.1.57926 WP_003410078.1.57930 WP_003410078.1.57957 WP_003410078.1.57960 WP_003410078.1.57964 WP_003410078.1.57991 WP_003410078.1.58000 WP_003410078.1.58086 WP_003410078.1.58101 WP_003410078.1.58103 WP_003410078.1.58108 WP_003410078.1.5811 WP_003410078.1.58121 WP_003410078.1.58145 WP_003410078.1.58164 WP_003410078.1.58174 WP_003410078.1.582 WP_003410078.1.58202 WP_003410078.1.58209 WP_003410078.1.58215 WP_003410078.1.5824 WP_003410078.1.58250 WP_003410078.1.58259 WP_003410078.1.58283 WP_003410078.1.58288 WP_003410078.1.5830 WP_003410078.1.58303 WP_003410078.1.58311 WP_003410078.1.58330 WP_003410078.1.58359 WP_003410078.1.58386 WP_003410078.1.58393 WP_003410078.1.58431 WP_003410078.1.5844 WP_003410078.1.58457 WP_003410078.1.58488 WP_003410078.1.58534 WP_003410078.1.58559 WP_003410078.1.58567 WP_003410078.1.58573 WP_003410078.1.58612 WP_003410078.1.58619 WP_003410078.1.58630 WP_003410078.1.5865 WP_003410078.1.58671 WP_003410078.1.58690 WP_003410078.1.58702 WP_003410078.1.58743 WP_003410078.1.58754 WP_003410078.1.5879 WP_003410078.1.5881 WP_003410078.1.58824 WP_003410078.1.58848 WP_003410078.1.58857 WP_003410078.1.58891 WP_003410078.1.58892 WP_003410078.1.5890 WP_003410078.1.58904 WP_003410078.1.58921 WP_003410078.1.58930 WP_003410078.1.58939 WP_003410078.1.58941 WP_003410078.1.58953 WP_003410078.1.58961 WP_003410078.1.5898 WP_003410078.1.59025 WP_003410078.1.59029 WP_003410078.1.59037 WP_003410078.1.59044 WP_003410078.1.59085 WP_003410078.1.59088 WP_003410078.1.59112 WP_003410078.1.59130 WP_003410078.1.5914 WP_003410078.1.59147 WP_003410078.1.59166 WP_003410078.1.59205 WP_003410078.1.59209 WP_003410078.1.59237 WP_003410078.1.59240 WP_003410078.1.59253 WP_003410078.1.59254 WP_003410078.1.59262 WP_003410078.1.59270 WP_003410078.1.5928 WP_003410078.1.59304 WP_003410078.1.59305 WP_003410078.1.59309 WP_003410078.1.59316 WP_003410078.1.59326 WP_003410078.1.59328 WP_003410078.1.59333 WP_003410078.1.59338 WP_003410078.1.59388 WP_003410078.1.59428 WP_003410078.1.59487 WP_003410078.1.59537 WP_003410078.1.59561 WP_003410078.1.59677 WP_003410078.1.59722 WP_003410078.1.59727 WP_003410078.1.59732 WP_003410078.1.59738 WP_003410078.1.59750 WP_003410078.1.59757 WP_003410078.1.59761 WP_003410078.1.59808 WP_003410078.1.59850 WP_003410078.1.59856 WP_003410078.1.59860 WP_003410078.1.59861 WP_003410078.1.5987 WP_003410078.1.59878 WP_003410078.1.59888 WP_003410078.1.59952 WP_003410078.1.5996 WP_003410078.1.59961 WP_003410078.1.59974 WP_003410078.1.6000 WP_003410078.1.60007 WP_003410078.1.60016 WP_003410078.1.6003 WP_003410078.1.60047 WP_003410078.1.6007 WP_003410078.1.60091 WP_003410078.1.60121 WP_003410078.1.60125 WP_003410078.1.60135 WP_003410078.1.60139 WP_003410078.1.60152 WP_003410078.1.60171 WP_003410078.1.60197 WP_003410078.1.6020 WP_003410078.1.60205 WP_003410078.1.60207 WP_003410078.1.60215 WP_003410078.1.60217 WP_003410078.1.60267 WP_003410078.1.60288 WP_003410078.1.60291 WP_003410078.1.60301 WP_003410078.1.60305 WP_003410078.1.60312 WP_003410078.1.60313 WP_003410078.1.60314 WP_003410078.1.60367 WP_003410078.1.60376 WP_003410078.1.60403 WP_003410078.1.60413 WP_003410078.1.60421 WP_003410078.1.60451 WP_003410078.1.60460 WP_003410078.1.60479 WP_003410078.1.60487 WP_003410078.1.60573 WP_003410078.1.60583 WP_003410078.1.60632 WP_003410078.1.60657 WP_003410078.1.60687 WP_003410078.1.60689 WP_003410078.1.60727 WP_003410078.1.60738 WP_003410078.1.60763 WP_003410078.1.6077 WP_003410078.1.60791 WP_003410078.1.60834 WP_003410078.1.60870 WP_003410078.1.60878 WP_003410078.1.60879 WP_003410078.1.60913 WP_003410078.1.60978 WP_003410078.1.61000 WP_003410078.1.61001 WP_003410078.1.61012 WP_003410078.1.61014 WP_003410078.1.61015 WP_003410078.1.61037 WP_003410078.1.61100 WP_003410078.1.61101 WP_003410078.1.61138 WP_003410078.1.61142 WP_003410078.1.61198 WP_003410078.1.612 WP_003410078.1.61234 WP_003410078.1.61256 WP_003410078.1.61281 WP_003410078.1.61314 WP_003410078.1.61321 WP_003410078.1.61326 WP_003410078.1.61328 WP_003410078.1.61368 WP_003410078.1.61391 WP_003410078.1.61406 WP_003410078.1.61409 WP_003410078.1.61420 WP_003410078.1.61422 WP_003410078.1.61425 WP_003410078.1.61428 WP_003410078.1.61469 WP_003410078.1.61494 WP_003410078.1.61522 WP_003410078.1.61552 WP_003410078.1.61557 WP_003410078.1.61567 WP_003410078.1.61571 WP_003410078.1.61573 WP_003410078.1.61584 WP_003410078.1.61586 WP_003410078.1.6159 WP_003410078.1.61592 WP_003410078.1.6160 WP_003410078.1.61614 WP_003410078.1.6163 WP_003410078.1.61655 WP_003410078.1.61665 WP_003410078.1.61669 WP_003410078.1.61682 WP_003410078.1.61692 WP_003410078.1.61719 WP_003410078.1.61728 WP_003410078.1.61750 WP_003410078.1.61754 WP_003410078.1.61755 WP_003410078.1.61757 WP_003410078.1.61778 WP_003410078.1.6179 WP_003410078.1.61793 WP_003410078.1.61816 WP_003410078.1.61842 WP_003410078.1.61850 WP_003410078.1.61862 WP_003410078.1.61865 WP_003410078.1.61868 WP_003410078.1.61911 WP_003410078.1.61925 WP_003410078.1.61941 WP_003410078.1.61953 WP_003410078.1.61979 WP_003410078.1.61986 WP_003410078.1.61987 WP_003410078.1.61998 WP_003410078.1.62021 WP_003410078.1.62087 WP_003410078.1.62089 WP_003410078.1.62101 WP_003410078.1.62104 WP_003410078.1.6211 WP_003410078.1.62132 WP_003410078.1.62162 WP_003410078.1.62225 WP_003410078.1.62230 WP_003410078.1.62238 WP_003410078.1.62249 WP_003410078.1.62270 WP_003410078.1.62281 WP_003410078.1.62307 WP_003410078.1.6231 WP_003410078.1.62359 WP_003410078.1.62360 WP_003410078.1.62371 WP_003410078.1.62379 WP_003410078.1.62395 WP_003410078.1.62408 WP_003410078.1.62449 WP_003410078.1.62468 WP_003410078.1.6248 WP_003410078.1.62508 WP_003410078.1.62565 WP_003410078.1.62594 WP_003410078.1.62606 WP_003410078.1.62616 WP_003410078.1.62666 WP_003410078.1.62687 WP_003410078.1.62715 WP_003410078.1.62730 WP_003410078.1.62738 WP_003410078.1.62761 WP_003410078.1.62766 WP_003410078.1.62786 WP_003410078.1.62813 WP_003410078.1.62839 WP_003410078.1.62841 WP_003410078.1.62909 WP_003410078.1.62936 WP_003410078.1.6294 WP_003410078.1.6295 WP_003410078.1.62962 WP_003410078.1.63007 WP_003410078.1.63019 WP_003410078.1.63032 WP_003410078.1.63037 WP_003410078.1.63064 WP_003410078.1.63066 WP_003410078.1.63072 WP_003410078.1.6308 WP_003410078.1.63081 WP_003410078.1.63096 WP_003410078.1.63106 WP_003410078.1.6314 WP_003410078.1.63144 WP_003410078.1.63154 WP_003410078.1.63160 WP_003410078.1.63161 WP_003410078.1.63166 WP_003410078.1.63175 WP_003410078.1.63194 WP_003410078.1.6322 WP_003410078.1.63222 WP_003410078.1.63247 WP_003410078.1.6328 WP_003410078.1.63291 WP_003410078.1.63312 WP_003410078.1.63317 WP_003410078.1.63331 WP_003410078.1.63373 WP_003410078.1.63384 WP_003410078.1.63403 WP_003410078.1.63424 WP_003410078.1.63428 WP_003410078.1.6345 WP_003410078.1.63464 WP_003410078.1.63483 WP_003410078.1.63502 WP_003410078.1.63504 WP_003410078.1.63522 WP_003410078.1.63530 WP_003410078.1.63538 WP_003410078.1.63564 WP_003410078.1.63567 WP_003410078.1.63596 WP_003410078.1.63600 WP_003410078.1.63623 WP_003410078.1.63624 WP_003410078.1.63625 WP_003410078.1.63627 WP_003410078.1.63654 WP_003410078.1.63662 WP_003410078.1.63711 WP_003410078.1.63734 WP_003410078.1.63807 WP_003410078.1.63819 WP_003410078.1.63844 WP_003410078.1.63888 WP_003410078.1.63913 WP_003410078.1.63915 WP_003410078.1.63918 WP_003410078.1.63961 WP_003410078.1.63970 WP_003410078.1.64000 WP_003410078.1.64027 WP_003410078.1.64058 WP_003410078.1.64065 WP_003410078.1.6407 WP_003410078.1.64082 WP_003410078.1.64091 WP_003410078.1.64102 WP_003410078.1.64104 WP_003410078.1.64119 WP_003410078.1.64169 WP_003410078.1.64219 WP_003410078.1.6422 WP_003410078.1.64222 WP_003410078.1.64223 WP_003410078.1.64228 WP_003410078.1.64235 WP_003410078.1.64249 WP_003410078.1.6427 WP_003410078.1.64278 WP_003410078.1.64287 WP_003410078.1.64414 WP_003410078.1.64419 WP_003410078.1.6443 WP_003410078.1.64463 WP_003410078.1.64480 WP_003410078.1.64497 WP_003410078.1.64506 WP_003410078.1.64511 WP_003410078.1.64513 WP_003410078.1.64514 WP_003410078.1.64515 WP_003410078.1.64522 WP_003410078.1.64526 WP_003410078.1.64543 WP_003410078.1.6456 WP_003410078.1.64567 WP_003410078.1.64588 WP_003410078.1.64589 WP_003410078.1.64594 WP_003410078.1.64595 WP_003410078.1.64608 WP_003410078.1.64619 WP_003410078.1.64629 WP_003410078.1.6464 WP_003410078.1.64664 WP_003410078.1.64669 WP_003410078.1.64672 WP_003410078.1.64680 WP_003410078.1.64682 WP_003410078.1.64727 WP_003410078.1.64729 WP_003410078.1.64774 WP_003410078.1.64776 WP_003410078.1.64802 WP_003410078.1.64832 WP_003410078.1.6486 WP_003410078.1.64870 WP_003410078.1.64898 WP_003410078.1.64922 WP_003410078.1.64924 WP_003410078.1.6493 WP_003410078.1.64937 WP_003410078.1.64941 WP_003410078.1.64966 WP_003410078.1.64973 WP_003410078.1.65001 WP_003410078.1.65026 WP_003410078.1.65053 WP_003410078.1.65070 WP_003410078.1.65079 WP_003410078.1.65102 WP_003410078.1.65157 WP_003410078.1.65181 WP_003410078.1.65212 WP_003410078.1.65229 WP_003410078.1.6523 WP_003410078.1.65253 WP_003410078.1.65289 WP_003410078.1.65291 WP_003410078.1.65315 WP_003410078.1.65329 WP_003410078.1.65359 WP_003410078.1.6536 WP_003410078.1.65374 WP_003410078.1.65386 WP_003410078.1.65414 WP_003410078.1.65416 WP_003410078.1.65433 WP_003410078.1.65455 WP_003410078.1.65467 WP_003410078.1.65488 WP_003410078.1.65529 WP_003410078.1.65539 WP_003410078.1.65583 WP_003410078.1.65612 WP_003410078.1.65623 WP_003410078.1.65635 WP_003410078.1.65637 WP_003410078.1.65648 WP_003410078.1.65683 WP_003410078.1.65686 WP_003410078.1.65688 WP_003410078.1.65707 WP_003410078.1.65733 WP_003410078.1.65746 WP_003410078.1.65747 WP_003410078.1.65759 WP_003410078.1.65816 WP_003410078.1.65830 WP_003410078.1.65858 WP_003410078.1.65862 WP_003410078.1.65869 WP_003410078.1.65893 WP_003410078.1.65929 WP_003410078.1.65932 WP_003410078.1.65958 WP_003410078.1.65974 WP_003410078.1.66004 WP_003410078.1.66013 WP_003410078.1.6606 WP_003410078.1.66089 WP_003410078.1.66149 WP_003410078.1.66151 WP_003410078.1.66229 WP_003410078.1.66276 WP_003410078.1.66293 WP_003410078.1.66297 WP_003410078.1.66323 WP_003410078.1.66325 WP_003410078.1.6633 WP_003410078.1.66334 WP_003410078.1.66355 WP_003410078.1.66367 WP_003410078.1.66394 WP_003410078.1.66396 WP_003410078.1.66451 WP_003410078.1.66455 WP_003410078.1.66457 WP_003410078.1.66460 WP_003410078.1.66464 WP_003410078.1.66466 WP_003410078.1.66487 WP_003410078.1.66504 WP_003410078.1.66544 WP_003410078.1.66558 WP_003410078.1.66582 WP_003410078.1.66612 WP_003410078.1.66615 WP_003410078.1.66617 WP_003410078.1.66635 WP_003410078.1.66656 WP_003410078.1.66663 WP_003410078.1.66675 WP_003410078.1.66715 WP_003410078.1.66718 WP_003410078.1.66762 WP_003410078.1.66776 WP_003410078.1.66808 WP_003410078.1.66817 WP_003410078.1.66819 WP_003410078.1.66826 WP_003410078.1.66830 WP_003410078.1.66842 WP_003410078.1.66868 WP_003410078.1.66878 WP_003410078.1.66880 WP_003410078.1.66893 WP_003410078.1.66961 WP_003410078.1.67005 WP_003410078.1.6704 WP_003410078.1.67044 WP_003410078.1.67061 WP_003410078.1.67089 WP_003410078.1.67098 WP_003410078.1.67146 WP_003410078.1.67170 WP_003410078.1.67198 WP_003410078.1.6720 WP_003410078.1.67207 WP_003410078.1.67218 WP_003410078.1.67220 WP_003410078.1.67225 WP_003410078.1.67231 WP_003410078.1.6724 WP_003410078.1.67257 WP_003410078.1.67298 WP_003410078.1.67307 WP_003410078.1.67324 WP_003410078.1.67332 WP_003410078.1.67346 WP_003410078.1.67354 WP_003410078.1.67360 WP_003410078.1.67381 WP_003410078.1.67396 WP_003410078.1.67417 WP_003410078.1.67422 WP_003410078.1.67453 WP_003410078.1.67459 WP_003410078.1.6746 WP_003410078.1.67473 WP_003410078.1.67481 WP_003410078.1.67482 WP_003410078.1.67496 WP_003410078.1.67499 WP_003410078.1.67516 WP_003410078.1.67523 WP_003410078.1.67536 WP_003410078.1.67575 WP_003410078.1.67587 WP_003410078.1.67598 WP_003410078.1.67600 WP_003410078.1.67602 WP_003410078.1.67630 WP_003410078.1.67679 WP_003410078.1.67692 WP_003410078.1.67744 WP_003410078.1.6775 WP_003410078.1.67750 WP_003410078.1.6777 WP_003410078.1.67809 WP_003410078.1.67816 WP_003410078.1.67844 WP_003410078.1.67848 WP_003410078.1.67870 WP_003410078.1.67888 WP_003410078.1.67915 WP_003410078.1.67945 WP_003410078.1.67949 WP_003410078.1.67980 WP_003410078.1.67982 WP_003410078.1.68022 WP_003410078.1.68029 WP_003410078.1.68037 WP_003410078.1.68038 WP_003410078.1.68045 WP_003410078.1.68057 WP_003410078.1.68083 WP_003410078.1.68088 WP_003410078.1.68106 WP_003410078.1.68110 WP_003410078.1.68153 WP_003410078.1.68164 WP_003410078.1.68169 WP_003410078.1.68193 WP_003410078.1.68212 WP_003410078.1.68227 WP_003410078.1.68243 WP_003410078.1.6825 WP_003410078.1.68297 WP_003410078.1.68309 WP_003410078.1.68325 WP_003410078.1.68329 WP_003410078.1.68340 WP_003410078.1.68384 WP_003410078.1.68388 WP_003410078.1.68429 WP_003410078.1.6843 WP_003410078.1.68433 WP_003410078.1.68444 WP_003410078.1.68465 WP_003410078.1.68484 WP_003410078.1.68518 WP_003410078.1.68569 WP_003410078.1.68576 WP_003410078.1.68580 WP_003410078.1.68586 WP_003410078.1.68623 WP_003410078.1.68624 WP_003410078.1.68637 WP_003410078.1.68646 WP_003410078.1.68667 WP_003410078.1.68669 WP_003410078.1.68672 WP_003410078.1.68684 WP_003410078.1.68704 WP_003410078.1.68708 WP_003410078.1.6872 WP_003410078.1.68730 WP_003410078.1.68734 WP_003410078.1.68748 WP_003410078.1.68754 WP_003410078.1.6876 WP_003410078.1.68761 WP_003410078.1.68763 WP_003410078.1.68766 WP_003410078.1.68774 WP_003410078.1.68796 WP_003410078.1.68824 WP_003410078.1.68832 WP_003410078.1.68833 WP_003410078.1.68841 WP_003410078.1.68859 WP_003410078.1.68876 WP_003410078.1.68906 WP_003410078.1.68916 WP_003410078.1.68923 WP_003410078.1.68945 WP_003410078.1.6896 WP_003410078.1.68981 WP_003410078.1.68997 WP_003410078.1.69008 WP_003410078.1.69076 WP_003410078.1.69079 WP_003410078.1.6908 WP_003410078.1.69082 WP_003410078.1.69178 WP_003410078.1.69181 WP_003410078.1.69208 WP_003410078.1.69231 WP_003410078.1.69256 WP_003410078.1.69311 WP_003410078.1.69315 WP_003410078.1.69322 WP_003410078.1.69342 WP_003410078.1.6935 WP_003410078.1.6936 WP_003410078.1.69369 WP_003410078.1.69374 WP_003410078.1.69398 WP_003410078.1.69401 WP_003410078.1.69426 WP_003410078.1.69427 WP_003410078.1.69429 WP_003410078.1.6949 WP_003410078.1.6951 WP_003410078.1.69511 WP_003410078.1.69526 WP_003410078.1.69528 WP_003410078.1.69547 WP_003410078.1.69573 WP_003410078.1.69581 WP_003410078.1.6960 WP_003410078.1.69617 WP_003410078.1.69634 WP_003410078.1.69647 WP_003410078.1.69659 WP_003410078.1.69673 WP_003410078.1.69682 WP_003410078.1.69684 WP_003410078.1.69686 WP_003410078.1.69707 WP_003410078.1.69709 WP_003410078.1.69723 WP_003410078.1.69736 WP_003410078.1.69778 WP_003410078.1.69800 WP_003410078.1.69802 WP_003410078.1.69845 WP_003410078.1.69870 WP_003410078.1.69873 WP_003410078.1.69898 WP_003410078.1.69913 WP_003410078.1.69925 WP_003410078.1.69931 WP_003410078.1.69938 WP_003410078.1.69955 WP_003410078.1.69957 WP_003410078.1.69981 WP_003410078.1.69990 WP_003410078.1.70 WP_003410078.1.70000 WP_003410078.1.70017 WP_003410078.1.70032 WP_003410078.1.70055 WP_003410078.1.70062 WP_003410078.1.70072 WP_003410078.1.70131 WP_003410078.1.70132 WP_003410078.1.7022 WP_003410078.1.70255 WP_003410078.1.70271 WP_003410078.1.70274 WP_003410078.1.7029 WP_003410078.1.70325 WP_003410078.1.70328 WP_003410078.1.70356 WP_003410078.1.70364 WP_003410078.1.70368 WP_003410078.1.70369 WP_003410078.1.70418 WP_003410078.1.70422 WP_003410078.1.70435 WP_003410078.1.70444 WP_003410078.1.70463 WP_003410078.1.70471 WP_003410078.1.70480 WP_003410078.1.70494 WP_003410078.1.70498 WP_003410078.1.70505 WP_003410078.1.70525 WP_003410078.1.70573 WP_003410078.1.70610 WP_003410078.1.70615 WP_003410078.1.70618 WP_003410078.1.70622 WP_003410078.1.70626 WP_003410078.1.70668 WP_003410078.1.70699 WP_003410078.1.70704 WP_003410078.1.70757 WP_003410078.1.70782 WP_003410078.1.70796 WP_003410078.1.70830 WP_003410078.1.70834 WP_003410078.1.7084 WP_003410078.1.70840 WP_003410078.1.70864 WP_003410078.1.70915 WP_003410078.1.70955 WP_003410078.1.70958 WP_003410078.1.70964 WP_003410078.1.70976 WP_003410078.1.71015 WP_003410078.1.71026 WP_003410078.1.71063 WP_003410078.1.71076 WP_003410078.1.71083 WP_003410078.1.7111 WP_003410078.1.71118 WP_003410078.1.71128 WP_003410078.1.7113 WP_003410078.1.71187 WP_003410078.1.71191 WP_003410078.1.71255 WP_003410078.1.71258 WP_003410078.1.71259 WP_003410078.1.71289 WP_003410078.1.71326 WP_003410078.1.71329 WP_003410078.1.71344 WP_003410078.1.71390 WP_003410078.1.71399 WP_003410078.1.71414 WP_003410078.1.71440 WP_003410078.1.71457 WP_003410078.1.7146 WP_003410078.1.71464 WP_003410078.1.71490 WP_003410078.1.71492 WP_003410078.1.71509 WP_003410078.1.71516 WP_003410078.1.71517 WP_003410078.1.71527 WP_003410078.1.71532 WP_003410078.1.71545 WP_003410078.1.71546 WP_003410078.1.71569 WP_003410078.1.71604 WP_003410078.1.71621 WP_003410078.1.71630 WP_003410078.1.71638 WP_003410078.1.71654 WP_003410078.1.71664 WP_003410078.1.71665 WP_003410078.1.71683 WP_003410078.1.71701 WP_003410078.1.71718 WP_003410078.1.71731 WP_003410078.1.71778 WP_003410078.1.71781 WP_003410078.1.71803 WP_003410078.1.71820 WP_003410078.1.71847 WP_003410078.1.7185 WP_003410078.1.71851 WP_003410078.1.71871 WP_003410078.1.71909 WP_003410078.1.71957 WP_003410078.1.71970 WP_003410078.1.72047 WP_003410078.1.72061 WP_003410078.1.72072 WP_003410078.1.72111 WP_003410078.1.72122 WP_003410078.1.72128 WP_003410078.1.72143 WP_003410078.1.7216 WP_003410078.1.72168 WP_003410078.1.72179 WP_003410078.1.72209 WP_003410078.1.72218 WP_003410078.1.72219 WP_003410078.1.72227 WP_003410078.1.7224 WP_003410078.1.72268 WP_003410078.1.72332 WP_003410078.1.72380 WP_003410078.1.72401 WP_003410078.1.72405 WP_003410078.1.72420 WP_003410078.1.72441 WP_003410078.1.72451 WP_003410078.1.72452 WP_003410078.1.72457 WP_003410078.1.72459 WP_003410078.1.72460 WP_003410078.1.72466 WP_003410078.1.72487 WP_003410078.1.72488 WP_003410078.1.72492 WP_003410078.1.72506 WP_003410078.1.72543 WP_003410078.1.7256 WP_003410078.1.72576 WP_003410078.1.72578 WP_003410078.1.72585 WP_003410078.1.72591 WP_003410078.1.72592 WP_003410078.1.72640 WP_003410078.1.7266 WP_003410078.1.72661 WP_003410078.1.72684 WP_003410078.1.72739 WP_003410078.1.72744 WP_003410078.1.72755 WP_003410078.1.72759 WP_003410078.1.72784 WP_003410078.1.72792 WP_003410078.1.72826 WP_003410078.1.72831 WP_003410078.1.72852 WP_003410078.1.72853 WP_003410078.1.72879 WP_003410078.1.72880 WP_003410078.1.72938 WP_003410078.1.72954 WP_003410078.1.72957 WP_003410078.1.72959 WP_003410078.1.72973 WP_003410078.1.7298 WP_003410078.1.72982 WP_003410078.1.72988 WP_003410078.1.72993 WP_003410078.1.73006 WP_003410078.1.73013 WP_003410078.1.73025 WP_003410078.1.73028 WP_003410078.1.73042 WP_003410078.1.73045 WP_003410078.1.73092 WP_003410078.1.73118 WP_003410078.1.7312 WP_003410078.1.73127 WP_003410078.1.73134 WP_003410078.1.73150 WP_003410078.1.73154 WP_003410078.1.73163 WP_003410078.1.73182 WP_003410078.1.73205 WP_003410078.1.7321 WP_003410078.1.73310 WP_003410078.1.73315 WP_003410078.1.73365 WP_003410078.1.73391 WP_003410078.1.73404 WP_003410078.1.73424 WP_003410078.1.73436 WP_003410078.1.73445 WP_003410078.1.73453 WP_003410078.1.73465 WP_003410078.1.73466 WP_003410078.1.73470 WP_003410078.1.73471 WP_003410078.1.73478 WP_003410078.1.73482 WP_003410078.1.73507 WP_003410078.1.73532 WP_003410078.1.73550 WP_003410078.1.73564 WP_003410078.1.73623 WP_003410078.1.73629 WP_003410078.1.73644 WP_003410078.1.7366 WP_003410078.1.73661 WP_003410078.1.7368 WP_003410078.1.73688 WP_003410078.1.73723 WP_003410078.1.73744 WP_003410078.1.73750 WP_003410078.1.73760 WP_003410078.1.73774 WP_003410078.1.7379 WP_003410078.1.73813 WP_003410078.1.73840 WP_003410078.1.73876 WP_003410078.1.7389 WP_003410078.1.73986 WP_003410078.1.74016 WP_003410078.1.74039 WP_003410078.1.74083 WP_003410078.1.74101 WP_003410078.1.74107 WP_003410078.1.74120 WP_003410078.1.74129 WP_003410078.1.74144 WP_003410078.1.7417 WP_003410078.1.74190 WP_003410078.1.74210 WP_003410078.1.7423 WP_003410078.1.74259 WP_003410078.1.74262 WP_003410078.1.74269 WP_003410078.1.74282 WP_003410078.1.74291 WP_003410078.1.74296 WP_003410078.1.74304 WP_003410078.1.7432 WP_003410078.1.74347 WP_003410078.1.7436 WP_003410078.1.74378 WP_003410078.1.74382 WP_003410078.1.74395 WP_003410078.1.74400 WP_003410078.1.74401 WP_003410078.1.74432 WP_003410078.1.74442 WP_003410078.1.74477 WP_003410078.1.74487 WP_003410078.1.74499 WP_003410078.1.74504 WP_003410078.1.74511 WP_003410078.1.74523 WP_003410078.1.74525 WP_003410078.1.74551 WP_003410078.1.74555 WP_003410078.1.74628 WP_003410078.1.74641 WP_003410078.1.74653 WP_003410078.1.74660 WP_003410078.1.74683 WP_003410078.1.7469 WP_003410078.1.74725 WP_003410078.1.74760 WP_003410078.1.74786 WP_003410078.1.74809 WP_003410078.1.74820 WP_003410078.1.74870 WP_003410078.1.74888 WP_003410078.1.74952 WP_003410078.1.7496 WP_003410078.1.74988 WP_003410078.1.75043 WP_003410078.1.75055 WP_003410078.1.75078 WP_003410078.1.75081 WP_003410078.1.75120 WP_003410078.1.75163 WP_003410078.1.75188 WP_003410078.1.75200 WP_003410078.1.75202 WP_003410078.1.75234 WP_003410078.1.75239 WP_003410078.1.75250 WP_003410078.1.75263 WP_003410078.1.75281 WP_003410078.1.75342 WP_003410078.1.7535 WP_003410078.1.75376 WP_003410078.1.75391 WP_003410078.1.75395 WP_003410078.1.75441 WP_003410078.1.75510 WP_003410078.1.75581 WP_003410078.1.75598 WP_003410078.1.75635 WP_003410078.1.75645 WP_003410078.1.75665 WP_003410078.1.75671 WP_003410078.1.75741 WP_003410078.1.75749 WP_003410078.1.75772 WP_003410078.1.75774 WP_003410078.1.75811 WP_003410078.1.75833 WP_003410078.1.7585 WP_003410078.1.75864 WP_003410078.1.75868 WP_003410078.1.75878 WP_003410078.1.75927 WP_003410078.1.75946 WP_003410078.1.75968 WP_003410078.1.75974 WP_003410078.1.76007 WP_003410078.1.76016 WP_003410078.1.76032 WP_003410078.1.76037 WP_003410078.1.7604 WP_003410078.1.76045 WP_003410078.1.76052 WP_003410078.1.76058 WP_003410078.1.76064 WP_003410078.1.76110 WP_003410078.1.76126 WP_003410078.1.76133 WP_003410078.1.76138 WP_003410078.1.76157 WP_003410078.1.76172 WP_003410078.1.76177 WP_003410078.1.76183 WP_003410078.1.76209 WP_003410078.1.76239 WP_003410078.1.76272 WP_003410078.1.76277 WP_003410078.1.76280 WP_003410078.1.76281 WP_003410078.1.76291 WP_003410078.1.76297 WP_003410078.1.76360 WP_003410078.1.76379 WP_003410078.1.76403 WP_003410078.1.76413 WP_003410078.1.76414 WP_003410078.1.76427 WP_003410078.1.76436 WP_003410078.1.76442 WP_003410078.1.76443 WP_003410078.1.76456 WP_003410078.1.76521 WP_003410078.1.76533 WP_003410078.1.76616 WP_003410078.1.76625 WP_003410078.1.76629 WP_003410078.1.76635 WP_003410078.1.76638 WP_003410078.1.76639 WP_003410078.1.76640 WP_003410078.1.76644 WP_003410078.1.76677 WP_003410078.1.76678 WP_003410078.1.76679 WP_003410078.1.76734 WP_003410078.1.76744 WP_003410078.1.76750 WP_003410078.1.76754 WP_003410078.1.76757 WP_003410078.1.76781 WP_003410078.1.76818 WP_003410078.1.76824 WP_003410078.1.76835 WP_003410078.1.76873 WP_003410078.1.76881 WP_003410078.1.76888 WP_003410078.1.76900 WP_003410078.1.7691 WP_003410078.1.76947 WP_003410078.1.76954 WP_003410078.1.76955 WP_003410078.1.76963 WP_003410078.1.76976 WP_003410078.1.770 WP_003410078.1.77000 WP_003410078.1.77008 WP_003410078.1.77021 WP_003410078.1.77056 WP_003410078.1.77065 WP_003410078.1.77075 WP_003410078.1.77093 WP_003410078.1.77107 WP_003410078.1.77115 WP_003410078.1.77118 WP_003410078.1.77125 WP_003410078.1.77141 WP_003410078.1.77142 WP_003410078.1.77166 WP_003410078.1.77250 WP_003410078.1.77252 WP_003410078.1.77260 WP_003410078.1.77266 WP_003410078.1.77280 WP_003410078.1.77285 WP_003410078.1.77312 WP_003410078.1.77348 WP_003410078.1.77351 WP_003410078.1.77352 WP_003410078.1.77361 WP_003410078.1.774 WP_003410078.1.7740 WP_003410078.1.77404 WP_003410078.1.77425 WP_003410078.1.77463 WP_003410078.1.77474 WP_003410078.1.7748 WP_003410078.1.77491 WP_003410078.1.77499 WP_003410078.1.77510 WP_003410078.1.77530 WP_003410078.1.77554 WP_003410078.1.77559 WP_003410078.1.77599 WP_003410078.1.77605 WP_003410078.1.7762 WP_003410078.1.77627 WP_003410078.1.77649 WP_003410078.1.77654 WP_003410078.1.7766 WP_003410078.1.77667 WP_003410078.1.77704 WP_003410078.1.77706 WP_003410078.1.77726 WP_003410078.1.77774 WP_003410078.1.7778 WP_003410078.1.77790 WP_003410078.1.77809 WP_003410078.1.77820 WP_003410078.1.77843 WP_003410078.1.77855 WP_003410078.1.77865 WP_003410078.1.77868 WP_003410078.1.77879 WP_003410078.1.77890 WP_003410078.1.77909 WP_003410078.1.77911 WP_003410078.1.77931 WP_003410078.1.77984 WP_003410078.1.78020 WP_003410078.1.78024 WP_003410078.1.78075 WP_003410078.1.78084 WP_003410078.1.78086 WP_003410078.1.7809 WP_003410078.1.78098 WP_003410078.1.78105 WP_003410078.1.78113 WP_003410078.1.78136 WP_003410078.1.78162 WP_003410078.1.7817 WP_003410078.1.78200 WP_003410078.1.78216 WP_003410078.1.78236 WP_003410078.1.78238 WP_003410078.1.78322 WP_003410078.1.78338 WP_003410078.1.7836 WP_003410078.1.78360 WP_003410078.1.78386 WP_003410078.1.78429 WP_003410078.1.78435 WP_003410078.1.7844 WP_003410078.1.78459 WP_003410078.1.78488 WP_003410078.1.78499 WP_003410078.1.785 WP_003410078.1.78516 WP_003410078.1.78524 WP_003410078.1.78526 WP_003410078.1.78538 WP_003410078.1.78544 WP_003410078.1.78545 WP_003410078.1.78547 WP_003410078.1.78574 WP_003410078.1.78580 WP_003410078.1.7860 WP_003410078.1.78620 WP_003410078.1.78646 WP_003410078.1.78648 WP_003410078.1.78649 WP_003410078.1.78655 WP_003410078.1.78657 WP_003410078.1.78659 WP_003410078.1.7869 WP_003410078.1.78692 WP_003410078.1.78760 WP_003410078.1.78766 WP_003410078.1.78776 WP_003410078.1.78778 WP_003410078.1.78784 WP_003410078.1.78788 WP_003410078.1.78790 WP_003410078.1.78793 WP_003410078.1.78848 WP_003410078.1.78860 WP_003410078.1.7887 WP_003410078.1.78884 WP_003410078.1.78932 WP_003410078.1.78969 WP_003410078.1.78977 WP_003410078.1.78980 WP_003410078.1.79005 WP_003410078.1.79016 WP_003410078.1.79033 WP_003410078.1.79064 WP_003410078.1.79066 WP_003410078.1.79068 WP_003410078.1.79077 WP_003410078.1.79095 WP_003410078.1.79112 WP_003410078.1.79122 WP_003410078.1.79145 WP_003410078.1.79152 WP_003410078.1.79163 WP_003410078.1.79182 WP_003410078.1.79198 WP_003410078.1.79213 WP_003410078.1.79218 WP_003410078.1.79268 WP_003410078.1.79273 WP_003410078.1.79278 WP_003410078.1.79290 WP_003410078.1.79319 WP_003410078.1.79325 WP_003410078.1.79326 WP_003410078.1.7933 WP_003410078.1.79330 WP_003410078.1.79339 WP_003410078.1.79394 WP_003410078.1.79399 WP_003410078.1.79413 WP_003410078.1.79422 WP_003410078.1.79445 WP_003410078.1.79447 WP_003410078.1.79455 WP_003410078.1.79471 WP_003410078.1.79480 WP_003410078.1.79482 WP_003410078.1.79488 WP_003410078.1.79500 WP_003410078.1.79502 WP_003410078.1.79508 WP_003410078.1.79514 WP_003410078.1.79561 WP_003410078.1.79565 WP_003410078.1.79578 WP_003410078.1.79588 WP_003410078.1.79598 WP_003410078.1.79615 WP_003410078.1.79684 WP_003410078.1.79698 WP_003410078.1.797 WP_003410078.1.79744 WP_003410078.1.79784 WP_003410078.1.79802 WP_003410078.1.79806 WP_003410078.1.79819 WP_003410078.1.79826 WP_003410078.1.79828 WP_003410078.1.79851 WP_003410078.1.79853 WP_003410078.1.79863 WP_003410078.1.79881 WP_003410078.1.79885 WP_003410078.1.79898 WP_003410078.1.7990 WP_003410078.1.79900 WP_003410078.1.79913 WP_003410078.1.79918 WP_003410078.1.79947 WP_003410078.1.79948 WP_003410078.1.7995 WP_003410078.1.7997 WP_003410078.1.80004 WP_003410078.1.80015 WP_003410078.1.80022 WP_003410078.1.80030 WP_003410078.1.80054 WP_003410078.1.80084 WP_003410078.1.80099 WP_003410078.1.80129 WP_003410078.1.80177 WP_003410078.1.80234 WP_003410078.1.8026 WP_003410078.1.80275 WP_003410078.1.8029 WP_003410078.1.80299 WP_003410078.1.80300 WP_003410078.1.80304 WP_003410078.1.80326 WP_003410078.1.80351 WP_003410078.1.8037 WP_003410078.1.80370 WP_003410078.1.80399 WP_003410078.1.8044 WP_003410078.1.80451 WP_003410078.1.80458 WP_003410078.1.80461 WP_003410078.1.80490 WP_003410078.1.80503 WP_003410078.1.80507 WP_003410078.1.80552 WP_003410078.1.80576 WP_003410078.1.80588 WP_003410078.1.80599 WP_003410078.1.8060 WP_003410078.1.80624 WP_003410078.1.80636 WP_003410078.1.80669 WP_003410078.1.80673 WP_003410078.1.80711 WP_003410078.1.80714 WP_003410078.1.80743 WP_003410078.1.80784 WP_003410078.1.80815 WP_003410078.1.80853 WP_003410078.1.80918 WP_003410078.1.8093 WP_003410078.1.80967 WP_003410078.1.8097 WP_003410078.1.80988 WP_003410078.1.81007 WP_003410078.1.81013 WP_003410078.1.8105 WP_003410078.1.81059 WP_003410078.1.81063 WP_003410078.1.81066 WP_003410078.1.81075 WP_003410078.1.81091 WP_003410078.1.81119 WP_003410078.1.81125 WP_003410078.1.81136 WP_003410078.1.8114 WP_003410078.1.81189 WP_003410078.1.81192 WP_003410078.1.812 WP_003410078.1.81230 WP_003410078.1.81249 WP_003410078.1.81250 WP_003410078.1.81264 WP_003410078.1.8128 WP_003410078.1.81297 WP_003410078.1.8138 WP_003410078.1.81407 WP_003410078.1.8143 WP_003410078.1.81439 WP_003410078.1.81465 WP_003410078.1.81505 WP_003410078.1.81529 WP_003410078.1.81538 WP_003410078.1.81541 WP_003410078.1.81560 WP_003410078.1.81561 WP_003410078.1.81567 WP_003410078.1.81583 WP_003410078.1.81686 WP_003410078.1.81712 WP_003410078.1.81720 WP_003410078.1.81731 WP_003410078.1.81774 WP_003410078.1.81788 WP_003410078.1.81809 WP_003410078.1.81820 WP_003410078.1.81850 WP_003410078.1.81883 WP_003410078.1.81891 WP_003410078.1.81911 WP_003410078.1.81918 WP_003410078.1.82011 WP_003410078.1.82048 WP_003410078.1.82069 WP_003410078.1.82071 WP_003410078.1.82108 WP_003410078.1.82136 WP_003410078.1.82142 WP_003410078.1.8215 WP_003410078.1.82158 WP_003410078.1.8217 WP_003410078.1.82209 WP_003410078.1.82210 WP_003410078.1.82228 WP_003410078.1.82236 WP_003410078.1.82251 WP_003410078.1.82271 WP_003410078.1.82305 WP_003410078.1.82307 WP_003410078.1.82309 WP_003410078.1.82317 WP_003410078.1.8232 WP_003410078.1.82346 WP_003410078.1.82374 WP_003410078.1.82385 WP_003410078.1.82429 WP_003410078.1.82460 WP_003410078.1.82462 WP_003410078.1.82483 WP_003410078.1.82494 WP_003410078.1.82531 WP_003410078.1.82546 WP_003410078.1.82547 WP_003410078.1.82549 WP_003410078.1.82577 WP_003410078.1.82592 WP_003410078.1.82597 WP_003410078.1.82598 WP_003410078.1.82625 WP_003410078.1.82642 WP_003410078.1.82653 WP_003410078.1.82681 WP_003410078.1.82685 WP_003410078.1.8271 WP_003410078.1.82712 WP_003410078.1.8273 WP_003410078.1.82743 WP_003410078.1.82757 WP_003410078.1.82774 WP_003410078.1.82803 WP_003410078.1.82860 WP_003410078.1.82871 WP_003410078.1.82892 WP_003410078.1.82935 WP_003410078.1.82957 WP_003410078.1.82973 WP_003410078.1.82981 WP_003410078.1.82983 WP_003410078.1.83004 WP_003410078.1.83009 WP_003410078.1.83044 WP_003410078.1.83065 WP_003410078.1.83074 WP_003410078.1.83110 WP_003410078.1.83146 WP_003410078.1.83149 WP_003410078.1.83159 WP_003410078.1.8317 WP_003410078.1.83173 WP_003410078.1.83181 WP_003410078.1.83182 WP_003410078.1.83191 WP_003410078.1.83197 WP_003410078.1.83212 WP_003410078.1.8326 WP_003410078.1.83262 WP_003410078.1.83268 WP_003410078.1.83273 WP_003410078.1.83309 WP_003410078.1.83332 WP_003410078.1.83334 WP_003410078.1.83341 WP_003410078.1.83349 WP_003410078.1.8335 WP_003410078.1.83353 WP_003410078.1.83367 WP_003410078.1.83380 WP_003410078.1.83381 WP_003410078.1.83389 WP_003410078.1.83408 WP_003410078.1.83409 WP_003410078.1.83435 WP_003410078.1.83470 WP_003410078.1.83524 WP_003410078.1.83526 WP_003410078.1.8358 WP_003410078.1.83589 WP_003410078.1.83601 WP_003410078.1.83611 WP_003410078.1.83638 WP_003410078.1.83648 WP_003410078.1.83656 WP_003410078.1.83667 WP_003410078.1.83689 WP_003410078.1.83692 WP_003410078.1.83704 WP_003410078.1.83705 WP_003410078.1.83766 WP_003410078.1.83793 WP_003410078.1.83794 WP_003410078.1.83802 WP_003410078.1.83805 WP_003410078.1.83839 WP_003410078.1.83842 WP_003410078.1.83850 WP_003410078.1.83861 WP_003410078.1.83884 WP_003410078.1.83920 WP_003410078.1.83929 WP_003410078.1.83930 WP_003410078.1.83975 WP_003410078.1.83991 WP_003410078.1.8400 WP_003410078.1.84027 WP_003410078.1.8404 WP_003410078.1.84057 WP_003410078.1.84070 WP_003410078.1.8409 WP_003410078.1.84112 WP_003410078.1.84146 WP_003410078.1.8415 WP_003410078.1.84176 WP_003410078.1.84186 WP_003410078.1.84192 WP_003410078.1.84228 WP_003410078.1.8424 WP_003410078.1.84244 WP_003410078.1.84259 WP_003410078.1.8426 WP_003410078.1.84277 WP_003410078.1.84287 WP_003410078.1.8434 WP_003410078.1.84388 WP_003410078.1.84408 WP_003410078.1.84409 WP_003410078.1.84438 WP_003410078.1.84460 WP_003410078.1.84488 WP_003410078.1.84504 WP_003410078.1.84525 WP_003410078.1.84620 WP_003410078.1.84623 WP_003410078.1.84641 WP_003410078.1.84655 WP_003410078.1.84666 WP_003410078.1.84670 WP_003410078.1.84739 WP_003410078.1.84748 WP_003410078.1.84766 WP_003410078.1.84772 WP_003410078.1.84774 WP_003410078.1.848 WP_003410078.1.84812 WP_003410078.1.84836 WP_003410078.1.84839 WP_003410078.1.84846 WP_003410078.1.84873 WP_003410078.1.84911 WP_003410078.1.84938 WP_003410078.1.84968 WP_003410078.1.84973 WP_003410078.1.84981 WP_003410078.1.84985 WP_003410078.1.8503 WP_003410078.1.85041 WP_003410078.1.85043 WP_003410078.1.8505 WP_003410078.1.85074 WP_003410078.1.8509 WP_003410078.1.8512 WP_003410078.1.85148 WP_003410078.1.8518 WP_003410078.1.8522 WP_003410078.1.85276 WP_003410078.1.85281 WP_003410078.1.85284 WP_003410078.1.85314 WP_003410078.1.85319 WP_003410078.1.85330 WP_003410078.1.85341 WP_003410078.1.85346 WP_003410078.1.8535 WP_003410078.1.85363 WP_003410078.1.85371 WP_003410078.1.85377 WP_003410078.1.85387 WP_003410078.1.85399 WP_003410078.1.85458 WP_003410078.1.8546 WP_003410078.1.85478 WP_003410078.1.85480 WP_003410078.1.85488 WP_003410078.1.85495 WP_003410078.1.85551 WP_003410078.1.85557 WP_003410078.1.85577 WP_003410078.1.85597 WP_003410078.1.85599 WP_003410078.1.85610 WP_003410078.1.8563 WP_003410078.1.85648 WP_003410078.1.85679 WP_003410078.1.85704 WP_003410078.1.85727 WP_003410078.1.85737 WP_003410078.1.85763 WP_003410078.1.85808 WP_003410078.1.85819 WP_003410078.1.85820 WP_003410078.1.85823 WP_003410078.1.85832 WP_003410078.1.8586 WP_003410078.1.85872 WP_003410078.1.85894 WP_003410078.1.85909 WP_003410078.1.85913 WP_003410078.1.85953 WP_003410078.1.85986 WP_003410078.1.86000 WP_003410078.1.86024 WP_003410078.1.86025 WP_003410078.1.86032 WP_003410078.1.86048 WP_003410078.1.86052 WP_003410078.1.86067 WP_003410078.1.86103 WP_003410078.1.86122 WP_003410078.1.86124 WP_003410078.1.86160 WP_003410078.1.86168 WP_003410078.1.86190 WP_003410078.1.86204 WP_003410078.1.86208 WP_003410078.1.86235 WP_003410078.1.86249 WP_003410078.1.86260 WP_003410078.1.86290 WP_003410078.1.863 WP_003410078.1.86327 WP_003410078.1.86334 WP_003410078.1.86337 WP_003410078.1.86368 WP_003410078.1.86377 WP_003410078.1.86425 WP_003410078.1.86459 WP_003410078.1.8649 WP_003410078.1.86499 WP_003410078.1.86520 WP_003410078.1.86561 WP_003410078.1.86568 WP_003410078.1.86575 WP_003410078.1.86584 WP_003410078.1.86605 WP_003410078.1.86626 WP_003410078.1.86648 WP_003410078.1.8666 WP_003410078.1.86684 WP_003410078.1.86696 WP_003410078.1.86705 WP_003410078.1.86718 WP_003410078.1.86725 WP_003410078.1.86757 WP_003410078.1.86766 WP_003410078.1.86801 WP_003410078.1.86814 WP_003410078.1.86820 WP_003410078.1.86825 WP_003410078.1.86834 WP_003410078.1.8685 WP_003410078.1.86851 WP_003410078.1.86855 WP_003410078.1.86867 WP_003410078.1.86877 WP_003410078.1.86883 WP_003410078.1.8689 WP_003410078.1.86892 WP_003410078.1.86933 WP_003410078.1.86941 WP_003410078.1.86950 WP_003410078.1.86962 WP_003410078.1.86963 WP_003410078.1.86979 WP_003410078.1.8700 WP_003410078.1.87001 WP_003410078.1.87002 WP_003410078.1.87031 WP_003410078.1.87116 WP_003410078.1.87117 WP_003410078.1.8714 WP_003410078.1.87162 WP_003410078.1.87178 WP_003410078.1.87191 WP_003410078.1.87201 WP_003410078.1.87209 WP_003410078.1.87240 WP_003410078.1.87266 WP_003410078.1.87273 WP_003410078.1.87275 WP_003410078.1.8733 WP_003410078.1.87345 WP_003410078.1.87369 WP_003410078.1.8737 WP_003410078.1.87401 WP_003410078.1.87404 WP_003410078.1.87406 WP_003410078.1.87409 WP_003410078.1.87444 WP_003410078.1.87446 WP_003410078.1.87459 WP_003410078.1.87472 WP_003410078.1.87489 WP_003410078.1.87494 WP_003410078.1.87496 WP_003410078.1.87582 WP_003410078.1.87588 WP_003410078.1.87617 WP_003410078.1.87619 WP_003410078.1.87620 WP_003410078.1.87634 WP_003410078.1.87643 WP_003410078.1.8765 WP_003410078.1.87650 WP_003410078.1.87654 WP_003410078.1.87658 WP_003410078.1.87665 WP_003410078.1.87676 WP_003410078.1.87677 WP_003410078.1.87684 WP_003410078.1.87692 WP_003410078.1.87707 WP_003410078.1.87732 WP_003410078.1.87784 WP_003410078.1.87796 WP_003410078.1.87809 WP_003410078.1.87817 WP_003410078.1.87827 WP_003410078.1.87831 WP_003410078.1.87835 WP_003410078.1.87837 WP_003410078.1.87866 WP_003410078.1.8789 WP_003410078.1.87911 WP_003410078.1.87924 WP_003410078.1.87951 WP_003410078.1.87956 WP_003410078.1.87991 WP_003410078.1.88 WP_003410078.1.88002 WP_003410078.1.88037 WP_003410078.1.88039 WP_003410078.1.88072 WP_003410078.1.88077 WP_003410078.1.88121 WP_003410078.1.88180 WP_003410078.1.88191 WP_003410078.1.88205 WP_003410078.1.88217 WP_003410078.1.88219 WP_003410078.1.88245 WP_003410078.1.88253 WP_003410078.1.88294 WP_003410078.1.88315 WP_003410078.1.88316 WP_003410078.1.88320 WP_003410078.1.88338 WP_003410078.1.8840 WP_003410078.1.88437 WP_003410078.1.88453 WP_003410078.1.88469 WP_003410078.1.88489 WP_003410078.1.88507 WP_003410078.1.88521 WP_003410078.1.88530 WP_003410078.1.88537 WP_003410078.1.88541 WP_003410078.1.88592 WP_003410078.1.88616 WP_003410078.1.88618 WP_003410078.1.8862 WP_003410078.1.88625 WP_003410078.1.88632 WP_003410078.1.88634 WP_003410078.1.88649 WP_003410078.1.8870 WP_003410078.1.88737 WP_003410078.1.88756 WP_003410078.1.888 WP_003410078.1.88824 WP_003410078.1.88886 WP_003410078.1.88965 WP_003410078.1.8902 WP_003410078.1.89025 WP_003410078.1.89041 WP_003410078.1.89046 WP_003410078.1.89082 WP_003410078.1.89162 WP_003410078.1.89168 WP_003410078.1.8917 WP_003410078.1.89193 WP_003410078.1.89205 WP_003410078.1.89207 WP_003410078.1.89225 WP_003410078.1.8925 WP_003410078.1.89277 WP_003410078.1.89286 WP_003410078.1.89293 WP_003410078.1.89320 WP_003410078.1.8935 WP_003410078.1.89371 WP_003410078.1.89378 WP_003410078.1.89392 WP_003410078.1.89406 WP_003410078.1.8943 WP_003410078.1.89451 WP_003410078.1.89453 WP_003410078.1.89473 WP_003410078.1.89475 WP_003410078.1.89483 WP_003410078.1.895 WP_003410078.1.89513 WP_003410078.1.89517 WP_003410078.1.89522 WP_003410078.1.8954 WP_003410078.1.89543 WP_003410078.1.89567 WP_003410078.1.8957 WP_003410078.1.89572 WP_003410078.1.89589 WP_003410078.1.89607 WP_003410078.1.89613 WP_003410078.1.89625 WP_003410078.1.89648 WP_003410078.1.8967 WP_003410078.1.89670 WP_003410078.1.89676 WP_003410078.1.89729 WP_003410078.1.89739 WP_003410078.1.89762 WP_003410078.1.8977 WP_003410078.1.89802 WP_003410078.1.89808 WP_003410078.1.8982 WP_003410078.1.89829 WP_003410078.1.89831 WP_003410078.1.89844 WP_003410078.1.89849 WP_003410078.1.8989 WP_003410078.1.89901 WP_003410078.1.89903 WP_003410078.1.89909 WP_003410078.1.8992 WP_003410078.1.89922 WP_003410078.1.89926 WP_003410078.1.89963 WP_003410078.1.89971 WP_003410078.1.8998 WP_003410078.1.89987 WP_003410078.1.900 WP_003410078.1.90048 WP_003410078.1.9007 WP_003410078.1.90130 WP_003410078.1.90134 WP_003410078.1.90137 WP_003410078.1.90157 WP_003410078.1.90184 WP_003410078.1.90199 WP_003410078.1.90231 WP_003410078.1.90245 WP_003410078.1.90308 WP_003410078.1.90322 WP_003410078.1.90328 WP_003410078.1.90372 WP_003410078.1.90439 WP_003410078.1.90499 WP_003410078.1.9050 WP_003410078.1.90527 WP_003410078.1.90550 WP_003410078.1.90560 WP_003410078.1.90612 WP_003410078.1.90640 WP_003410078.1.90672 WP_003410078.1.90687 WP_003410078.1.90691 WP_003410078.1.90711 WP_003410078.1.90722 WP_003410078.1.90744 WP_003410078.1.9075 WP_003410078.1.90756 WP_003410078.1.90767 WP_003410078.1.90771 WP_003410078.1.90785 WP_003410078.1.90788 WP_003410078.1.90800 WP_003410078.1.90810 WP_003410078.1.90816 WP_003410078.1.90819 WP_003410078.1.9082 WP_003410078.1.90831 WP_003410078.1.90884 WP_003410078.1.90899 WP_003410078.1.90906 WP_003410078.1.90958 WP_003410078.1.90976 WP_003410078.1.90977 WP_003410078.1.90987 WP_003410078.1.9102 WP_003410078.1.91026 WP_003410078.1.91032 WP_003410078.1.91043 WP_003410078.1.91053 WP_003410078.1.91082 WP_003410078.1.91106 WP_003410078.1.91112 WP_003410078.1.91144 WP_003410078.1.91151 WP_003410078.1.91157 WP_003410078.1.91167 WP_003410078.1.91169 WP_003410078.1.91192 WP_003410078.1.91201 WP_003410078.1.91207 WP_003410078.1.91208 WP_003410078.1.91211 WP_003410078.1.91214 WP_003410078.1.91230 WP_003410078.1.91244 WP_003410078.1.91251 WP_003410078.1.91260 WP_003410078.1.91265 WP_003410078.1.9128 WP_003410078.1.91284 WP_003410078.1.91294 WP_003410078.1.91303 WP_003410078.1.91322 WP_003410078.1.91352 WP_003410078.1.91386 WP_003410078.1.9139 WP_003410078.1.91411 WP_003410078.1.91430 WP_003410078.1.91436 WP_003410078.1.91483 WP_003410078.1.91496 WP_003410078.1.91507 WP_003410078.1.91508 WP_003410078.1.91576 WP_003410078.1.91589 WP_003410078.1.91694 WP_003410078.1.91695 WP_003410078.1.91713 WP_003410078.1.91716 WP_003410078.1.91717 WP_003410078.1.91728 WP_003410078.1.91743 WP_003410078.1.91759 WP_003410078.1.91784 WP_003410078.1.91785 WP_003410078.1.91786 WP_003410078.1.91802 WP_003410078.1.91822 WP_003410078.1.91828 WP_003410078.1.9189 WP_003410078.1.91896 WP_003410078.1.9190 WP_003410078.1.91915 WP_003410078.1.91931 WP_003410078.1.91937 WP_003410078.1.91944 WP_003410078.1.91953 WP_003410078.1.91957 WP_003410078.1.91976 WP_003410078.1.91978 WP_003410078.1.92021 WP_003410078.1.92083 WP_003410078.1.92127 WP_003410078.1.92144 WP_003410078.1.92150 WP_003410078.1.92153 WP_003410078.1.92190 WP_003410078.1.92192 WP_003410078.1.92200 WP_003410078.1.92220 WP_003410078.1.92221 WP_003410078.1.92222 WP_003410078.1.92273 WP_003410078.1.92289 WP_003410078.1.9229 WP_003410078.1.92294 WP_003410078.1.92300 WP_003410078.1.92334 WP_003410078.1.92338 WP_003410078.1.92345 WP_003410078.1.92356 WP_003410078.1.92364 WP_003410078.1.92380 WP_003410078.1.92416 WP_003410078.1.92447 WP_003410078.1.92456 WP_003410078.1.92467 WP_003410078.1.92471 WP_003410078.1.92490 WP_003410078.1.92508 WP_003410078.1.9251 WP_003410078.1.92511 WP_003410078.1.92523 WP_003410078.1.92527 WP_003410078.1.92536 WP_003410078.1.92592 WP_003410078.1.92597 WP_003410078.1.92603 WP_003410078.1.92606 WP_003410078.1.92610 WP_003410078.1.92613 WP_003410078.1.9263 WP_003410078.1.9265 WP_003410078.1.92660 WP_003410078.1.92677 WP_003410078.1.92685 WP_003410078.1.92689 WP_003410078.1.92690 WP_003410078.1.92714 WP_003410078.1.92736 WP_003410078.1.9274 WP_003410078.1.92752 WP_003410078.1.92760 WP_003410078.1.92777 WP_003410078.1.92803 WP_003410078.1.92833 WP_003410078.1.92856 WP_003410078.1.92881 WP_003410078.1.92892 WP_003410078.1.92907 WP_003410078.1.92908 WP_003410078.1.9291 WP_003410078.1.92917 WP_003410078.1.92996 WP_003410078.1.93006 WP_003410078.1.93008 WP_003410078.1.93009 WP_003410078.1.93015 WP_003410078.1.93043 WP_003410078.1.9307 WP_003410078.1.93083 WP_003410078.1.93097 WP_003410078.1.93137 WP_003410078.1.93192 WP_003410078.1.93199 WP_003410078.1.93203 WP_003410078.1.93212 WP_003410078.1.93234 WP_003410078.1.93245 WP_003410078.1.93257 WP_003410078.1.93265 WP_003410078.1.93297 WP_003410078.1.93320 WP_003410078.1.93328 WP_003410078.1.93337 WP_003410078.1.93343 WP_003410078.1.93349 WP_003410078.1.93363 WP_003410078.1.93377 WP_003410078.1.9338 WP_003410078.1.93407 WP_003410078.1.93417 WP_003410078.1.93419 WP_003410078.1.93426 WP_003410078.1.9344 WP_003410078.1.93443 WP_003410078.1.93447 WP_003410078.1.93470 WP_003410078.1.93483 WP_003410078.1.93487 WP_003410078.1.93495 WP_003410078.1.93499 WP_003410078.1.93516 WP_003410078.1.93536 WP_003410078.1.93544 WP_003410078.1.93555 WP_003410078.1.93560 WP_003410078.1.93564 WP_003410078.1.9357 WP_003410078.1.93573 WP_003410078.1.93576 WP_003410078.1.93588 WP_003410078.1.9363 WP_003410078.1.93645 WP_003410078.1.93649 WP_003410078.1.93659 WP_003410078.1.93677 WP_003410078.1.9368 WP_003410078.1.93689 WP_003410078.1.93693 WP_003410078.1.93698 WP_003410078.1.93706 WP_003410078.1.9371 WP_003410078.1.93792 WP_003410078.1.93823 WP_003410078.1.93871 WP_003410078.1.9388 WP_003410078.1.93894 WP_003410078.1.93903 WP_003410078.1.93907 WP_003410078.1.93913 WP_003410078.1.93946 WP_003410078.1.93950 WP_003410078.1.93953 WP_003410078.1.93954 WP_003410078.1.93988 WP_003410078.1.9407 WP_003410078.1.94143 WP_003410078.1.94154 WP_003410078.1.94184 WP_003410078.1.94204 WP_003410078.1.94205 WP_003410078.1.94226 WP_003410078.1.94231 WP_003410078.1.94256 WP_003410078.1.94261 WP_003410078.1.94281 WP_003410078.1.94292 WP_003410078.1.94297 WP_003410078.1.9431 WP_003410078.1.94326 WP_003410078.1.94339 WP_003410078.1.94416 WP_003410078.1.94421 WP_003410078.1.94456 WP_003410078.1.94470 WP_003410078.1.94480 WP_003410078.1.94495 WP_003410078.1.94511 WP_003410078.1.94512 WP_003410078.1.94525 WP_003410078.1.94528 WP_003410078.1.94564 WP_003410078.1.946 WP_003410078.1.94602 WP_003410078.1.94623 WP_003410078.1.94629 WP_003410078.1.9465 WP_003410078.1.94673 WP_003410078.1.94714 WP_003410078.1.94730 WP_003410078.1.94736 WP_003410078.1.94776 WP_003410078.1.9478 WP_003410078.1.94834 WP_003410078.1.94852 WP_003410078.1.94872 WP_003410078.1.9488 WP_003410078.1.94902 WP_003410078.1.94916 WP_003410078.1.94979 WP_003410078.1.94994 WP_003410078.1.94996 WP_003410078.1.94998 WP_003410078.1.95007 WP_003410078.1.95010 WP_003410078.1.95015 WP_003410078.1.95034 WP_003410078.1.95068 WP_003410078.1.95081 WP_003410078.1.95082 WP_003410078.1.9509 WP_003410078.1.95096 WP_003410078.1.95112 WP_003410078.1.95138 WP_003410078.1.9514 WP_003410078.1.95179 WP_003410078.1.95188 WP_003410078.1.95190 WP_003410078.1.95234 WP_003410078.1.95241 WP_003410078.1.95245 WP_003410078.1.95257 WP_003410078.1.95279 WP_003410078.1.9531 WP_003410078.1.95335 WP_003410078.1.95344 WP_003410078.1.9535 WP_003410078.1.95370 WP_003410078.1.95392 WP_003410078.1.95416 WP_003410078.1.95417 WP_003410078.1.95454 WP_003410078.1.95491 WP_003410078.1.95497 WP_003410078.1.95508 WP_003410078.1.95509 WP_003410078.1.95529 WP_003410078.1.95556 WP_003410078.1.95557 WP_003410078.1.95565 WP_003410078.1.95578 WP_003410078.1.95580 WP_003410078.1.95585 WP_003410078.1.95643 WP_003410078.1.95679 WP_003410078.1.95685 WP_003410078.1.957 WP_003410078.1.95724 WP_003410078.1.95727 WP_003410078.1.95730 WP_003410078.1.95735 WP_003410078.1.95758 WP_003410078.1.95772 WP_003410078.1.95797 WP_003410078.1.9585 WP_003410078.1.9590 WP_003410078.1.95902 WP_003410078.1.95908 WP_003410078.1.95924 WP_003410078.1.95926 WP_003410078.1.95953 WP_003410078.1.95958 WP_003410078.1.95964 WP_003410078.1.95973 WP_003410078.1.96006 WP_003410078.1.9602 WP_003410078.1.96036 WP_003410078.1.96062 WP_003410078.1.96065 WP_003410078.1.96098 WP_003410078.1.96146 WP_003410078.1.96166 WP_003410078.1.96171 WP_003410078.1.96182 WP_003410078.1.96204 WP_003410078.1.96230 WP_003410078.1.96235 WP_003410078.1.96242 WP_003410078.1.96245 WP_003410078.1.96254 WP_003410078.1.96259 WP_003410078.1.96286 WP_003410078.1.96313 WP_003410078.1.96318 WP_003410078.1.96345 WP_003410078.1.96360 WP_003410078.1.96373 WP_003410078.1.96456 WP_003410078.1.96486 WP_003410078.1.96560 WP_003410078.1.96569 WP_003410078.1.96573 WP_003410078.1.96575 WP_003410078.1.96576 WP_003410078.1.96611 WP_003410078.1.96621 WP_003410078.1.9667 WP_003410078.1.96681 WP_003410078.1.96726 WP_003410078.1.96733 WP_003410078.1.96742 WP_003410078.1.96754 WP_003410078.1.9678 WP_003410078.1.96832 WP_003410078.1.9685 WP_003410078.1.97008 WP_003410078.1.97009 WP_003410078.1.97056 WP_003410078.1.97084 WP_003410078.1.97087 WP_003410078.1.97094 WP_003410078.1.97096 WP_003410078.1.97099 WP_003410078.1.97108 WP_003410078.1.97113 WP_003410078.1.97122 WP_003410078.1.97127 WP_003410078.1.97129 WP_003410078.1.97136 WP_003410078.1.9716 WP_003410078.1.97176 WP_003410078.1.97222 WP_003410078.1.97223 WP_003410078.1.97237 WP_003410078.1.97242 WP_003410078.1.97270 WP_003410078.1.97283 WP_003410078.1.97296 WP_003410078.1.97321 WP_003410078.1.97325 WP_003410078.1.97330 WP_003410078.1.97366 WP_003410078.1.97376 WP_003410078.1.97380 WP_003410078.1.9739 WP_003410078.1.97462 WP_003410078.1.97517 WP_003410078.1.97519 WP_003410078.1.97535 WP_003410078.1.97540 WP_003410078.1.97545 WP_003410078.1.97546 WP_003410078.1.97550 WP_003410078.1.97568 WP_003410078.1.97577 WP_003410078.1.97584 WP_003410078.1.9759 WP_003410078.1.97591 WP_003410078.1.97596 WP_003410078.1.97609 WP_003410078.1.97618 WP_003410078.1.9763 WP_003410078.1.97669 WP_003410078.1.97673 WP_003410078.1.97700 WP_003410078.1.97701 WP_003410078.1.9773 WP_003410078.1.97730 WP_003410078.1.97740 WP_003410078.1.97751 WP_003410078.1.97754 WP_003410078.1.97797 WP_003410078.1.9782 WP_003410078.1.9784 WP_003410078.1.97888 WP_003410078.1.9790 WP_003410078.1.9795 WP_003410078.1.97951 WP_003410078.1.97958 WP_003410078.1.97966 WP_003410078.1.97977 WP_003410078.1.97979 WP_003410078.1.97995 WP_003410078.1.98018 WP_003410078.1.98034 WP_003410078.1.98052 WP_003410078.1.98071 WP_003410078.1.98072 WP_003410078.1.98113 WP_003410078.1.98114 WP_003410078.1.98128 WP_003410078.1.98181 WP_003410078.1.98188 WP_003410078.1.98189 WP_003410078.1.98213 WP_003410078.1.98225 WP_003410078.1.98291 WP_003410078.1.98335 WP_003410078.1.98350 WP_003410078.1.98395 WP_003410078.1.98412 WP_003410078.1.98441 WP_003410078.1.98443 WP_003410078.1.98462 WP_003410078.1.9848 WP_003410078.1.98482 WP_003410078.1.98486 WP_003410078.1.98488 WP_003410078.1.98503 WP_003410078.1.98516 WP_003410078.1.98524 WP_003410078.1.98536 WP_003410078.1.98541 WP_003410078.1.98566 WP_003410078.1.98576 WP_003410078.1.98590 WP_003410078.1.98594 WP_003410078.1.98599 WP_003410078.1.98629 WP_003410078.1.98645 WP_003410078.1.98646 WP_003410078.1.98649 WP_003410078.1.98656 WP_003410078.1.9867 WP_003410078.1.98674 WP_003410078.1.98697 WP_003410078.1.98701 WP_003410078.1.98739 WP_003410078.1.98749 WP_003410078.1.98765 WP_003410078.1.98770 WP_003410078.1.98777 WP_003410078.1.98778 WP_003410078.1.98802 WP_003410078.1.98838 WP_003410078.1.98850 WP_003410078.1.98906 WP_003410078.1.98935 WP_003410078.1.98948 WP_003410078.1.98953 WP_003410078.1.98984 WP_003410078.1.99000 WP_003410078.1.99023 WP_003410078.1.99030 WP_003410078.1.99037 WP_003410078.1.99055 WP_003410078.1.99062 WP_003410078.1.99086 WP_003410078.1.99115 WP_003410078.1.99117 WP_003410078.1.99161 WP_003410078.1.99176 WP_003410078.1.99205 WP_003410078.1.99211 WP_003410078.1.99216 WP_003410078.1.99222 WP_003410078.1.99251 WP_003410078.1.99269 WP_003410078.1.99294 WP_003410078.1.99312 WP_003410078.1.99315 WP_003410078.1.99316 WP_003410078.1.99322 WP_003410078.1.99328 WP_003410078.1.99365 WP_003410078.1.99368 WP_003410078.1.99379 WP_003410078.1.99396 WP_003410078.1.99402 WP_003410078.1.99404 WP_003410078.1.99419 WP_003410078.1.99438 WP_003410078.1.99460 WP_003410078.1.99468 WP_003410078.1.99473 WP_003410078.1.99513 WP_003410078.1.99529 WP_003410078.1.99548 WP_003410078.1.99572 WP_003410078.1.99575 WP_003410078.1.99578 WP_003410078.1.99605 WP_003410078.1.99609 WP_003410078.1.99617 WP_003410078.1.99635 WP_003410078.1.99650 WP_003410078.1.99672 WP_003410078.1.99701 WP_003410078.1.99711 WP_003410078.1.99716 WP_003410078.1.99740 WP_003410078.1.99745 WP_003410078.1.99749 WP_003410078.1.9976 WP_003410078.1.99798 WP_003410078.1.99817 WP_003410078.1.99832 WP_003410078.1.99847 WP_003410078.1.99852 WP_003410078.1.99886 WP_003410078.1.99897 WP_003410078.1.99899 WP_003410078.1.99915 WP_003410078.1.9993 WP_003410078.1.99982 WP_003410078.1.99991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]