SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740952|ref|YP_002162266.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740952|ref|YP_002162266.1|
Domain Number 1 Region: 38-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.01e-23
Family ArsR-like transcriptional regulators 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197740952|ref|YP_002162266.1|
Sequence length 135
Comment transcriptional regulator SmtB [Mycobacterium tuberculosis str. Haarlem]
Sequence
MVTSPSTPTAAHEDVGADEVGGHQHPADRFAECPTFPAPPPREILDAAGELLRALAAPVR
IAIVLQLRESQRCVHELVDALHVPQPLVSQHLKILKAAGVVTGERSGREVLYRLADHHLA
HIVLDAVAHAGEDAI
Download sequence
Identical sequences A0A045HCD2 A0A083W5L1 A0A0H3LFL7 A0A0H3M644 A0A0K2HXY7 A0A120IXH3 A0A120J1V6 A0A197IW13 A0A1R3Y102 A0A1S1BGF2 A5U551 F8M1E7 G0TP41 I6X407 M8CL22 P9WMI4 P9WMI5 R4M7Y9
gi|375295827|ref|YP_005100094.1| gi|525674940|ref|YP_008226450.1| gi|385991686|ref|YP_005909984.1| gi|494700793|ref|YP_007966275.1| gi|494696737|ref|YP_007962240.1| gi|383308150|ref|YP_005360961.1| 233413.Mb2379 336982.TBFG_12384 410289.BCG_2372 419947.MRA_2382 478434.TBMG_01617 561275.JTY_2366 83331.MT2427 83332.Rv2358 gi|15609495|ref|NP_216874.1| gi|378772088|ref|YP_005171821.1| gi|340627369|ref|YP_004745821.1| gi|224990731|ref|YP_002645418.1| gi|339632384|ref|YP_004724026.1| gi|31793535|ref|NP_856028.1| gi|148823561|ref|YP_001288315.1| gi|479056320|ref|YP_007352126.1| gi|197740952|ref|YP_002162266.1| gi|253798564|ref|YP_003031565.1| gi|506926883|ref|YP_008007333.1| gi|471338344|ref|YP_007611057.1| gi|386005277|ref|YP_005923556.1| gi|15609495|ref|NP_216874.1| gi|433642553|ref|YP_007288312.1| gi|433635440|ref|YP_007269067.1| gi|433631474|ref|YP_007265102.1| gi|392432034|ref|YP_006473078.1| NP_216874.1.84033 WP_003412205.1.100000 WP_003412205.1.100021 WP_003412205.1.100069 WP_003412205.1.100087 WP_003412205.1.10015 WP_003412205.1.100208 WP_003412205.1.100216 WP_003412205.1.10022 WP_003412205.1.100255 WP_003412205.1.100260 WP_003412205.1.100270 WP_003412205.1.100279 WP_003412205.1.100286 WP_003412205.1.100308 WP_003412205.1.100309 WP_003412205.1.100318 WP_003412205.1.100337 WP_003412205.1.100338 WP_003412205.1.10037 WP_003412205.1.100383 WP_003412205.1.100395 WP_003412205.1.100396 WP_003412205.1.1004 WP_003412205.1.100401 WP_003412205.1.100459 WP_003412205.1.100460 WP_003412205.1.100552 WP_003412205.1.100581 WP_003412205.1.100600 WP_003412205.1.100625 WP_003412205.1.10064 WP_003412205.1.100666 WP_003412205.1.100671 WP_003412205.1.100677 WP_003412205.1.100682 WP_003412205.1.100697 WP_003412205.1.100703 WP_003412205.1.100716 WP_003412205.1.100722 WP_003412205.1.100754 WP_003412205.1.100757 WP_003412205.1.100772 WP_003412205.1.1008 WP_003412205.1.100812 WP_003412205.1.100845 WP_003412205.1.100866 WP_003412205.1.10088 WP_003412205.1.100889 WP_003412205.1.10090 WP_003412205.1.100910 WP_003412205.1.100915 WP_003412205.1.100918 WP_003412205.1.100935 WP_003412205.1.100984 WP_003412205.1.100992 WP_003412205.1.100998 WP_003412205.1.101 WP_003412205.1.101025 WP_003412205.1.101028 WP_003412205.1.10104 WP_003412205.1.101048 WP_003412205.1.101054 WP_003412205.1.101075 WP_003412205.1.101143 WP_003412205.1.101146 WP_003412205.1.10116 WP_003412205.1.10117 WP_003412205.1.101209 WP_003412205.1.10125 WP_003412205.1.101290 WP_003412205.1.101323 WP_003412205.1.101324 WP_003412205.1.101350 WP_003412205.1.101367 WP_003412205.1.101398 WP_003412205.1.101403 WP_003412205.1.101421 WP_003412205.1.10144 WP_003412205.1.101442 WP_003412205.1.10145 WP_003412205.1.101452 WP_003412205.1.101456 WP_003412205.1.101481 WP_003412205.1.101493 WP_003412205.1.101496 WP_003412205.1.101525 WP_003412205.1.101533 WP_003412205.1.101535 WP_003412205.1.101553 WP_003412205.1.101558 WP_003412205.1.10156 WP_003412205.1.101573 WP_003412205.1.101576 WP_003412205.1.10159 WP_003412205.1.101592 WP_003412205.1.101604 WP_003412205.1.101607 WP_003412205.1.101622 WP_003412205.1.101644 WP_003412205.1.101659 WP_003412205.1.101671 WP_003412205.1.101687 WP_003412205.1.101698 WP_003412205.1.10170 WP_003412205.1.101713 WP_003412205.1.101722 WP_003412205.1.101733 WP_003412205.1.101743 WP_003412205.1.101753 WP_003412205.1.101754 WP_003412205.1.101764 WP_003412205.1.101773 WP_003412205.1.101795 WP_003412205.1.101797 WP_003412205.1.101798 WP_003412205.1.101802 WP_003412205.1.101826 WP_003412205.1.101836 WP_003412205.1.101858 WP_003412205.1.101859 WP_003412205.1.101862 WP_003412205.1.101888 WP_003412205.1.101894 WP_003412205.1.101899 WP_003412205.1.1019 WP_003412205.1.101923 WP_003412205.1.101925 WP_003412205.1.10193 WP_003412205.1.101996 WP_003412205.1.102 WP_003412205.1.102008 WP_003412205.1.102017 WP_003412205.1.102053 WP_003412205.1.102055 WP_003412205.1.102063 WP_003412205.1.102099 WP_003412205.1.1021 WP_003412205.1.10211 WP_003412205.1.102119 WP_003412205.1.102121 WP_003412205.1.102143 WP_003412205.1.10216 WP_003412205.1.10224 WP_003412205.1.10253 WP_003412205.1.10262 WP_003412205.1.10272 WP_003412205.1.10277 WP_003412205.1.1033 WP_003412205.1.10350 WP_003412205.1.10362 WP_003412205.1.10366 WP_003412205.1.10376 WP_003412205.1.10396 WP_003412205.1.10410 WP_003412205.1.10414 WP_003412205.1.10421 WP_003412205.1.10430 WP_003412205.1.1044 WP_003412205.1.10440 WP_003412205.1.10445 WP_003412205.1.10471 WP_003412205.1.10472 WP_003412205.1.10489 WP_003412205.1.105 WP_003412205.1.10518 WP_003412205.1.10523 WP_003412205.1.10545 WP_003412205.1.1057 WP_003412205.1.10594 WP_003412205.1.10603 WP_003412205.1.10606 WP_003412205.1.10615 WP_003412205.1.10623 WP_003412205.1.10635 WP_003412205.1.10643 WP_003412205.1.10648 WP_003412205.1.10662 WP_003412205.1.10709 WP_003412205.1.10735 WP_003412205.1.10740 WP_003412205.1.10756 WP_003412205.1.1078 WP_003412205.1.10791 WP_003412205.1.10799 WP_003412205.1.10825 WP_003412205.1.10848 WP_003412205.1.10863 WP_003412205.1.10879 WP_003412205.1.10912 WP_003412205.1.10916 WP_003412205.1.10923 WP_003412205.1.10927 WP_003412205.1.1095 WP_003412205.1.10956 WP_003412205.1.10958 WP_003412205.1.10962 WP_003412205.1.10980 WP_003412205.1.10981 WP_003412205.1.10993 WP_003412205.1.1100 WP_003412205.1.11040 WP_003412205.1.11061 WP_003412205.1.11070 WP_003412205.1.11141 WP_003412205.1.11171 WP_003412205.1.11175 WP_003412205.1.11176 WP_003412205.1.11222 WP_003412205.1.11236 WP_003412205.1.11329 WP_003412205.1.1133 WP_003412205.1.11342 WP_003412205.1.11373 WP_003412205.1.11376 WP_003412205.1.11390 WP_003412205.1.11402 WP_003412205.1.11481 WP_003412205.1.11487 WP_003412205.1.11489 WP_003412205.1.11491 WP_003412205.1.11514 WP_003412205.1.11587 WP_003412205.1.11589 WP_003412205.1.11596 WP_003412205.1.11604 WP_003412205.1.11610 WP_003412205.1.11697 WP_003412205.1.11707 WP_003412205.1.11752 WP_003412205.1.11758 WP_003412205.1.11761 WP_003412205.1.11775 WP_003412205.1.11804 WP_003412205.1.11822 WP_003412205.1.11826 WP_003412205.1.11856 WP_003412205.1.11898 WP_003412205.1.11906 WP_003412205.1.11939 WP_003412205.1.11960 WP_003412205.1.11961 WP_003412205.1.11972 WP_003412205.1.11984 WP_003412205.1.12001 WP_003412205.1.12049 WP_003412205.1.12052 WP_003412205.1.12100 WP_003412205.1.12116 WP_003412205.1.12130 WP_003412205.1.12133 WP_003412205.1.12161 WP_003412205.1.12165 WP_003412205.1.12184 WP_003412205.1.12187 WP_003412205.1.12190 WP_003412205.1.12216 WP_003412205.1.12265 WP_003412205.1.12275 WP_003412205.1.12293 WP_003412205.1.12294 WP_003412205.1.123 WP_003412205.1.1231 WP_003412205.1.12314 WP_003412205.1.12327 WP_003412205.1.12338 WP_003412205.1.1236 WP_003412205.1.12371 WP_003412205.1.12372 WP_003412205.1.12389 WP_003412205.1.12406 WP_003412205.1.1241 WP_003412205.1.12421 WP_003412205.1.12424 WP_003412205.1.12446 WP_003412205.1.12464 WP_003412205.1.12479 WP_003412205.1.12519 WP_003412205.1.12523 WP_003412205.1.12526 WP_003412205.1.1255 WP_003412205.1.12550 WP_003412205.1.12551 WP_003412205.1.12563 WP_003412205.1.12611 WP_003412205.1.12669 WP_003412205.1.1267 WP_003412205.1.12672 WP_003412205.1.12692 WP_003412205.1.1271 WP_003412205.1.12710 WP_003412205.1.12768 WP_003412205.1.1279 WP_003412205.1.12794 WP_003412205.1.12801 WP_003412205.1.12804 WP_003412205.1.12821 WP_003412205.1.12841 WP_003412205.1.12854 WP_003412205.1.12871 WP_003412205.1.12901 WP_003412205.1.12941 WP_003412205.1.12947 WP_003412205.1.12957 WP_003412205.1.12972 WP_003412205.1.13028 WP_003412205.1.13043 WP_003412205.1.13086 WP_003412205.1.13087 WP_003412205.1.13090 WP_003412205.1.13096 WP_003412205.1.13163 WP_003412205.1.13175 WP_003412205.1.13183 WP_003412205.1.132 WP_003412205.1.13249 WP_003412205.1.13282 WP_003412205.1.13284 WP_003412205.1.13296 WP_003412205.1.13298 WP_003412205.1.13302 WP_003412205.1.13306 WP_003412205.1.13312 WP_003412205.1.13313 WP_003412205.1.13321 WP_003412205.1.13345 WP_003412205.1.13358 WP_003412205.1.13370 WP_003412205.1.13375 WP_003412205.1.1338 WP_003412205.1.13420 WP_003412205.1.13433 WP_003412205.1.13435 WP_003412205.1.13438 WP_003412205.1.13461 WP_003412205.1.13466 WP_003412205.1.13489 WP_003412205.1.13526 WP_003412205.1.13551 WP_003412205.1.13561 WP_003412205.1.13564 WP_003412205.1.13579 WP_003412205.1.13647 WP_003412205.1.13667 WP_003412205.1.13687 WP_003412205.1.13697 WP_003412205.1.13719 WP_003412205.1.13763 WP_003412205.1.1377 WP_003412205.1.13774 WP_003412205.1.13786 WP_003412205.1.13793 WP_003412205.1.13794 WP_003412205.1.13817 WP_003412205.1.13834 WP_003412205.1.13866 WP_003412205.1.13880 WP_003412205.1.13899 WP_003412205.1.13909 WP_003412205.1.13910 WP_003412205.1.13919 WP_003412205.1.13920 WP_003412205.1.13952 WP_003412205.1.13953 WP_003412205.1.13962 WP_003412205.1.1398 WP_003412205.1.13988 WP_003412205.1.14027 WP_003412205.1.14046 WP_003412205.1.14115 WP_003412205.1.1415 WP_003412205.1.14152 WP_003412205.1.14158 WP_003412205.1.14162 WP_003412205.1.14175 WP_003412205.1.14178 WP_003412205.1.14194 WP_003412205.1.14195 WP_003412205.1.14208 WP_003412205.1.14238 WP_003412205.1.14266 WP_003412205.1.14273 WP_003412205.1.14303 WP_003412205.1.14306 WP_003412205.1.14307 WP_003412205.1.14310 WP_003412205.1.14341 WP_003412205.1.14382 WP_003412205.1.14416 WP_003412205.1.14428 WP_003412205.1.14441 WP_003412205.1.14469 WP_003412205.1.14477 WP_003412205.1.14504 WP_003412205.1.14514 WP_003412205.1.1452 WP_003412205.1.14527 WP_003412205.1.1454 WP_003412205.1.14544 WP_003412205.1.14548 WP_003412205.1.14551 WP_003412205.1.14561 WP_003412205.1.14573 WP_003412205.1.1462 WP_003412205.1.14658 WP_003412205.1.14667 WP_003412205.1.14668 WP_003412205.1.14675 WP_003412205.1.14694 WP_003412205.1.14695 WP_003412205.1.14709 WP_003412205.1.14766 WP_003412205.1.14783 WP_003412205.1.14865 WP_003412205.1.14872 WP_003412205.1.14905 WP_003412205.1.14926 WP_003412205.1.14951 WP_003412205.1.14955 WP_003412205.1.15003 WP_003412205.1.15009 WP_003412205.1.15028 WP_003412205.1.15040 WP_003412205.1.15052 WP_003412205.1.15065 WP_003412205.1.15072 WP_003412205.1.15089 WP_003412205.1.1509 WP_003412205.1.15126 WP_003412205.1.15131 WP_003412205.1.15168 WP_003412205.1.15172 WP_003412205.1.15174 WP_003412205.1.15187 WP_003412205.1.15196 WP_003412205.1.15210 WP_003412205.1.15216 WP_003412205.1.15217 WP_003412205.1.1523 WP_003412205.1.15232 WP_003412205.1.15238 WP_003412205.1.15240 WP_003412205.1.15253 WP_003412205.1.15267 WP_003412205.1.1527 WP_003412205.1.15292 WP_003412205.1.15299 WP_003412205.1.15302 WP_003412205.1.15322 WP_003412205.1.1534 WP_003412205.1.15345 WP_003412205.1.15365 WP_003412205.1.15372 WP_003412205.1.15386 WP_003412205.1.15387 WP_003412205.1.15442 WP_003412205.1.15447 WP_003412205.1.15449 WP_003412205.1.15477 WP_003412205.1.15481 WP_003412205.1.15492 WP_003412205.1.15511 WP_003412205.1.15512 WP_003412205.1.15558 WP_003412205.1.15559 WP_003412205.1.15566 WP_003412205.1.15599 WP_003412205.1.1560 WP_003412205.1.15611 WP_003412205.1.1563 WP_003412205.1.15633 WP_003412205.1.15643 WP_003412205.1.15688 WP_003412205.1.15755 WP_003412205.1.15763 WP_003412205.1.15774 WP_003412205.1.1578 WP_003412205.1.15780 WP_003412205.1.15827 WP_003412205.1.15834 WP_003412205.1.15842 WP_003412205.1.15848 WP_003412205.1.15853 WP_003412205.1.15870 WP_003412205.1.15877 WP_003412205.1.15893 WP_003412205.1.15896 WP_003412205.1.15926 WP_003412205.1.15933 WP_003412205.1.15946 WP_003412205.1.15958 WP_003412205.1.15973 WP_003412205.1.15987 WP_003412205.1.15993 WP_003412205.1.16009 WP_003412205.1.16025 WP_003412205.1.16043 WP_003412205.1.16055 WP_003412205.1.16066 WP_003412205.1.16069 WP_003412205.1.16077 WP_003412205.1.16106 WP_003412205.1.16108 WP_003412205.1.16110 WP_003412205.1.16130 WP_003412205.1.16136 WP_003412205.1.16139 WP_003412205.1.16141 WP_003412205.1.16143 WP_003412205.1.1630 WP_003412205.1.16318 WP_003412205.1.1632 WP_003412205.1.16327 WP_003412205.1.16334 WP_003412205.1.16341 WP_003412205.1.16345 WP_003412205.1.16374 WP_003412205.1.16384 WP_003412205.1.16386 WP_003412205.1.164 WP_003412205.1.1642 WP_003412205.1.16421 WP_003412205.1.16424 WP_003412205.1.16426 WP_003412205.1.16431 WP_003412205.1.16438 WP_003412205.1.1644 WP_003412205.1.16442 WP_003412205.1.16448 WP_003412205.1.16451 WP_003412205.1.16476 WP_003412205.1.16480 WP_003412205.1.16494 WP_003412205.1.1652 WP_003412205.1.16549 WP_003412205.1.16560 WP_003412205.1.16598 WP_003412205.1.16609 WP_003412205.1.16619 WP_003412205.1.16620 WP_003412205.1.16622 WP_003412205.1.16637 WP_003412205.1.1669 WP_003412205.1.16707 WP_003412205.1.16724 WP_003412205.1.16731 WP_003412205.1.16743 WP_003412205.1.1683 WP_003412205.1.16837 WP_003412205.1.16852 WP_003412205.1.16937 WP_003412205.1.16940 WP_003412205.1.16950 WP_003412205.1.16959 WP_003412205.1.16968 WP_003412205.1.1697 WP_003412205.1.16973 WP_003412205.1.16977 WP_003412205.1.16987 WP_003412205.1.17005 WP_003412205.1.17006 WP_003412205.1.17010 WP_003412205.1.17015 WP_003412205.1.17019 WP_003412205.1.17039 WP_003412205.1.17041 WP_003412205.1.17052 WP_003412205.1.17057 WP_003412205.1.17062 WP_003412205.1.1707 WP_003412205.1.17094 WP_003412205.1.17130 WP_003412205.1.17138 WP_003412205.1.17147 WP_003412205.1.17167 WP_003412205.1.17224 WP_003412205.1.17251 WP_003412205.1.17288 WP_003412205.1.17304 WP_003412205.1.17314 WP_003412205.1.17345 WP_003412205.1.17381 WP_003412205.1.17391 WP_003412205.1.17412 WP_003412205.1.1743 WP_003412205.1.17440 WP_003412205.1.17466 WP_003412205.1.17477 WP_003412205.1.17483 WP_003412205.1.17505 WP_003412205.1.17527 WP_003412205.1.17535 WP_003412205.1.17540 WP_003412205.1.17553 WP_003412205.1.17558 WP_003412205.1.17599 WP_003412205.1.17635 WP_003412205.1.17655 WP_003412205.1.17679 WP_003412205.1.1768 WP_003412205.1.17687 WP_003412205.1.17700 WP_003412205.1.17710 WP_003412205.1.17713 WP_003412205.1.17722 WP_003412205.1.17746 WP_003412205.1.17788 WP_003412205.1.17798 WP_003412205.1.17803 WP_003412205.1.17816 WP_003412205.1.17821 WP_003412205.1.17830 WP_003412205.1.17868 WP_003412205.1.17878 WP_003412205.1.1792 WP_003412205.1.17923 WP_003412205.1.1795 WP_003412205.1.17955 WP_003412205.1.17973 WP_003412205.1.18009 WP_003412205.1.18013 WP_003412205.1.18033 WP_003412205.1.18057 WP_003412205.1.18065 WP_003412205.1.18070 WP_003412205.1.18116 WP_003412205.1.18120 WP_003412205.1.18126 WP_003412205.1.1817 WP_003412205.1.18170 WP_003412205.1.18206 WP_003412205.1.18216 WP_003412205.1.18240 WP_003412205.1.18257 WP_003412205.1.18297 WP_003412205.1.18306 WP_003412205.1.18364 WP_003412205.1.18399 WP_003412205.1.18411 WP_003412205.1.18444 WP_003412205.1.18448 WP_003412205.1.18467 WP_003412205.1.18476 WP_003412205.1.18522 WP_003412205.1.18580 WP_003412205.1.18582 WP_003412205.1.18587 WP_003412205.1.186 WP_003412205.1.18601 WP_003412205.1.18639 WP_003412205.1.18646 WP_003412205.1.18647 WP_003412205.1.1868 WP_003412205.1.18694 WP_003412205.1.18710 WP_003412205.1.18751 WP_003412205.1.18781 WP_003412205.1.18793 WP_003412205.1.18804 WP_003412205.1.18816 WP_003412205.1.18823 WP_003412205.1.18827 WP_003412205.1.18838 WP_003412205.1.18849 WP_003412205.1.18856 WP_003412205.1.18945 WP_003412205.1.1898 WP_003412205.1.19005 WP_003412205.1.19056 WP_003412205.1.19063 WP_003412205.1.19066 WP_003412205.1.19071 WP_003412205.1.19085 WP_003412205.1.19094 WP_003412205.1.19144 WP_003412205.1.19159 WP_003412205.1.19193 WP_003412205.1.19231 WP_003412205.1.19243 WP_003412205.1.19264 WP_003412205.1.19295 WP_003412205.1.19307 WP_003412205.1.19326 WP_003412205.1.1933 WP_003412205.1.19364 WP_003412205.1.19382 WP_003412205.1.19400 WP_003412205.1.19426 WP_003412205.1.19429 WP_003412205.1.19464 WP_003412205.1.19480 WP_003412205.1.19512 WP_003412205.1.19553 WP_003412205.1.19562 WP_003412205.1.19564 WP_003412205.1.19568 WP_003412205.1.19572 WP_003412205.1.19595 WP_003412205.1.19596 WP_003412205.1.19600 WP_003412205.1.19630 WP_003412205.1.1967 WP_003412205.1.19694 WP_003412205.1.1970 WP_003412205.1.19707 WP_003412205.1.19742 WP_003412205.1.19785 WP_003412205.1.19820 WP_003412205.1.19868 WP_003412205.1.19874 WP_003412205.1.19890 WP_003412205.1.19900 WP_003412205.1.19922 WP_003412205.1.19936 WP_003412205.1.19946 WP_003412205.1.19949 WP_003412205.1.19960 WP_003412205.1.19964 WP_003412205.1.20007 WP_003412205.1.20016 WP_003412205.1.20028 WP_003412205.1.2003 WP_003412205.1.20037 WP_003412205.1.20039 WP_003412205.1.20082 WP_003412205.1.20085 WP_003412205.1.20097 WP_003412205.1.20116 WP_003412205.1.20130 WP_003412205.1.20140 WP_003412205.1.20141 WP_003412205.1.20142 WP_003412205.1.20158 WP_003412205.1.20239 WP_003412205.1.20243 WP_003412205.1.20259 WP_003412205.1.20262 WP_003412205.1.20268 WP_003412205.1.20272 WP_003412205.1.20273 WP_003412205.1.20280 WP_003412205.1.20294 WP_003412205.1.20300 WP_003412205.1.20309 WP_003412205.1.20322 WP_003412205.1.2037 WP_003412205.1.20372 WP_003412205.1.20381 WP_003412205.1.204 WP_003412205.1.20427 WP_003412205.1.20432 WP_003412205.1.20457 WP_003412205.1.20459 WP_003412205.1.20460 WP_003412205.1.20542 WP_003412205.1.20578 WP_003412205.1.20608 WP_003412205.1.20624 WP_003412205.1.20628 WP_003412205.1.2066 WP_003412205.1.20707 WP_003412205.1.20722 WP_003412205.1.20729 WP_003412205.1.20742 WP_003412205.1.20751 WP_003412205.1.20776 WP_003412205.1.20843 WP_003412205.1.20850 WP_003412205.1.2086 WP_003412205.1.20868 WP_003412205.1.20876 WP_003412205.1.20897 WP_003412205.1.20898 WP_003412205.1.2090 WP_003412205.1.20911 WP_003412205.1.20916 WP_003412205.1.20921 WP_003412205.1.20926 WP_003412205.1.20927 WP_003412205.1.20951 WP_003412205.1.20970 WP_003412205.1.2104 WP_003412205.1.21070 WP_003412205.1.21127 WP_003412205.1.21135 WP_003412205.1.21173 WP_003412205.1.21187 WP_003412205.1.212 WP_003412205.1.2120 WP_003412205.1.21218 WP_003412205.1.21219 WP_003412205.1.2123 WP_003412205.1.21231 WP_003412205.1.21234 WP_003412205.1.2126 WP_003412205.1.21292 WP_003412205.1.21307 WP_003412205.1.2131 WP_003412205.1.21311 WP_003412205.1.21321 WP_003412205.1.21365 WP_003412205.1.2137 WP_003412205.1.21392 WP_003412205.1.21397 WP_003412205.1.21403 WP_003412205.1.21415 WP_003412205.1.21418 WP_003412205.1.21430 WP_003412205.1.21434 WP_003412205.1.21444 WP_003412205.1.21468 WP_003412205.1.21498 WP_003412205.1.21509 WP_003412205.1.21513 WP_003412205.1.21560 WP_003412205.1.21565 WP_003412205.1.21586 WP_003412205.1.21591 WP_003412205.1.21594 WP_003412205.1.21602 WP_003412205.1.21615 WP_003412205.1.21638 WP_003412205.1.21639 WP_003412205.1.21655 WP_003412205.1.21658 WP_003412205.1.2168 WP_003412205.1.2174 WP_003412205.1.21741 WP_003412205.1.21742 WP_003412205.1.21777 WP_003412205.1.21786 WP_003412205.1.21795 WP_003412205.1.218 WP_003412205.1.21826 WP_003412205.1.21829 WP_003412205.1.21840 WP_003412205.1.21843 WP_003412205.1.21872 WP_003412205.1.21873 WP_003412205.1.2188 WP_003412205.1.21882 WP_003412205.1.21906 WP_003412205.1.21912 WP_003412205.1.2194 WP_003412205.1.21941 WP_003412205.1.21956 WP_003412205.1.21958 WP_003412205.1.21960 WP_003412205.1.21971 WP_003412205.1.21973 WP_003412205.1.21983 WP_003412205.1.22003 WP_003412205.1.22013 WP_003412205.1.22025 WP_003412205.1.22036 WP_003412205.1.22075 WP_003412205.1.22092 WP_003412205.1.2212 WP_003412205.1.22127 WP_003412205.1.22140 WP_003412205.1.22233 WP_003412205.1.22255 WP_003412205.1.22277 WP_003412205.1.22305 WP_003412205.1.22348 WP_003412205.1.22366 WP_003412205.1.2238 WP_003412205.1.22380 WP_003412205.1.22437 WP_003412205.1.22438 WP_003412205.1.22445 WP_003412205.1.22490 WP_003412205.1.22511 WP_003412205.1.22524 WP_003412205.1.2253 WP_003412205.1.22585 WP_003412205.1.22589 WP_003412205.1.22606 WP_003412205.1.22608 WP_003412205.1.22609 WP_003412205.1.22618 WP_003412205.1.2262 WP_003412205.1.22624 WP_003412205.1.22629 WP_003412205.1.22647 WP_003412205.1.22664 WP_003412205.1.22665 WP_003412205.1.22670 WP_003412205.1.22674 WP_003412205.1.22680 WP_003412205.1.22725 WP_003412205.1.22728 WP_003412205.1.22733 WP_003412205.1.22737 WP_003412205.1.2275 WP_003412205.1.22754 WP_003412205.1.22797 WP_003412205.1.22800 WP_003412205.1.22804 WP_003412205.1.22829 WP_003412205.1.22840 WP_003412205.1.22844 WP_003412205.1.22963 WP_003412205.1.22970 WP_003412205.1.22996 WP_003412205.1.22997 WP_003412205.1.22999 WP_003412205.1.23015 WP_003412205.1.23032 WP_003412205.1.231 WP_003412205.1.23101 WP_003412205.1.2312 WP_003412205.1.23140 WP_003412205.1.23153 WP_003412205.1.23171 WP_003412205.1.23199 WP_003412205.1.2320 WP_003412205.1.23204 WP_003412205.1.23216 WP_003412205.1.23229 WP_003412205.1.23233 WP_003412205.1.2326 WP_003412205.1.23261 WP_003412205.1.23272 WP_003412205.1.23289 WP_003412205.1.2329 WP_003412205.1.23308 WP_003412205.1.23316 WP_003412205.1.23321 WP_003412205.1.23325 WP_003412205.1.2339 WP_003412205.1.23406 WP_003412205.1.23438 WP_003412205.1.23445 WP_003412205.1.23447 WP_003412205.1.23452 WP_003412205.1.23461 WP_003412205.1.2349 WP_003412205.1.23496 WP_003412205.1.23497 WP_003412205.1.23506 WP_003412205.1.23530 WP_003412205.1.23539 WP_003412205.1.23546 WP_003412205.1.23551 WP_003412205.1.23573 WP_003412205.1.23583 WP_003412205.1.23588 WP_003412205.1.23628 WP_003412205.1.23677 WP_003412205.1.23683 WP_003412205.1.23692 WP_003412205.1.23694 WP_003412205.1.23699 WP_003412205.1.2371 WP_003412205.1.23803 WP_003412205.1.23807 WP_003412205.1.23825 WP_003412205.1.23832 WP_003412205.1.2384 WP_003412205.1.23843 WP_003412205.1.23863 WP_003412205.1.2387 WP_003412205.1.23894 WP_003412205.1.23993 WP_003412205.1.2400 WP_003412205.1.24007 WP_003412205.1.24008 WP_003412205.1.24046 WP_003412205.1.24057 WP_003412205.1.24062 WP_003412205.1.24113 WP_003412205.1.24119 WP_003412205.1.24128 WP_003412205.1.24140 WP_003412205.1.24176 WP_003412205.1.24190 WP_003412205.1.24202 WP_003412205.1.24244 WP_003412205.1.24261 WP_003412205.1.24284 WP_003412205.1.24294 WP_003412205.1.24357 WP_003412205.1.24396 WP_003412205.1.24414 WP_003412205.1.24423 WP_003412205.1.2443 WP_003412205.1.24446 WP_003412205.1.24461 WP_003412205.1.24500 WP_003412205.1.24507 WP_003412205.1.24509 WP_003412205.1.24529 WP_003412205.1.24553 WP_003412205.1.24599 WP_003412205.1.24629 WP_003412205.1.24638 WP_003412205.1.24648 WP_003412205.1.2466 WP_003412205.1.24767 WP_003412205.1.24824 WP_003412205.1.24831 WP_003412205.1.24840 WP_003412205.1.24848 WP_003412205.1.24857 WP_003412205.1.2487 WP_003412205.1.24893 WP_003412205.1.24907 WP_003412205.1.24933 WP_003412205.1.24956 WP_003412205.1.24958 WP_003412205.1.24985 WP_003412205.1.2499 WP_003412205.1.25004 WP_003412205.1.2505 WP_003412205.1.25051 WP_003412205.1.2507 WP_003412205.1.25096 WP_003412205.1.25103 WP_003412205.1.25129 WP_003412205.1.25171 WP_003412205.1.25184 WP_003412205.1.25247 WP_003412205.1.25252 WP_003412205.1.25278 WP_003412205.1.25283 WP_003412205.1.25309 WP_003412205.1.25313 WP_003412205.1.25338 WP_003412205.1.25342 WP_003412205.1.25343 WP_003412205.1.25367 WP_003412205.1.25393 WP_003412205.1.25406 WP_003412205.1.25435 WP_003412205.1.25437 WP_003412205.1.25445 WP_003412205.1.25455 WP_003412205.1.25473 WP_003412205.1.25504 WP_003412205.1.25513 WP_003412205.1.25542 WP_003412205.1.25579 WP_003412205.1.25594 WP_003412205.1.25606 WP_003412205.1.25645 WP_003412205.1.2566 WP_003412205.1.25673 WP_003412205.1.25674 WP_003412205.1.25693 WP_003412205.1.25699 WP_003412205.1.25727 WP_003412205.1.25736 WP_003412205.1.25738 WP_003412205.1.25756 WP_003412205.1.25759 WP_003412205.1.2580 WP_003412205.1.25813 WP_003412205.1.25853 WP_003412205.1.25854 WP_003412205.1.25874 WP_003412205.1.25885 WP_003412205.1.25892 WP_003412205.1.25906 WP_003412205.1.25914 WP_003412205.1.25916 WP_003412205.1.2594 WP_003412205.1.25954 WP_003412205.1.25965 WP_003412205.1.25972 WP_003412205.1.26017 WP_003412205.1.26032 WP_003412205.1.26038 WP_003412205.1.26072 WP_003412205.1.26089 WP_003412205.1.26097 WP_003412205.1.26098 WP_003412205.1.26108 WP_003412205.1.26109 WP_003412205.1.26118 WP_003412205.1.26126 WP_003412205.1.2614 WP_003412205.1.26168 WP_003412205.1.26182 WP_003412205.1.26190 WP_003412205.1.2620 WP_003412205.1.26234 WP_003412205.1.26243 WP_003412205.1.26265 WP_003412205.1.26267 WP_003412205.1.26292 WP_003412205.1.26310 WP_003412205.1.26328 WP_003412205.1.26349 WP_003412205.1.26366 WP_003412205.1.26374 WP_003412205.1.26407 WP_003412205.1.26412 WP_003412205.1.26454 WP_003412205.1.26464 WP_003412205.1.2653 WP_003412205.1.26560 WP_003412205.1.26571 WP_003412205.1.2659 WP_003412205.1.26597 WP_003412205.1.26603 WP_003412205.1.26629 WP_003412205.1.26651 WP_003412205.1.26702 WP_003412205.1.26707 WP_003412205.1.26710 WP_003412205.1.26719 WP_003412205.1.26737 WP_003412205.1.26738 WP_003412205.1.26745 WP_003412205.1.26756 WP_003412205.1.2676 WP_003412205.1.2677 WP_003412205.1.26779 WP_003412205.1.26780 WP_003412205.1.26798 WP_003412205.1.26854 WP_003412205.1.26868 WP_003412205.1.26876 WP_003412205.1.26888 WP_003412205.1.26914 WP_003412205.1.26945 WP_003412205.1.26959 WP_003412205.1.26969 WP_003412205.1.26984 WP_003412205.1.26992 WP_003412205.1.27004 WP_003412205.1.27017 WP_003412205.1.27045 WP_003412205.1.27074 WP_003412205.1.27075 WP_003412205.1.27128 WP_003412205.1.27130 WP_003412205.1.27139 WP_003412205.1.27152 WP_003412205.1.27162 WP_003412205.1.27164 WP_003412205.1.27235 WP_003412205.1.27254 WP_003412205.1.27278 WP_003412205.1.27343 WP_003412205.1.27352 WP_003412205.1.27369 WP_003412205.1.27391 WP_003412205.1.27398 WP_003412205.1.27402 WP_003412205.1.27410 WP_003412205.1.27411 WP_003412205.1.27449 WP_003412205.1.27460 WP_003412205.1.27463 WP_003412205.1.2749 WP_003412205.1.27492 WP_003412205.1.27528 WP_003412205.1.27541 WP_003412205.1.27576 WP_003412205.1.27582 WP_003412205.1.27596 WP_003412205.1.27607 WP_003412205.1.2766 WP_003412205.1.277 WP_003412205.1.27724 WP_003412205.1.27730 WP_003412205.1.27736 WP_003412205.1.27743 WP_003412205.1.27750 WP_003412205.1.27771 WP_003412205.1.27779 WP_003412205.1.27795 WP_003412205.1.27803 WP_003412205.1.27819 WP_003412205.1.27835 WP_003412205.1.27915 WP_003412205.1.27935 WP_003412205.1.27962 WP_003412205.1.28053 WP_003412205.1.28092 WP_003412205.1.28106 WP_003412205.1.28131 WP_003412205.1.28142 WP_003412205.1.28159 WP_003412205.1.2816 WP_003412205.1.28161 WP_003412205.1.28192 WP_003412205.1.28202 WP_003412205.1.28241 WP_003412205.1.28242 WP_003412205.1.28251 WP_003412205.1.28255 WP_003412205.1.28269 WP_003412205.1.28276 WP_003412205.1.28293 WP_003412205.1.28331 WP_003412205.1.28367 WP_003412205.1.28378 WP_003412205.1.28391 WP_003412205.1.2842 WP_003412205.1.28448 WP_003412205.1.2847 WP_003412205.1.28471 WP_003412205.1.28473 WP_003412205.1.28493 WP_003412205.1.28497 WP_003412205.1.28530 WP_003412205.1.28545 WP_003412205.1.28561 WP_003412205.1.28567 WP_003412205.1.28585 WP_003412205.1.286 WP_003412205.1.28610 WP_003412205.1.28617 WP_003412205.1.28634 WP_003412205.1.28642 WP_003412205.1.28671 WP_003412205.1.28682 WP_003412205.1.28698 WP_003412205.1.28703 WP_003412205.1.28739 WP_003412205.1.28758 WP_003412205.1.28781 WP_003412205.1.28787 WP_003412205.1.28827 WP_003412205.1.28839 WP_003412205.1.28847 WP_003412205.1.28850 WP_003412205.1.28851 WP_003412205.1.28865 WP_003412205.1.28897 WP_003412205.1.28914 WP_003412205.1.28935 WP_003412205.1.28936 WP_003412205.1.28939 WP_003412205.1.28943 WP_003412205.1.28952 WP_003412205.1.28975 WP_003412205.1.2899 WP_003412205.1.28993 WP_003412205.1.29000 WP_003412205.1.2901 WP_003412205.1.29028 WP_003412205.1.29033 WP_003412205.1.29058 WP_003412205.1.29078 WP_003412205.1.29102 WP_003412205.1.29115 WP_003412205.1.2916 WP_003412205.1.29217 WP_003412205.1.29223 WP_003412205.1.29234 WP_003412205.1.29264 WP_003412205.1.29275 WP_003412205.1.29306 WP_003412205.1.29339 WP_003412205.1.29348 WP_003412205.1.29364 WP_003412205.1.29367 WP_003412205.1.2938 WP_003412205.1.29399 WP_003412205.1.29426 WP_003412205.1.2944 WP_003412205.1.29449 WP_003412205.1.29450 WP_003412205.1.29452 WP_003412205.1.2949 WP_003412205.1.29510 WP_003412205.1.29515 WP_003412205.1.29525 WP_003412205.1.2953 WP_003412205.1.29559 WP_003412205.1.29587 WP_003412205.1.2959 WP_003412205.1.29592 WP_003412205.1.29599 WP_003412205.1.29611 WP_003412205.1.29632 WP_003412205.1.29649 WP_003412205.1.2965 WP_003412205.1.29659 WP_003412205.1.2969 WP_003412205.1.29696 WP_003412205.1.29698 WP_003412205.1.29718 WP_003412205.1.29742 WP_003412205.1.29745 WP_003412205.1.29747 WP_003412205.1.29769 WP_003412205.1.29825 WP_003412205.1.29830 WP_003412205.1.29847 WP_003412205.1.29861 WP_003412205.1.29869 WP_003412205.1.29883 WP_003412205.1.29890 WP_003412205.1.299 WP_003412205.1.29931 WP_003412205.1.29960 WP_003412205.1.30014 WP_003412205.1.3004 WP_003412205.1.30040 WP_003412205.1.30043 WP_003412205.1.30074 WP_003412205.1.30097 WP_003412205.1.30101 WP_003412205.1.30106 WP_003412205.1.30114 WP_003412205.1.30126 WP_003412205.1.30131 WP_003412205.1.30138 WP_003412205.1.30139 WP_003412205.1.30211 WP_003412205.1.30224 WP_003412205.1.30235 WP_003412205.1.30237 WP_003412205.1.3027 WP_003412205.1.30279 WP_003412205.1.30282 WP_003412205.1.30283 WP_003412205.1.30288 WP_003412205.1.30291 WP_003412205.1.30363 WP_003412205.1.30374 WP_003412205.1.30404 WP_003412205.1.3043 WP_003412205.1.30433 WP_003412205.1.30438 WP_003412205.1.30462 WP_003412205.1.30468 WP_003412205.1.30500 WP_003412205.1.3057 WP_003412205.1.30574 WP_003412205.1.30628 WP_003412205.1.30641 WP_003412205.1.30642 WP_003412205.1.30661 WP_003412205.1.30669 WP_003412205.1.30683 WP_003412205.1.30699 WP_003412205.1.30709 WP_003412205.1.30713 WP_003412205.1.30716 WP_003412205.1.30719 WP_003412205.1.30730 WP_003412205.1.30732 WP_003412205.1.30736 WP_003412205.1.30745 WP_003412205.1.30760 WP_003412205.1.30791 WP_003412205.1.308 WP_003412205.1.30807 WP_003412205.1.30818 WP_003412205.1.30824 WP_003412205.1.30848 WP_003412205.1.30877 WP_003412205.1.30888 WP_003412205.1.30901 WP_003412205.1.30903 WP_003412205.1.30912 WP_003412205.1.30913 WP_003412205.1.30914 WP_003412205.1.30919 WP_003412205.1.30977 WP_003412205.1.3100 WP_003412205.1.31002 WP_003412205.1.3101 WP_003412205.1.31034 WP_003412205.1.31047 WP_003412205.1.31070 WP_003412205.1.31074 WP_003412205.1.31102 WP_003412205.1.31127 WP_003412205.1.31184 WP_003412205.1.31199 WP_003412205.1.31226 WP_003412205.1.31230 WP_003412205.1.31233 WP_003412205.1.31263 WP_003412205.1.31264 WP_003412205.1.31270 WP_003412205.1.31287 WP_003412205.1.31290 WP_003412205.1.31304 WP_003412205.1.31346 WP_003412205.1.31348 WP_003412205.1.31354 WP_003412205.1.31390 WP_003412205.1.31414 WP_003412205.1.31417 WP_003412205.1.31428 WP_003412205.1.3143 WP_003412205.1.31458 WP_003412205.1.31483 WP_003412205.1.3149 WP_003412205.1.31498 WP_003412205.1.31507 WP_003412205.1.31537 WP_003412205.1.31548 WP_003412205.1.31569 WP_003412205.1.31573 WP_003412205.1.316 WP_003412205.1.31629 WP_003412205.1.31666 WP_003412205.1.31693 WP_003412205.1.31703 WP_003412205.1.31744 WP_003412205.1.31745 WP_003412205.1.31770 WP_003412205.1.31776 WP_003412205.1.31783 WP_003412205.1.318 WP_003412205.1.3184 WP_003412205.1.31840 WP_003412205.1.31880 WP_003412205.1.31911 WP_003412205.1.31930 WP_003412205.1.31932 WP_003412205.1.31955 WP_003412205.1.31985 WP_003412205.1.31991 WP_003412205.1.31995 WP_003412205.1.32004 WP_003412205.1.32039 WP_003412205.1.3204 WP_003412205.1.32045 WP_003412205.1.32071 WP_003412205.1.32098 WP_003412205.1.32132 WP_003412205.1.32157 WP_003412205.1.32164 WP_003412205.1.32179 WP_003412205.1.32198 WP_003412205.1.32297 WP_003412205.1.32317 WP_003412205.1.32383 WP_003412205.1.32400 WP_003412205.1.32403 WP_003412205.1.32416 WP_003412205.1.32421 WP_003412205.1.32433 WP_003412205.1.32461 WP_003412205.1.32482 WP_003412205.1.32503 WP_003412205.1.32556 WP_003412205.1.32562 WP_003412205.1.32569 WP_003412205.1.32592 WP_003412205.1.32620 WP_003412205.1.32647 WP_003412205.1.32653 WP_003412205.1.32654 WP_003412205.1.3268 WP_003412205.1.32695 WP_003412205.1.32706 WP_003412205.1.32716 WP_003412205.1.32738 WP_003412205.1.32752 WP_003412205.1.32780 WP_003412205.1.32781 WP_003412205.1.32793 WP_003412205.1.32799 WP_003412205.1.32822 WP_003412205.1.32833 WP_003412205.1.32862 WP_003412205.1.32880 WP_003412205.1.32897 WP_003412205.1.32909 WP_003412205.1.32935 WP_003412205.1.32974 WP_003412205.1.33007 WP_003412205.1.3302 WP_003412205.1.33028 WP_003412205.1.33035 WP_003412205.1.33044 WP_003412205.1.33054 WP_003412205.1.33082 WP_003412205.1.33141 WP_003412205.1.33148 WP_003412205.1.33155 WP_003412205.1.33168 WP_003412205.1.3321 WP_003412205.1.33215 WP_003412205.1.3325 WP_003412205.1.3327 WP_003412205.1.33278 WP_003412205.1.33288 WP_003412205.1.33305 WP_003412205.1.3331 WP_003412205.1.33319 WP_003412205.1.3333 WP_003412205.1.33393 WP_003412205.1.33403 WP_003412205.1.33452 WP_003412205.1.33467 WP_003412205.1.33477 WP_003412205.1.3349 WP_003412205.1.33519 WP_003412205.1.33542 WP_003412205.1.33601 WP_003412205.1.33602 WP_003412205.1.33633 WP_003412205.1.33646 WP_003412205.1.33673 WP_003412205.1.3369 WP_003412205.1.33705 WP_003412205.1.33762 WP_003412205.1.33783 WP_003412205.1.33789 WP_003412205.1.3383 WP_003412205.1.33832 WP_003412205.1.33839 WP_003412205.1.33848 WP_003412205.1.3387 WP_003412205.1.33886 WP_003412205.1.33895 WP_003412205.1.33906 WP_003412205.1.33912 WP_003412205.1.33954 WP_003412205.1.3399 WP_003412205.1.34042 WP_003412205.1.3405 WP_003412205.1.34055 WP_003412205.1.34056 WP_003412205.1.34065 WP_003412205.1.3408 WP_003412205.1.34090 WP_003412205.1.34109 WP_003412205.1.34111 WP_003412205.1.34131 WP_003412205.1.34152 WP_003412205.1.34153 WP_003412205.1.34163 WP_003412205.1.34181 WP_003412205.1.34197 WP_003412205.1.34198 WP_003412205.1.34215 WP_003412205.1.34219 WP_003412205.1.34255 WP_003412205.1.34260 WP_003412205.1.34275 WP_003412205.1.343 WP_003412205.1.34347 WP_003412205.1.34358 WP_003412205.1.34392 WP_003412205.1.344 WP_003412205.1.34428 WP_003412205.1.3443 WP_003412205.1.34435 WP_003412205.1.34446 WP_003412205.1.34499 WP_003412205.1.34505 WP_003412205.1.34516 WP_003412205.1.34529 WP_003412205.1.34551 WP_003412205.1.34563 WP_003412205.1.34576 WP_003412205.1.34581 WP_003412205.1.34588 WP_003412205.1.34596 WP_003412205.1.34599 WP_003412205.1.34639 WP_003412205.1.34673 WP_003412205.1.34724 WP_003412205.1.34740 WP_003412205.1.34755 WP_003412205.1.34777 WP_003412205.1.34783 WP_003412205.1.34841 WP_003412205.1.34908 WP_003412205.1.34919 WP_003412205.1.3492 WP_003412205.1.34933 WP_003412205.1.34945 WP_003412205.1.34946 WP_003412205.1.34954 WP_003412205.1.34961 WP_003412205.1.34963 WP_003412205.1.34965 WP_003412205.1.34968 WP_003412205.1.35023 WP_003412205.1.35069 WP_003412205.1.35072 WP_003412205.1.35078 WP_003412205.1.35100 WP_003412205.1.35146 WP_003412205.1.35156 WP_003412205.1.35160 WP_003412205.1.35162 WP_003412205.1.35173 WP_003412205.1.35176 WP_003412205.1.3520 WP_003412205.1.35213 WP_003412205.1.35221 WP_003412205.1.35246 WP_003412205.1.35278 WP_003412205.1.35301 WP_003412205.1.35311 WP_003412205.1.35312 WP_003412205.1.35317 WP_003412205.1.35319 WP_003412205.1.35347 WP_003412205.1.35363 WP_003412205.1.35382 WP_003412205.1.35385 WP_003412205.1.35396 WP_003412205.1.35397 WP_003412205.1.35403 WP_003412205.1.35426 WP_003412205.1.35439 WP_003412205.1.35455 WP_003412205.1.3548 WP_003412205.1.35484 WP_003412205.1.35492 WP_003412205.1.3553 WP_003412205.1.35553 WP_003412205.1.35555 WP_003412205.1.35561 WP_003412205.1.35602 WP_003412205.1.35610 WP_003412205.1.35635 WP_003412205.1.35657 WP_003412205.1.35680 WP_003412205.1.35687 WP_003412205.1.35689 WP_003412205.1.35707 WP_003412205.1.35732 WP_003412205.1.35754 WP_003412205.1.35767 WP_003412205.1.35770 WP_003412205.1.35771 WP_003412205.1.35780 WP_003412205.1.35805 WP_003412205.1.35811 WP_003412205.1.35821 WP_003412205.1.3584 WP_003412205.1.35848 WP_003412205.1.35864 WP_003412205.1.35874 WP_003412205.1.35876 WP_003412205.1.35897 WP_003412205.1.35899 WP_003412205.1.35923 WP_003412205.1.3593 WP_003412205.1.35954 WP_003412205.1.36005 WP_003412205.1.36014 WP_003412205.1.36023 WP_003412205.1.36051 WP_003412205.1.36053 WP_003412205.1.36075 WP_003412205.1.36089 WP_003412205.1.36097 WP_003412205.1.36098 WP_003412205.1.36116 WP_003412205.1.36145 WP_003412205.1.36156 WP_003412205.1.36205 WP_003412205.1.36228 WP_003412205.1.36246 WP_003412205.1.36252 WP_003412205.1.36260 WP_003412205.1.36270 WP_003412205.1.36271 WP_003412205.1.36303 WP_003412205.1.36309 WP_003412205.1.36315 WP_003412205.1.36319 WP_003412205.1.36321 WP_003412205.1.36326 WP_003412205.1.3634 WP_003412205.1.36356 WP_003412205.1.36357 WP_003412205.1.3636 WP_003412205.1.36385 WP_003412205.1.36399 WP_003412205.1.36436 WP_003412205.1.36465 WP_003412205.1.36469 WP_003412205.1.36485 WP_003412205.1.36508 WP_003412205.1.36540 WP_003412205.1.36561 WP_003412205.1.36571 WP_003412205.1.36573 WP_003412205.1.36578 WP_003412205.1.36585 WP_003412205.1.36597 WP_003412205.1.36614 WP_003412205.1.36657 WP_003412205.1.36674 WP_003412205.1.36720 WP_003412205.1.36727 WP_003412205.1.36733 WP_003412205.1.36785 WP_003412205.1.36810 WP_003412205.1.36844 WP_003412205.1.36851 WP_003412205.1.36862 WP_003412205.1.36893 WP_003412205.1.36901 WP_003412205.1.36921 WP_003412205.1.36935 WP_003412205.1.36941 WP_003412205.1.3695 WP_003412205.1.36951 WP_003412205.1.36968 WP_003412205.1.3700 WP_003412205.1.37004 WP_003412205.1.37012 WP_003412205.1.37071 WP_003412205.1.37088 WP_003412205.1.37131 WP_003412205.1.37157 WP_003412205.1.37175 WP_003412205.1.37188 WP_003412205.1.37213 WP_003412205.1.37229 WP_003412205.1.3724 WP_003412205.1.37277 WP_003412205.1.37305 WP_003412205.1.37330 WP_003412205.1.37389 WP_003412205.1.37400 WP_003412205.1.37440 WP_003412205.1.37459 WP_003412205.1.37468 WP_003412205.1.37475 WP_003412205.1.37484 WP_003412205.1.37601 WP_003412205.1.37612 WP_003412205.1.37632 WP_003412205.1.37643 WP_003412205.1.37655 WP_003412205.1.37660 WP_003412205.1.37674 WP_003412205.1.37700 WP_003412205.1.37701 WP_003412205.1.37709 WP_003412205.1.37711 WP_003412205.1.37721 WP_003412205.1.37722 WP_003412205.1.37747 WP_003412205.1.37765 WP_003412205.1.37772 WP_003412205.1.37804 WP_003412205.1.37809 WP_003412205.1.37859 WP_003412205.1.37877 WP_003412205.1.37912 WP_003412205.1.37913 WP_003412205.1.37943 WP_003412205.1.37950 WP_003412205.1.37973 WP_003412205.1.37975 WP_003412205.1.37983 WP_003412205.1.38 WP_003412205.1.38002 WP_003412205.1.3802 WP_003412205.1.38039 WP_003412205.1.38040 WP_003412205.1.38067 WP_003412205.1.38068 WP_003412205.1.38135 WP_003412205.1.38138 WP_003412205.1.38144 WP_003412205.1.38158 WP_003412205.1.38159 WP_003412205.1.38210 WP_003412205.1.38233 WP_003412205.1.38240 WP_003412205.1.38299 WP_003412205.1.38332 WP_003412205.1.38347 WP_003412205.1.38354 WP_003412205.1.38380 WP_003412205.1.38384 WP_003412205.1.38389 WP_003412205.1.38398 WP_003412205.1.38402 WP_003412205.1.38418 WP_003412205.1.38421 WP_003412205.1.38466 WP_003412205.1.38477 WP_003412205.1.38483 WP_003412205.1.3849 WP_003412205.1.385 WP_003412205.1.38530 WP_003412205.1.38535 WP_003412205.1.38539 WP_003412205.1.38594 WP_003412205.1.38611 WP_003412205.1.38638 WP_003412205.1.38639 WP_003412205.1.38646 WP_003412205.1.38648 WP_003412205.1.38654 WP_003412205.1.38659 WP_003412205.1.38660 WP_003412205.1.38666 WP_003412205.1.38671 WP_003412205.1.38672 WP_003412205.1.38677 WP_003412205.1.38750 WP_003412205.1.38772 WP_003412205.1.38812 WP_003412205.1.38821 WP_003412205.1.38844 WP_003412205.1.38863 WP_003412205.1.38865 WP_003412205.1.38873 WP_003412205.1.3889 WP_003412205.1.38894 WP_003412205.1.38909 WP_003412205.1.38939 WP_003412205.1.38974 WP_003412205.1.38975 WP_003412205.1.38991 WP_003412205.1.39025 WP_003412205.1.39070 WP_003412205.1.39072 WP_003412205.1.39095 WP_003412205.1.39106 WP_003412205.1.39165 WP_003412205.1.39174 WP_003412205.1.39176 WP_003412205.1.39178 WP_003412205.1.39190 WP_003412205.1.39201 WP_003412205.1.39207 WP_003412205.1.39211 WP_003412205.1.39236 WP_003412205.1.39239 WP_003412205.1.39252 WP_003412205.1.39288 WP_003412205.1.39295 WP_003412205.1.39306 WP_003412205.1.39359 WP_003412205.1.39364 WP_003412205.1.39400 WP_003412205.1.39447 WP_003412205.1.3945 WP_003412205.1.39450 WP_003412205.1.39455 WP_003412205.1.3949 WP_003412205.1.39521 WP_003412205.1.39560 WP_003412205.1.39592 WP_003412205.1.39593 WP_003412205.1.396 WP_003412205.1.3960 WP_003412205.1.39616 WP_003412205.1.39654 WP_003412205.1.39657 WP_003412205.1.39661 WP_003412205.1.39674 WP_003412205.1.39678 WP_003412205.1.3968 WP_003412205.1.39694 WP_003412205.1.3971 WP_003412205.1.39718 WP_003412205.1.39728 WP_003412205.1.39739 WP_003412205.1.39748 WP_003412205.1.39751 WP_003412205.1.39759 WP_003412205.1.39801 WP_003412205.1.39804 WP_003412205.1.39848 WP_003412205.1.39877 WP_003412205.1.39925 WP_003412205.1.3994 WP_003412205.1.39959 WP_003412205.1.3996 WP_003412205.1.39960 WP_003412205.1.3997 WP_003412205.1.39980 WP_003412205.1.40000 WP_003412205.1.40028 WP_003412205.1.40029 WP_003412205.1.4003 WP_003412205.1.40094 WP_003412205.1.40096 WP_003412205.1.40150 WP_003412205.1.40156 WP_003412205.1.40174 WP_003412205.1.40186 WP_003412205.1.40276 WP_003412205.1.40277 WP_003412205.1.40323 WP_003412205.1.40336 WP_003412205.1.40353 WP_003412205.1.4036 WP_003412205.1.40372 WP_003412205.1.40402 WP_003412205.1.40413 WP_003412205.1.40440 WP_003412205.1.40446 WP_003412205.1.40451 WP_003412205.1.40455 WP_003412205.1.40523 WP_003412205.1.40543 WP_003412205.1.40641 WP_003412205.1.40646 WP_003412205.1.40651 WP_003412205.1.40653 WP_003412205.1.4067 WP_003412205.1.40705 WP_003412205.1.40723 WP_003412205.1.40731 WP_003412205.1.40735 WP_003412205.1.40795 WP_003412205.1.40799 WP_003412205.1.40852 WP_003412205.1.40876 WP_003412205.1.40881 WP_003412205.1.40922 WP_003412205.1.40948 WP_003412205.1.4095 WP_003412205.1.40956 WP_003412205.1.40957 WP_003412205.1.40964 WP_003412205.1.4097 WP_003412205.1.410 WP_003412205.1.41000 WP_003412205.1.41055 WP_003412205.1.41108 WP_003412205.1.41123 WP_003412205.1.41177 WP_003412205.1.41202 WP_003412205.1.41219 WP_003412205.1.41231 WP_003412205.1.41249 WP_003412205.1.4127 WP_003412205.1.41296 WP_003412205.1.41355 WP_003412205.1.41376 WP_003412205.1.41430 WP_003412205.1.41447 WP_003412205.1.41469 WP_003412205.1.41504 WP_003412205.1.41564 WP_003412205.1.41583 WP_003412205.1.41616 WP_003412205.1.41632 WP_003412205.1.41635 WP_003412205.1.41636 WP_003412205.1.41648 WP_003412205.1.41660 WP_003412205.1.41685 WP_003412205.1.41695 WP_003412205.1.41704 WP_003412205.1.4171 WP_003412205.1.41719 WP_003412205.1.41733 WP_003412205.1.41744 WP_003412205.1.41774 WP_003412205.1.41791 WP_003412205.1.41803 WP_003412205.1.41820 WP_003412205.1.41828 WP_003412205.1.41829 WP_003412205.1.41860 WP_003412205.1.41912 WP_003412205.1.41921 WP_003412205.1.41933 WP_003412205.1.41944 WP_003412205.1.42043 WP_003412205.1.42075 WP_003412205.1.42078 WP_003412205.1.42094 WP_003412205.1.42112 WP_003412205.1.4212 WP_003412205.1.42122 WP_003412205.1.42134 WP_003412205.1.42183 WP_003412205.1.42188 WP_003412205.1.42201 WP_003412205.1.42202 WP_003412205.1.42208 WP_003412205.1.42247 WP_003412205.1.42255 WP_003412205.1.42273 WP_003412205.1.42278 WP_003412205.1.42304 WP_003412205.1.42309 WP_003412205.1.42370 WP_003412205.1.42385 WP_003412205.1.42400 WP_003412205.1.42409 WP_003412205.1.42414 WP_003412205.1.42417 WP_003412205.1.42430 WP_003412205.1.42467 WP_003412205.1.42473 WP_003412205.1.42474 WP_003412205.1.4248 WP_003412205.1.42494 WP_003412205.1.42519 WP_003412205.1.42524 WP_003412205.1.42534 WP_003412205.1.4255 WP_003412205.1.42562 WP_003412205.1.42568 WP_003412205.1.42570 WP_003412205.1.42618 WP_003412205.1.42660 WP_003412205.1.42695 WP_003412205.1.42704 WP_003412205.1.42705 WP_003412205.1.42722 WP_003412205.1.42777 WP_003412205.1.42782 WP_003412205.1.42835 WP_003412205.1.42839 WP_003412205.1.42842 WP_003412205.1.42905 WP_003412205.1.42916 WP_003412205.1.42930 WP_003412205.1.42971 WP_003412205.1.43005 WP_003412205.1.43009 WP_003412205.1.43053 WP_003412205.1.43082 WP_003412205.1.43087 WP_003412205.1.43098 WP_003412205.1.43208 WP_003412205.1.43236 WP_003412205.1.43246 WP_003412205.1.43255 WP_003412205.1.43266 WP_003412205.1.43269 WP_003412205.1.43273 WP_003412205.1.43296 WP_003412205.1.43306 WP_003412205.1.4335 WP_003412205.1.43368 WP_003412205.1.43395 WP_003412205.1.43457 WP_003412205.1.43462 WP_003412205.1.43475 WP_003412205.1.43478 WP_003412205.1.43484 WP_003412205.1.43557 WP_003412205.1.43578 WP_003412205.1.43588 WP_003412205.1.43643 WP_003412205.1.43664 WP_003412205.1.43684 WP_003412205.1.43686 WP_003412205.1.43706 WP_003412205.1.43716 WP_003412205.1.4377 WP_003412205.1.43781 WP_003412205.1.43794 WP_003412205.1.43815 WP_003412205.1.43846 WP_003412205.1.43861 WP_003412205.1.43863 WP_003412205.1.43866 WP_003412205.1.43872 WP_003412205.1.43885 WP_003412205.1.43897 WP_003412205.1.4390 WP_003412205.1.43902 WP_003412205.1.43921 WP_003412205.1.43936 WP_003412205.1.43937 WP_003412205.1.43960 WP_003412205.1.43965 WP_003412205.1.4399 WP_003412205.1.43993 WP_003412205.1.43996 WP_003412205.1.44 WP_003412205.1.44001 WP_003412205.1.44008 WP_003412205.1.44016 WP_003412205.1.44033 WP_003412205.1.44037 WP_003412205.1.44041 WP_003412205.1.44070 WP_003412205.1.44071 WP_003412205.1.44076 WP_003412205.1.44104 WP_003412205.1.44111 WP_003412205.1.44124 WP_003412205.1.44169 WP_003412205.1.44219 WP_003412205.1.44237 WP_003412205.1.44277 WP_003412205.1.44279 WP_003412205.1.44336 WP_003412205.1.44355 WP_003412205.1.44358 WP_003412205.1.4438 WP_003412205.1.44390 WP_003412205.1.44392 WP_003412205.1.4441 WP_003412205.1.44415 WP_003412205.1.44464 WP_003412205.1.44466 WP_003412205.1.44489 WP_003412205.1.44492 WP_003412205.1.44494 WP_003412205.1.44500 WP_003412205.1.44519 WP_003412205.1.44526 WP_003412205.1.44532 WP_003412205.1.44534 WP_003412205.1.44562 WP_003412205.1.44589 WP_003412205.1.44597 WP_003412205.1.44600 WP_003412205.1.44602 WP_003412205.1.44615 WP_003412205.1.4464 WP_003412205.1.44651 WP_003412205.1.44659 WP_003412205.1.44665 WP_003412205.1.44694 WP_003412205.1.44700 WP_003412205.1.44713 WP_003412205.1.44735 WP_003412205.1.44740 WP_003412205.1.44757 WP_003412205.1.4476 WP_003412205.1.44761 WP_003412205.1.44767 WP_003412205.1.44776 WP_003412205.1.44779 WP_003412205.1.44786 WP_003412205.1.44808 WP_003412205.1.44864 WP_003412205.1.44901 WP_003412205.1.44908 WP_003412205.1.44913 WP_003412205.1.4492 WP_003412205.1.44939 WP_003412205.1.44979 WP_003412205.1.44981 WP_003412205.1.45002 WP_003412205.1.45011 WP_003412205.1.4504 WP_003412205.1.45062 WP_003412205.1.45066 WP_003412205.1.45081 WP_003412205.1.45129 WP_003412205.1.45135 WP_003412205.1.45147 WP_003412205.1.45168 WP_003412205.1.4517 WP_003412205.1.45181 WP_003412205.1.45185 WP_003412205.1.45192 WP_003412205.1.45200 WP_003412205.1.45205 WP_003412205.1.45211 WP_003412205.1.45249 WP_003412205.1.4526 WP_003412205.1.45286 WP_003412205.1.45326 WP_003412205.1.45347 WP_003412205.1.45374 WP_003412205.1.45390 WP_003412205.1.454 WP_003412205.1.45407 WP_003412205.1.45451 WP_003412205.1.45453 WP_003412205.1.45460 WP_003412205.1.45463 WP_003412205.1.45470 WP_003412205.1.45474 WP_003412205.1.45491 WP_003412205.1.45510 WP_003412205.1.45563 WP_003412205.1.45584 WP_003412205.1.45590 WP_003412205.1.45619 WP_003412205.1.45626 WP_003412205.1.45631 WP_003412205.1.45666 WP_003412205.1.45697 WP_003412205.1.4571 WP_003412205.1.45731 WP_003412205.1.45743 WP_003412205.1.45765 WP_003412205.1.45776 WP_003412205.1.45783 WP_003412205.1.45805 WP_003412205.1.45815 WP_003412205.1.45849 WP_003412205.1.45867 WP_003412205.1.45884 WP_003412205.1.4590 WP_003412205.1.45923 WP_003412205.1.45926 WP_003412205.1.45963 WP_003412205.1.45989 WP_003412205.1.45992 WP_003412205.1.46025 WP_003412205.1.46083 WP_003412205.1.46090 WP_003412205.1.46092 WP_003412205.1.46100 WP_003412205.1.46101 WP_003412205.1.46103 WP_003412205.1.46107 WP_003412205.1.46127 WP_003412205.1.46128 WP_003412205.1.46129 WP_003412205.1.46141 WP_003412205.1.46150 WP_003412205.1.46201 WP_003412205.1.46226 WP_003412205.1.4624 WP_003412205.1.46253 WP_003412205.1.46268 WP_003412205.1.46285 WP_003412205.1.46300 WP_003412205.1.46313 WP_003412205.1.46336 WP_003412205.1.46365 WP_003412205.1.46370 WP_003412205.1.46381 WP_003412205.1.46402 WP_003412205.1.46411 WP_003412205.1.4644 WP_003412205.1.46442 WP_003412205.1.46453 WP_003412205.1.46463 WP_003412205.1.46478 WP_003412205.1.46492 WP_003412205.1.46521 WP_003412205.1.4653 WP_003412205.1.46532 WP_003412205.1.46539 WP_003412205.1.46568 WP_003412205.1.46585 WP_003412205.1.46609 WP_003412205.1.46613 WP_003412205.1.46625 WP_003412205.1.46642 WP_003412205.1.46647 WP_003412205.1.46674 WP_003412205.1.46724 WP_003412205.1.46758 WP_003412205.1.46773 WP_003412205.1.46777 WP_003412205.1.46786 WP_003412205.1.46792 WP_003412205.1.46847 WP_003412205.1.46851 WP_003412205.1.4687 WP_003412205.1.46897 WP_003412205.1.46936 WP_003412205.1.46980 WP_003412205.1.47011 WP_003412205.1.47012 WP_003412205.1.47066 WP_003412205.1.47077 WP_003412205.1.47083 WP_003412205.1.47106 WP_003412205.1.47142 WP_003412205.1.47147 WP_003412205.1.47166 WP_003412205.1.47178 WP_003412205.1.47179 WP_003412205.1.47194 WP_003412205.1.47207 WP_003412205.1.47210 WP_003412205.1.47261 WP_003412205.1.47262 WP_003412205.1.47402 WP_003412205.1.47423 WP_003412205.1.47467 WP_003412205.1.47502 WP_003412205.1.4751 WP_003412205.1.47511 WP_003412205.1.47537 WP_003412205.1.47540 WP_003412205.1.47568 WP_003412205.1.47572 WP_003412205.1.47588 WP_003412205.1.47636 WP_003412205.1.4764 WP_003412205.1.47653 WP_003412205.1.47679 WP_003412205.1.47681 WP_003412205.1.47690 WP_003412205.1.4771 WP_003412205.1.47717 WP_003412205.1.47743 WP_003412205.1.47754 WP_003412205.1.47773 WP_003412205.1.47776 WP_003412205.1.47780 WP_003412205.1.47805 WP_003412205.1.47832 WP_003412205.1.47847 WP_003412205.1.47858 WP_003412205.1.47861 WP_003412205.1.47868 WP_003412205.1.47893 WP_003412205.1.47899 WP_003412205.1.479 WP_003412205.1.47912 WP_003412205.1.47913 WP_003412205.1.47926 WP_003412205.1.4794 WP_003412205.1.47943 WP_003412205.1.47944 WP_003412205.1.47959 WP_003412205.1.47974 WP_003412205.1.47993 WP_003412205.1.48004 WP_003412205.1.48039 WP_003412205.1.48050 WP_003412205.1.48084 WP_003412205.1.48097 WP_003412205.1.48101 WP_003412205.1.48109 WP_003412205.1.4813 WP_003412205.1.48130 WP_003412205.1.48135 WP_003412205.1.48143 WP_003412205.1.48152 WP_003412205.1.48155 WP_003412205.1.48170 WP_003412205.1.48173 WP_003412205.1.48177 WP_003412205.1.48185 WP_003412205.1.48204 WP_003412205.1.48219 WP_003412205.1.4823 WP_003412205.1.48240 WP_003412205.1.48256 WP_003412205.1.48264 WP_003412205.1.48287 WP_003412205.1.48330 WP_003412205.1.48333 WP_003412205.1.48348 WP_003412205.1.48354 WP_003412205.1.48372 WP_003412205.1.48383 WP_003412205.1.48388 WP_003412205.1.48419 WP_003412205.1.48423 WP_003412205.1.48443 WP_003412205.1.48450 WP_003412205.1.48462 WP_003412205.1.48543 WP_003412205.1.48550 WP_003412205.1.48605 WP_003412205.1.48618 WP_003412205.1.4863 WP_003412205.1.48648 WP_003412205.1.48658 WP_003412205.1.48666 WP_003412205.1.48687 WP_003412205.1.48779 WP_003412205.1.4878 WP_003412205.1.48798 WP_003412205.1.48802 WP_003412205.1.48826 WP_003412205.1.48831 WP_003412205.1.48843 WP_003412205.1.48857 WP_003412205.1.4890 WP_003412205.1.48946 WP_003412205.1.48979 WP_003412205.1.49017 WP_003412205.1.49048 WP_003412205.1.49059 WP_003412205.1.4906 WP_003412205.1.4907 WP_003412205.1.49103 WP_003412205.1.49110 WP_003412205.1.49111 WP_003412205.1.49112 WP_003412205.1.4919 WP_003412205.1.49251 WP_003412205.1.49254 WP_003412205.1.49263 WP_003412205.1.49291 WP_003412205.1.49296 WP_003412205.1.49335 WP_003412205.1.49337 WP_003412205.1.49419 WP_003412205.1.49426 WP_003412205.1.49437 WP_003412205.1.49439 WP_003412205.1.49474 WP_003412205.1.49506 WP_003412205.1.49516 WP_003412205.1.49523 WP_003412205.1.49526 WP_003412205.1.49532 WP_003412205.1.49588 WP_003412205.1.4959 WP_003412205.1.49678 WP_003412205.1.49687 WP_003412205.1.49699 WP_003412205.1.49709 WP_003412205.1.4971 WP_003412205.1.4972 WP_003412205.1.49736 WP_003412205.1.49746 WP_003412205.1.49764 WP_003412205.1.49773 WP_003412205.1.49796 WP_003412205.1.49814 WP_003412205.1.49815 WP_003412205.1.49816 WP_003412205.1.49839 WP_003412205.1.49857 WP_003412205.1.49878 WP_003412205.1.49880 WP_003412205.1.49944 WP_003412205.1.4999 WP_003412205.1.49990 WP_003412205.1.50068 WP_003412205.1.50077 WP_003412205.1.5008 WP_003412205.1.50081 WP_003412205.1.50122 WP_003412205.1.50126 WP_003412205.1.50149 WP_003412205.1.50162 WP_003412205.1.5018 WP_003412205.1.50194 WP_003412205.1.50218 WP_003412205.1.50235 WP_003412205.1.50249 WP_003412205.1.50265 WP_003412205.1.50271 WP_003412205.1.50324 WP_003412205.1.50347 WP_003412205.1.50372 WP_003412205.1.50398 WP_003412205.1.50407 WP_003412205.1.50444 WP_003412205.1.50466 WP_003412205.1.50472 WP_003412205.1.5048 WP_003412205.1.50498 WP_003412205.1.5050 WP_003412205.1.50540 WP_003412205.1.50554 WP_003412205.1.50557 WP_003412205.1.50601 WP_003412205.1.50610 WP_003412205.1.50632 WP_003412205.1.50633 WP_003412205.1.50642 WP_003412205.1.50655 WP_003412205.1.50659 WP_003412205.1.50683 WP_003412205.1.50689 WP_003412205.1.50692 WP_003412205.1.50714 WP_003412205.1.50729 WP_003412205.1.50756 WP_003412205.1.50784 WP_003412205.1.50794 WP_003412205.1.50841 WP_003412205.1.50860 WP_003412205.1.50877 WP_003412205.1.5096 WP_003412205.1.50981 WP_003412205.1.50987 WP_003412205.1.51003 WP_003412205.1.51009 WP_003412205.1.51037 WP_003412205.1.51074 WP_003412205.1.51082 WP_003412205.1.51101 WP_003412205.1.51116 WP_003412205.1.51149 WP_003412205.1.51157 WP_003412205.1.51213 WP_003412205.1.51232 WP_003412205.1.51239 WP_003412205.1.51247 WP_003412205.1.51266 WP_003412205.1.51279 WP_003412205.1.51291 WP_003412205.1.51294 WP_003412205.1.51301 WP_003412205.1.51329 WP_003412205.1.51391 WP_003412205.1.51422 WP_003412205.1.51445 WP_003412205.1.51455 WP_003412205.1.51466 WP_003412205.1.51468 WP_003412205.1.51478 WP_003412205.1.51497 WP_003412205.1.51520 WP_003412205.1.51593 WP_003412205.1.51628 WP_003412205.1.5164 WP_003412205.1.51647 WP_003412205.1.51660 WP_003412205.1.51696 WP_003412205.1.51721 WP_003412205.1.51788 WP_003412205.1.51795 WP_003412205.1.51801 WP_003412205.1.51817 WP_003412205.1.51819 WP_003412205.1.51854 WP_003412205.1.51923 WP_003412205.1.51942 WP_003412205.1.51948 WP_003412205.1.51963 WP_003412205.1.51969 WP_003412205.1.52000 WP_003412205.1.52001 WP_003412205.1.52003 WP_003412205.1.52006 WP_003412205.1.52036 WP_003412205.1.52038 WP_003412205.1.52046 WP_003412205.1.52059 WP_003412205.1.52069 WP_003412205.1.52082 WP_003412205.1.52102 WP_003412205.1.52106 WP_003412205.1.52166 WP_003412205.1.52168 WP_003412205.1.52173 WP_003412205.1.52178 WP_003412205.1.52206 WP_003412205.1.52216 WP_003412205.1.52238 WP_003412205.1.52241 WP_003412205.1.52280 WP_003412205.1.52314 WP_003412205.1.52385 WP_003412205.1.52390 WP_003412205.1.524 WP_003412205.1.52460 WP_003412205.1.52485 WP_003412205.1.52486 WP_003412205.1.52495 WP_003412205.1.52504 WP_003412205.1.52522 WP_003412205.1.52531 WP_003412205.1.52533 WP_003412205.1.52545 WP_003412205.1.52553 WP_003412205.1.52563 WP_003412205.1.52564 WP_003412205.1.52574 WP_003412205.1.52641 WP_003412205.1.52673 WP_003412205.1.52674 WP_003412205.1.52708 WP_003412205.1.52713 WP_003412205.1.52761 WP_003412205.1.52778 WP_003412205.1.52791 WP_003412205.1.52797 WP_003412205.1.52818 WP_003412205.1.52872 WP_003412205.1.52873 WP_003412205.1.52891 WP_003412205.1.52892 WP_003412205.1.52909 WP_003412205.1.52970 WP_003412205.1.52998 WP_003412205.1.53053 WP_003412205.1.53056 WP_003412205.1.5306 WP_003412205.1.53088 WP_003412205.1.5309 WP_003412205.1.531 WP_003412205.1.53117 WP_003412205.1.53118 WP_003412205.1.53142 WP_003412205.1.53143 WP_003412205.1.53157 WP_003412205.1.53167 WP_003412205.1.53200 WP_003412205.1.53204 WP_003412205.1.53213 WP_003412205.1.53217 WP_003412205.1.53226 WP_003412205.1.53229 WP_003412205.1.53230 WP_003412205.1.53237 WP_003412205.1.53254 WP_003412205.1.53257 WP_003412205.1.5327 WP_003412205.1.53276 WP_003412205.1.53278 WP_003412205.1.533 WP_003412205.1.53302 WP_003412205.1.53306 WP_003412205.1.5334 WP_003412205.1.5335 WP_003412205.1.53353 WP_003412205.1.53381 WP_003412205.1.53413 WP_003412205.1.53458 WP_003412205.1.53460 WP_003412205.1.53480 WP_003412205.1.53517 WP_003412205.1.53522 WP_003412205.1.53525 WP_003412205.1.53526 WP_003412205.1.53553 WP_003412205.1.53606 WP_003412205.1.53609 WP_003412205.1.53628 WP_003412205.1.53643 WP_003412205.1.53667 WP_003412205.1.53679 WP_003412205.1.53715 WP_003412205.1.53730 WP_003412205.1.53742 WP_003412205.1.53743 WP_003412205.1.53754 WP_003412205.1.53775 WP_003412205.1.53787 WP_003412205.1.53803 WP_003412205.1.53818 WP_003412205.1.53822 WP_003412205.1.53853 WP_003412205.1.53865 WP_003412205.1.53888 WP_003412205.1.53900 WP_003412205.1.53912 WP_003412205.1.53914 WP_003412205.1.53952 WP_003412205.1.53973 WP_003412205.1.5398 WP_003412205.1.5408 WP_003412205.1.54089 WP_003412205.1.54093 WP_003412205.1.54099 WP_003412205.1.54112 WP_003412205.1.54125 WP_003412205.1.54141 WP_003412205.1.54162 WP_003412205.1.54179 WP_003412205.1.54206 WP_003412205.1.54218 WP_003412205.1.54225 WP_003412205.1.54227 WP_003412205.1.54232 WP_003412205.1.54241 WP_003412205.1.54245 WP_003412205.1.54247 WP_003412205.1.54260 WP_003412205.1.54275 WP_003412205.1.54280 WP_003412205.1.5429 WP_003412205.1.54294 WP_003412205.1.54314 WP_003412205.1.54347 WP_003412205.1.54351 WP_003412205.1.54370 WP_003412205.1.54428 WP_003412205.1.54449 WP_003412205.1.54494 WP_003412205.1.54502 WP_003412205.1.54514 WP_003412205.1.54519 WP_003412205.1.5452 WP_003412205.1.54531 WP_003412205.1.54537 WP_003412205.1.54553 WP_003412205.1.54555 WP_003412205.1.54575 WP_003412205.1.54633 WP_003412205.1.54686 WP_003412205.1.54687 WP_003412205.1.54705 WP_003412205.1.54730 WP_003412205.1.54732 WP_003412205.1.5475 WP_003412205.1.54797 WP_003412205.1.54807 WP_003412205.1.54836 WP_003412205.1.54838 WP_003412205.1.54860 WP_003412205.1.54888 WP_003412205.1.54897 WP_003412205.1.54905 WP_003412205.1.54909 WP_003412205.1.54937 WP_003412205.1.54939 WP_003412205.1.54944 WP_003412205.1.54945 WP_003412205.1.54953 WP_003412205.1.54964 WP_003412205.1.55015 WP_003412205.1.55022 WP_003412205.1.55023 WP_003412205.1.55051 WP_003412205.1.55072 WP_003412205.1.55088 WP_003412205.1.55106 WP_003412205.1.55126 WP_003412205.1.55128 WP_003412205.1.55140 WP_003412205.1.55150 WP_003412205.1.55210 WP_003412205.1.55227 WP_003412205.1.55248 WP_003412205.1.55257 WP_003412205.1.55258 WP_003412205.1.55267 WP_003412205.1.55279 WP_003412205.1.55307 WP_003412205.1.55326 WP_003412205.1.55328 WP_003412205.1.5533 WP_003412205.1.55345 WP_003412205.1.55396 WP_003412205.1.55398 WP_003412205.1.55441 WP_003412205.1.55459 WP_003412205.1.55501 WP_003412205.1.55504 WP_003412205.1.55578 WP_003412205.1.55626 WP_003412205.1.55641 WP_003412205.1.5569 WP_003412205.1.55723 WP_003412205.1.55735 WP_003412205.1.5574 WP_003412205.1.55772 WP_003412205.1.55802 WP_003412205.1.55807 WP_003412205.1.55819 WP_003412205.1.55821 WP_003412205.1.5583 WP_003412205.1.55849 WP_003412205.1.55856 WP_003412205.1.55860 WP_003412205.1.55882 WP_003412205.1.55883 WP_003412205.1.55894 WP_003412205.1.55902 WP_003412205.1.55908 WP_003412205.1.55909 WP_003412205.1.5591 WP_003412205.1.55961 WP_003412205.1.55977 WP_003412205.1.55983 WP_003412205.1.56028 WP_003412205.1.56057 WP_003412205.1.56060 WP_003412205.1.56107 WP_003412205.1.56132 WP_003412205.1.56163 WP_003412205.1.56167 WP_003412205.1.56178 WP_003412205.1.56287 WP_003412205.1.56292 WP_003412205.1.56327 WP_003412205.1.56341 WP_003412205.1.56359 WP_003412205.1.56365 WP_003412205.1.56394 WP_003412205.1.56443 WP_003412205.1.56473 WP_003412205.1.56478 WP_003412205.1.56500 WP_003412205.1.56517 WP_003412205.1.56534 WP_003412205.1.5656 WP_003412205.1.56577 WP_003412205.1.56593 WP_003412205.1.56625 WP_003412205.1.56637 WP_003412205.1.56670 WP_003412205.1.56697 WP_003412205.1.567 WP_003412205.1.56701 WP_003412205.1.56709 WP_003412205.1.56729 WP_003412205.1.56743 WP_003412205.1.56755 WP_003412205.1.56764 WP_003412205.1.56769 WP_003412205.1.56770 WP_003412205.1.56795 WP_003412205.1.5681 WP_003412205.1.56827 WP_003412205.1.56839 WP_003412205.1.56863 WP_003412205.1.56868 WP_003412205.1.56869 WP_003412205.1.56915 WP_003412205.1.56926 WP_003412205.1.56961 WP_003412205.1.56971 WP_003412205.1.56972 WP_003412205.1.57023 WP_003412205.1.57035 WP_003412205.1.57077 WP_003412205.1.57087 WP_003412205.1.57094 WP_003412205.1.57134 WP_003412205.1.57151 WP_003412205.1.57169 WP_003412205.1.57208 WP_003412205.1.57212 WP_003412205.1.57230 WP_003412205.1.5724 WP_003412205.1.5725 WP_003412205.1.5727 WP_003412205.1.57273 WP_003412205.1.573 WP_003412205.1.57314 WP_003412205.1.57326 WP_003412205.1.57328 WP_003412205.1.57331 WP_003412205.1.57340 WP_003412205.1.57351 WP_003412205.1.57352 WP_003412205.1.57380 WP_003412205.1.57430 WP_003412205.1.5744 WP_003412205.1.57440 WP_003412205.1.5745 WP_003412205.1.57461 WP_003412205.1.57469 WP_003412205.1.57489 WP_003412205.1.575 WP_003412205.1.57509 WP_003412205.1.57519 WP_003412205.1.57525 WP_003412205.1.57551 WP_003412205.1.5758 WP_003412205.1.57596 WP_003412205.1.57604 WP_003412205.1.57616 WP_003412205.1.57617 WP_003412205.1.57619 WP_003412205.1.57627 WP_003412205.1.57642 WP_003412205.1.57658 WP_003412205.1.57667 WP_003412205.1.57675 WP_003412205.1.57689 WP_003412205.1.57708 WP_003412205.1.57794 WP_003412205.1.57821 WP_003412205.1.57825 WP_003412205.1.57843 WP_003412205.1.57906 WP_003412205.1.57924 WP_003412205.1.57926 WP_003412205.1.57930 WP_003412205.1.57957 WP_003412205.1.57960 WP_003412205.1.57964 WP_003412205.1.57991 WP_003412205.1.58000 WP_003412205.1.58086 WP_003412205.1.58101 WP_003412205.1.58103 WP_003412205.1.58108 WP_003412205.1.5811 WP_003412205.1.58121 WP_003412205.1.58145 WP_003412205.1.58164 WP_003412205.1.58174 WP_003412205.1.582 WP_003412205.1.58202 WP_003412205.1.58209 WP_003412205.1.58215 WP_003412205.1.5824 WP_003412205.1.58250 WP_003412205.1.58259 WP_003412205.1.58283 WP_003412205.1.58288 WP_003412205.1.5830 WP_003412205.1.58303 WP_003412205.1.58311 WP_003412205.1.58330 WP_003412205.1.58359 WP_003412205.1.58386 WP_003412205.1.58393 WP_003412205.1.58431 WP_003412205.1.5844 WP_003412205.1.58457 WP_003412205.1.58488 WP_003412205.1.58518 WP_003412205.1.58534 WP_003412205.1.58559 WP_003412205.1.58567 WP_003412205.1.58573 WP_003412205.1.58602 WP_003412205.1.58612 WP_003412205.1.58619 WP_003412205.1.58630 WP_003412205.1.5865 WP_003412205.1.58671 WP_003412205.1.58690 WP_003412205.1.58702 WP_003412205.1.58743 WP_003412205.1.58754 WP_003412205.1.5879 WP_003412205.1.5881 WP_003412205.1.58824 WP_003412205.1.58848 WP_003412205.1.58857 WP_003412205.1.58891 WP_003412205.1.58892 WP_003412205.1.5890 WP_003412205.1.58904 WP_003412205.1.58921 WP_003412205.1.58930 WP_003412205.1.58939 WP_003412205.1.58941 WP_003412205.1.58953 WP_003412205.1.58961 WP_003412205.1.5898 WP_003412205.1.59025 WP_003412205.1.59029 WP_003412205.1.59037 WP_003412205.1.59044 WP_003412205.1.59085 WP_003412205.1.59088 WP_003412205.1.59112 WP_003412205.1.59130 WP_003412205.1.5914 WP_003412205.1.59147 WP_003412205.1.59166 WP_003412205.1.59205 WP_003412205.1.59209 WP_003412205.1.59237 WP_003412205.1.59240 WP_003412205.1.59253 WP_003412205.1.59254 WP_003412205.1.59262 WP_003412205.1.59270 WP_003412205.1.5928 WP_003412205.1.59304 WP_003412205.1.59305 WP_003412205.1.59309 WP_003412205.1.59316 WP_003412205.1.59326 WP_003412205.1.59328 WP_003412205.1.59333 WP_003412205.1.59338 WP_003412205.1.59388 WP_003412205.1.59428 WP_003412205.1.59487 WP_003412205.1.59537 WP_003412205.1.59561 WP_003412205.1.59677 WP_003412205.1.59722 WP_003412205.1.59727 WP_003412205.1.59732 WP_003412205.1.59738 WP_003412205.1.59750 WP_003412205.1.59757 WP_003412205.1.59761 WP_003412205.1.59808 WP_003412205.1.59850 WP_003412205.1.59856 WP_003412205.1.59860 WP_003412205.1.59861 WP_003412205.1.5987 WP_003412205.1.59878 WP_003412205.1.59888 WP_003412205.1.5996 WP_003412205.1.59961 WP_003412205.1.59974 WP_003412205.1.6000 WP_003412205.1.60007 WP_003412205.1.60016 WP_003412205.1.6003 WP_003412205.1.60047 WP_003412205.1.6007 WP_003412205.1.60091 WP_003412205.1.60121 WP_003412205.1.60125 WP_003412205.1.60135 WP_003412205.1.60139 WP_003412205.1.60152 WP_003412205.1.60171 WP_003412205.1.60197 WP_003412205.1.6020 WP_003412205.1.60205 WP_003412205.1.60207 WP_003412205.1.60215 WP_003412205.1.60217 WP_003412205.1.60267 WP_003412205.1.60288 WP_003412205.1.60291 WP_003412205.1.60301 WP_003412205.1.60305 WP_003412205.1.60312 WP_003412205.1.60313 WP_003412205.1.60314 WP_003412205.1.60367 WP_003412205.1.60376 WP_003412205.1.60403 WP_003412205.1.60413 WP_003412205.1.60421 WP_003412205.1.60451 WP_003412205.1.60460 WP_003412205.1.60479 WP_003412205.1.60487 WP_003412205.1.60512 WP_003412205.1.60573 WP_003412205.1.60583 WP_003412205.1.60632 WP_003412205.1.60657 WP_003412205.1.60687 WP_003412205.1.60689 WP_003412205.1.60727 WP_003412205.1.60738 WP_003412205.1.60763 WP_003412205.1.6077 WP_003412205.1.60791 WP_003412205.1.60834 WP_003412205.1.60870 WP_003412205.1.60878 WP_003412205.1.60879 WP_003412205.1.60913 WP_003412205.1.60978 WP_003412205.1.61000 WP_003412205.1.61001 WP_003412205.1.61012 WP_003412205.1.61014 WP_003412205.1.61015 WP_003412205.1.61037 WP_003412205.1.61052 WP_003412205.1.61065 WP_003412205.1.61100 WP_003412205.1.61101 WP_003412205.1.61138 WP_003412205.1.61142 WP_003412205.1.61198 WP_003412205.1.612 WP_003412205.1.61234 WP_003412205.1.61256 WP_003412205.1.61281 WP_003412205.1.61314 WP_003412205.1.61321 WP_003412205.1.61326 WP_003412205.1.61328 WP_003412205.1.61368 WP_003412205.1.61391 WP_003412205.1.61406 WP_003412205.1.61409 WP_003412205.1.61420 WP_003412205.1.61422 WP_003412205.1.61425 WP_003412205.1.61428 WP_003412205.1.61469 WP_003412205.1.61494 WP_003412205.1.61522 WP_003412205.1.61552 WP_003412205.1.61557 WP_003412205.1.61567 WP_003412205.1.61571 WP_003412205.1.61573 WP_003412205.1.61584 WP_003412205.1.61586 WP_003412205.1.6159 WP_003412205.1.61592 WP_003412205.1.6160 WP_003412205.1.61614 WP_003412205.1.6163 WP_003412205.1.61655 WP_003412205.1.61665 WP_003412205.1.61669 WP_003412205.1.61682 WP_003412205.1.61692 WP_003412205.1.61719 WP_003412205.1.61728 WP_003412205.1.61750 WP_003412205.1.61754 WP_003412205.1.61755 WP_003412205.1.61757 WP_003412205.1.61778 WP_003412205.1.6179 WP_003412205.1.61793 WP_003412205.1.61816 WP_003412205.1.61842 WP_003412205.1.61850 WP_003412205.1.61862 WP_003412205.1.61865 WP_003412205.1.61868 WP_003412205.1.61911 WP_003412205.1.61925 WP_003412205.1.61941 WP_003412205.1.61953 WP_003412205.1.61979 WP_003412205.1.61986 WP_003412205.1.61987 WP_003412205.1.61998 WP_003412205.1.62021 WP_003412205.1.62087 WP_003412205.1.62089 WP_003412205.1.62101 WP_003412205.1.62104 WP_003412205.1.6211 WP_003412205.1.62132 WP_003412205.1.62162 WP_003412205.1.62225 WP_003412205.1.62230 WP_003412205.1.62238 WP_003412205.1.62249 WP_003412205.1.62270 WP_003412205.1.62281 WP_003412205.1.62307 WP_003412205.1.6231 WP_003412205.1.62359 WP_003412205.1.62360 WP_003412205.1.62371 WP_003412205.1.62379 WP_003412205.1.62395 WP_003412205.1.62408 WP_003412205.1.62449 WP_003412205.1.62468 WP_003412205.1.6248 WP_003412205.1.62508 WP_003412205.1.62565 WP_003412205.1.62594 WP_003412205.1.62606 WP_003412205.1.62616 WP_003412205.1.62666 WP_003412205.1.62687 WP_003412205.1.62715 WP_003412205.1.62730 WP_003412205.1.62738 WP_003412205.1.62761 WP_003412205.1.62766 WP_003412205.1.62786 WP_003412205.1.62813 WP_003412205.1.62839 WP_003412205.1.62841 WP_003412205.1.62909 WP_003412205.1.62936 WP_003412205.1.6294 WP_003412205.1.6295 WP_003412205.1.62962 WP_003412205.1.63007 WP_003412205.1.63019 WP_003412205.1.63032 WP_003412205.1.63037 WP_003412205.1.63064 WP_003412205.1.63066 WP_003412205.1.63072 WP_003412205.1.6308 WP_003412205.1.63081 WP_003412205.1.63096 WP_003412205.1.63106 WP_003412205.1.6314 WP_003412205.1.63144 WP_003412205.1.63154 WP_003412205.1.63160 WP_003412205.1.63161 WP_003412205.1.63166 WP_003412205.1.63175 WP_003412205.1.63194 WP_003412205.1.6322 WP_003412205.1.63222 WP_003412205.1.63247 WP_003412205.1.6328 WP_003412205.1.63291 WP_003412205.1.63312 WP_003412205.1.63317 WP_003412205.1.63331 WP_003412205.1.63373 WP_003412205.1.63384 WP_003412205.1.63403 WP_003412205.1.63424 WP_003412205.1.63428 WP_003412205.1.6345 WP_003412205.1.63464 WP_003412205.1.63483 WP_003412205.1.63502 WP_003412205.1.63504 WP_003412205.1.63522 WP_003412205.1.63530 WP_003412205.1.63538 WP_003412205.1.63564 WP_003412205.1.63567 WP_003412205.1.63596 WP_003412205.1.63600 WP_003412205.1.63623 WP_003412205.1.63624 WP_003412205.1.63625 WP_003412205.1.63627 WP_003412205.1.63654 WP_003412205.1.63662 WP_003412205.1.63711 WP_003412205.1.63734 WP_003412205.1.63807 WP_003412205.1.63819 WP_003412205.1.63844 WP_003412205.1.63888 WP_003412205.1.63913 WP_003412205.1.63915 WP_003412205.1.63918 WP_003412205.1.63961 WP_003412205.1.63970 WP_003412205.1.64000 WP_003412205.1.64027 WP_003412205.1.64058 WP_003412205.1.64065 WP_003412205.1.6407 WP_003412205.1.64082 WP_003412205.1.64091 WP_003412205.1.64102 WP_003412205.1.64104 WP_003412205.1.64119 WP_003412205.1.64169 WP_003412205.1.64219 WP_003412205.1.6422 WP_003412205.1.64222 WP_003412205.1.64223 WP_003412205.1.64228 WP_003412205.1.64235 WP_003412205.1.64249 WP_003412205.1.6427 WP_003412205.1.64278 WP_003412205.1.64287 WP_003412205.1.64414 WP_003412205.1.64419 WP_003412205.1.6443 WP_003412205.1.64463 WP_003412205.1.64480 WP_003412205.1.64497 WP_003412205.1.64506 WP_003412205.1.64511 WP_003412205.1.64513 WP_003412205.1.64514 WP_003412205.1.64515 WP_003412205.1.64522 WP_003412205.1.64526 WP_003412205.1.64543 WP_003412205.1.6456 WP_003412205.1.64567 WP_003412205.1.64588 WP_003412205.1.64589 WP_003412205.1.64594 WP_003412205.1.64595 WP_003412205.1.64608 WP_003412205.1.64619 WP_003412205.1.64629 WP_003412205.1.6464 WP_003412205.1.64664 WP_003412205.1.64669 WP_003412205.1.64672 WP_003412205.1.64680 WP_003412205.1.64682 WP_003412205.1.64727 WP_003412205.1.64729 WP_003412205.1.64774 WP_003412205.1.64776 WP_003412205.1.64802 WP_003412205.1.64832 WP_003412205.1.6486 WP_003412205.1.64870 WP_003412205.1.64898 WP_003412205.1.64922 WP_003412205.1.64924 WP_003412205.1.6493 WP_003412205.1.64937 WP_003412205.1.64941 WP_003412205.1.64966 WP_003412205.1.64973 WP_003412205.1.65001 WP_003412205.1.65026 WP_003412205.1.65053 WP_003412205.1.65070 WP_003412205.1.65079 WP_003412205.1.65102 WP_003412205.1.65157 WP_003412205.1.65181 WP_003412205.1.65212 WP_003412205.1.65229 WP_003412205.1.6523 WP_003412205.1.65253 WP_003412205.1.65289 WP_003412205.1.65291 WP_003412205.1.65315 WP_003412205.1.65329 WP_003412205.1.65359 WP_003412205.1.6536 WP_003412205.1.65374 WP_003412205.1.65386 WP_003412205.1.65414 WP_003412205.1.65416 WP_003412205.1.65433 WP_003412205.1.65455 WP_003412205.1.65467 WP_003412205.1.65488 WP_003412205.1.65529 WP_003412205.1.65539 WP_003412205.1.65583 WP_003412205.1.65612 WP_003412205.1.65623 WP_003412205.1.65635 WP_003412205.1.65637 WP_003412205.1.65648 WP_003412205.1.65683 WP_003412205.1.65686 WP_003412205.1.65688 WP_003412205.1.65707 WP_003412205.1.65733 WP_003412205.1.65746 WP_003412205.1.65747 WP_003412205.1.65759 WP_003412205.1.65816 WP_003412205.1.65830 WP_003412205.1.65858 WP_003412205.1.65862 WP_003412205.1.65869 WP_003412205.1.65893 WP_003412205.1.65929 WP_003412205.1.65932 WP_003412205.1.65958 WP_003412205.1.65974 WP_003412205.1.66004 WP_003412205.1.66013 WP_003412205.1.6606 WP_003412205.1.66089 WP_003412205.1.66149 WP_003412205.1.66151 WP_003412205.1.66229 WP_003412205.1.66276 WP_003412205.1.66293 WP_003412205.1.66297 WP_003412205.1.66323 WP_003412205.1.66325 WP_003412205.1.6633 WP_003412205.1.66334 WP_003412205.1.66355 WP_003412205.1.66367 WP_003412205.1.66394 WP_003412205.1.66396 WP_003412205.1.66451 WP_003412205.1.66455 WP_003412205.1.66457 WP_003412205.1.66460 WP_003412205.1.66464 WP_003412205.1.66466 WP_003412205.1.66487 WP_003412205.1.66504 WP_003412205.1.66544 WP_003412205.1.66558 WP_003412205.1.66580 WP_003412205.1.66582 WP_003412205.1.66612 WP_003412205.1.66615 WP_003412205.1.66617 WP_003412205.1.66635 WP_003412205.1.66656 WP_003412205.1.66663 WP_003412205.1.66675 WP_003412205.1.66715 WP_003412205.1.66718 WP_003412205.1.66762 WP_003412205.1.66776 WP_003412205.1.66808 WP_003412205.1.66817 WP_003412205.1.66819 WP_003412205.1.66826 WP_003412205.1.66830 WP_003412205.1.66842 WP_003412205.1.66868 WP_003412205.1.66878 WP_003412205.1.66880 WP_003412205.1.66893 WP_003412205.1.66961 WP_003412205.1.67005 WP_003412205.1.6704 WP_003412205.1.67044 WP_003412205.1.67061 WP_003412205.1.67089 WP_003412205.1.67098 WP_003412205.1.67146 WP_003412205.1.67170 WP_003412205.1.67197 WP_003412205.1.67198 WP_003412205.1.6720 WP_003412205.1.67207 WP_003412205.1.67218 WP_003412205.1.67220 WP_003412205.1.67225 WP_003412205.1.67231 WP_003412205.1.6724 WP_003412205.1.67257 WP_003412205.1.67298 WP_003412205.1.67307 WP_003412205.1.67324 WP_003412205.1.67332 WP_003412205.1.67346 WP_003412205.1.67354 WP_003412205.1.67360 WP_003412205.1.67381 WP_003412205.1.67396 WP_003412205.1.67417 WP_003412205.1.67422 WP_003412205.1.67453 WP_003412205.1.67459 WP_003412205.1.6746 WP_003412205.1.67473 WP_003412205.1.67481 WP_003412205.1.67482 WP_003412205.1.67496 WP_003412205.1.67499 WP_003412205.1.67516 WP_003412205.1.67523 WP_003412205.1.67536 WP_003412205.1.67575 WP_003412205.1.67587 WP_003412205.1.67598 WP_003412205.1.67600 WP_003412205.1.67602 WP_003412205.1.67630 WP_003412205.1.67679 WP_003412205.1.67692 WP_003412205.1.67744 WP_003412205.1.6775 WP_003412205.1.6777 WP_003412205.1.67809 WP_003412205.1.67816 WP_003412205.1.67844 WP_003412205.1.67848 WP_003412205.1.67870 WP_003412205.1.67888 WP_003412205.1.67915 WP_003412205.1.67945 WP_003412205.1.67949 WP_003412205.1.67980 WP_003412205.1.67982 WP_003412205.1.68022 WP_003412205.1.68029 WP_003412205.1.68037 WP_003412205.1.68038 WP_003412205.1.68045 WP_003412205.1.68057 WP_003412205.1.68083 WP_003412205.1.68088 WP_003412205.1.68106 WP_003412205.1.68110 WP_003412205.1.68153 WP_003412205.1.68164 WP_003412205.1.68169 WP_003412205.1.68193 WP_003412205.1.68212 WP_003412205.1.68227 WP_003412205.1.68243 WP_003412205.1.6825 WP_003412205.1.68297 WP_003412205.1.68309 WP_003412205.1.68325 WP_003412205.1.68329 WP_003412205.1.68340 WP_003412205.1.68384 WP_003412205.1.68388 WP_003412205.1.68429 WP_003412205.1.6843 WP_003412205.1.68433 WP_003412205.1.68444 WP_003412205.1.68465 WP_003412205.1.68484 WP_003412205.1.68518 WP_003412205.1.68569 WP_003412205.1.68576 WP_003412205.1.68580 WP_003412205.1.68586 WP_003412205.1.68623 WP_003412205.1.68624 WP_003412205.1.68637 WP_003412205.1.68646 WP_003412205.1.68667 WP_003412205.1.68669 WP_003412205.1.68672 WP_003412205.1.68684 WP_003412205.1.68704 WP_003412205.1.68708 WP_003412205.1.6872 WP_003412205.1.68730 WP_003412205.1.68734 WP_003412205.1.68748 WP_003412205.1.68754 WP_003412205.1.6876 WP_003412205.1.68761 WP_003412205.1.68763 WP_003412205.1.68766 WP_003412205.1.68774 WP_003412205.1.68796 WP_003412205.1.68824 WP_003412205.1.68832 WP_003412205.1.68833 WP_003412205.1.68841 WP_003412205.1.68859 WP_003412205.1.68876 WP_003412205.1.68906 WP_003412205.1.68916 WP_003412205.1.68923 WP_003412205.1.68945 WP_003412205.1.6896 WP_003412205.1.68981 WP_003412205.1.68984 WP_003412205.1.68997 WP_003412205.1.69008 WP_003412205.1.69076 WP_003412205.1.69079 WP_003412205.1.6908 WP_003412205.1.69082 WP_003412205.1.69178 WP_003412205.1.69181 WP_003412205.1.69208 WP_003412205.1.69231 WP_003412205.1.69256 WP_003412205.1.69311 WP_003412205.1.69315 WP_003412205.1.69322 WP_003412205.1.69342 WP_003412205.1.6935 WP_003412205.1.6936 WP_003412205.1.69369 WP_003412205.1.69374 WP_003412205.1.69398 WP_003412205.1.69401 WP_003412205.1.69426 WP_003412205.1.69427 WP_003412205.1.69429 WP_003412205.1.6949 WP_003412205.1.6951 WP_003412205.1.69511 WP_003412205.1.69526 WP_003412205.1.69528 WP_003412205.1.69547 WP_003412205.1.69573 WP_003412205.1.69581 WP_003412205.1.6960 WP_003412205.1.69617 WP_003412205.1.69634 WP_003412205.1.69647 WP_003412205.1.69659 WP_003412205.1.69673 WP_003412205.1.69682 WP_003412205.1.69684 WP_003412205.1.69686 WP_003412205.1.69707 WP_003412205.1.69709 WP_003412205.1.69723 WP_003412205.1.69736 WP_003412205.1.69778 WP_003412205.1.69800 WP_003412205.1.69802 WP_003412205.1.69845 WP_003412205.1.69870 WP_003412205.1.69873 WP_003412205.1.69898 WP_003412205.1.69913 WP_003412205.1.69925 WP_003412205.1.69931 WP_003412205.1.69938 WP_003412205.1.69955 WP_003412205.1.69957 WP_003412205.1.69981 WP_003412205.1.69990 WP_003412205.1.70 WP_003412205.1.70000 WP_003412205.1.70017 WP_003412205.1.70032 WP_003412205.1.70055 WP_003412205.1.70062 WP_003412205.1.70072 WP_003412205.1.70131 WP_003412205.1.70132 WP_003412205.1.7022 WP_003412205.1.70227 WP_003412205.1.70255 WP_003412205.1.70271 WP_003412205.1.70274 WP_003412205.1.7029 WP_003412205.1.70325 WP_003412205.1.70328 WP_003412205.1.70356 WP_003412205.1.70364 WP_003412205.1.70368 WP_003412205.1.70369 WP_003412205.1.70418 WP_003412205.1.70422 WP_003412205.1.70435 WP_003412205.1.70444 WP_003412205.1.70463 WP_003412205.1.70471 WP_003412205.1.70480 WP_003412205.1.70494 WP_003412205.1.70498 WP_003412205.1.70505 WP_003412205.1.70525 WP_003412205.1.70573 WP_003412205.1.70577 WP_003412205.1.70610 WP_003412205.1.70615 WP_003412205.1.70618 WP_003412205.1.70622 WP_003412205.1.70626 WP_003412205.1.70668 WP_003412205.1.70699 WP_003412205.1.70704 WP_003412205.1.70729 WP_003412205.1.70757 WP_003412205.1.70782 WP_003412205.1.70796 WP_003412205.1.70830 WP_003412205.1.70834 WP_003412205.1.7084 WP_003412205.1.70840 WP_003412205.1.70864 WP_003412205.1.70871 WP_003412205.1.70915 WP_003412205.1.70955 WP_003412205.1.70958 WP_003412205.1.70964 WP_003412205.1.70976 WP_003412205.1.71015 WP_003412205.1.71026 WP_003412205.1.71063 WP_003412205.1.71076 WP_003412205.1.71083 WP_003412205.1.7111 WP_003412205.1.71118 WP_003412205.1.71128 WP_003412205.1.7113 WP_003412205.1.71187 WP_003412205.1.71191 WP_003412205.1.71255 WP_003412205.1.71258 WP_003412205.1.71259 WP_003412205.1.71289 WP_003412205.1.71326 WP_003412205.1.71329 WP_003412205.1.71331 WP_003412205.1.71344 WP_003412205.1.71390 WP_003412205.1.71399 WP_003412205.1.71414 WP_003412205.1.71440 WP_003412205.1.71457 WP_003412205.1.7146 WP_003412205.1.71464 WP_003412205.1.71490 WP_003412205.1.71492 WP_003412205.1.71509 WP_003412205.1.71516 WP_003412205.1.71517 WP_003412205.1.71527 WP_003412205.1.71532 WP_003412205.1.71545 WP_003412205.1.71546 WP_003412205.1.71569 WP_003412205.1.71604 WP_003412205.1.71621 WP_003412205.1.71630 WP_003412205.1.71638 WP_003412205.1.71654 WP_003412205.1.71664 WP_003412205.1.71665 WP_003412205.1.71683 WP_003412205.1.71701 WP_003412205.1.71718 WP_003412205.1.71731 WP_003412205.1.71778 WP_003412205.1.71781 WP_003412205.1.71803 WP_003412205.1.71847 WP_003412205.1.7185 WP_003412205.1.71851 WP_003412205.1.71871 WP_003412205.1.71909 WP_003412205.1.71957 WP_003412205.1.71970 WP_003412205.1.72047 WP_003412205.1.72061 WP_003412205.1.72062 WP_003412205.1.72072 WP_003412205.1.72111 WP_003412205.1.72122 WP_003412205.1.72128 WP_003412205.1.72143 WP_003412205.1.7216 WP_003412205.1.72168 WP_003412205.1.72179 WP_003412205.1.72209 WP_003412205.1.72218 WP_003412205.1.72219 WP_003412205.1.72227 WP_003412205.1.7224 WP_003412205.1.72268 WP_003412205.1.72332 WP_003412205.1.72380 WP_003412205.1.72401 WP_003412205.1.72405 WP_003412205.1.72420 WP_003412205.1.72441 WP_003412205.1.72451 WP_003412205.1.72452 WP_003412205.1.72457 WP_003412205.1.72459 WP_003412205.1.72460 WP_003412205.1.72466 WP_003412205.1.72487 WP_003412205.1.72488 WP_003412205.1.72492 WP_003412205.1.72506 WP_003412205.1.72543 WP_003412205.1.7256 WP_003412205.1.72576 WP_003412205.1.72578 WP_003412205.1.72585 WP_003412205.1.72591 WP_003412205.1.72592 WP_003412205.1.72640 WP_003412205.1.7266 WP_003412205.1.72661 WP_003412205.1.72684 WP_003412205.1.72739 WP_003412205.1.72744 WP_003412205.1.72755 WP_003412205.1.72759 WP_003412205.1.72784 WP_003412205.1.72792 WP_003412205.1.72826 WP_003412205.1.72831 WP_003412205.1.72852 WP_003412205.1.72853 WP_003412205.1.72879 WP_003412205.1.72880 WP_003412205.1.72938 WP_003412205.1.72954 WP_003412205.1.72957 WP_003412205.1.72959 WP_003412205.1.72973 WP_003412205.1.7298 WP_003412205.1.72982 WP_003412205.1.72988 WP_003412205.1.72993 WP_003412205.1.73006 WP_003412205.1.73013 WP_003412205.1.73025 WP_003412205.1.73028 WP_003412205.1.73042 WP_003412205.1.73045 WP_003412205.1.73092 WP_003412205.1.73118 WP_003412205.1.7312 WP_003412205.1.73127 WP_003412205.1.73134 WP_003412205.1.73150 WP_003412205.1.73154 WP_003412205.1.73163 WP_003412205.1.73182 WP_003412205.1.73205 WP_003412205.1.7321 WP_003412205.1.73310 WP_003412205.1.73315 WP_003412205.1.73365 WP_003412205.1.73391 WP_003412205.1.73404 WP_003412205.1.73424 WP_003412205.1.73436 WP_003412205.1.73445 WP_003412205.1.73453 WP_003412205.1.73465 WP_003412205.1.73466 WP_003412205.1.73470 WP_003412205.1.73471 WP_003412205.1.73478 WP_003412205.1.73482 WP_003412205.1.73507 WP_003412205.1.73532 WP_003412205.1.73550 WP_003412205.1.73564 WP_003412205.1.73623 WP_003412205.1.73629 WP_003412205.1.73644 WP_003412205.1.7366 WP_003412205.1.73661 WP_003412205.1.7368 WP_003412205.1.73688 WP_003412205.1.73723 WP_003412205.1.73744 WP_003412205.1.73750 WP_003412205.1.73760 WP_003412205.1.73774 WP_003412205.1.7379 WP_003412205.1.73813 WP_003412205.1.73840 WP_003412205.1.73876 WP_003412205.1.7389 WP_003412205.1.73986 WP_003412205.1.74016 WP_003412205.1.74039 WP_003412205.1.74083 WP_003412205.1.74101 WP_003412205.1.74107 WP_003412205.1.74120 WP_003412205.1.74129 WP_003412205.1.74144 WP_003412205.1.7417 WP_003412205.1.74190 WP_003412205.1.74210 WP_003412205.1.7423 WP_003412205.1.74259 WP_003412205.1.74262 WP_003412205.1.74269 WP_003412205.1.74282 WP_003412205.1.74291 WP_003412205.1.74296 WP_003412205.1.74304 WP_003412205.1.7432 WP_003412205.1.74347 WP_003412205.1.7436 WP_003412205.1.74378 WP_003412205.1.74382 WP_003412205.1.74395 WP_003412205.1.74400 WP_003412205.1.74401 WP_003412205.1.74432 WP_003412205.1.74442 WP_003412205.1.74477 WP_003412205.1.74487 WP_003412205.1.74499 WP_003412205.1.74504 WP_003412205.1.74511 WP_003412205.1.74523 WP_003412205.1.74525 WP_003412205.1.74551 WP_003412205.1.74555 WP_003412205.1.74628 WP_003412205.1.74641 WP_003412205.1.74653 WP_003412205.1.74660 WP_003412205.1.74683 WP_003412205.1.7469 WP_003412205.1.74725 WP_003412205.1.74760 WP_003412205.1.74786 WP_003412205.1.74809 WP_003412205.1.74820 WP_003412205.1.74870 WP_003412205.1.74881 WP_003412205.1.74888 WP_003412205.1.74952 WP_003412205.1.7496 WP_003412205.1.74988 WP_003412205.1.75043 WP_003412205.1.75045 WP_003412205.1.75078 WP_003412205.1.75081 WP_003412205.1.75120 WP_003412205.1.75163 WP_003412205.1.75188 WP_003412205.1.75200 WP_003412205.1.75202 WP_003412205.1.75234 WP_003412205.1.75239 WP_003412205.1.75250 WP_003412205.1.75263 WP_003412205.1.75281 WP_003412205.1.75342 WP_003412205.1.7535 WP_003412205.1.75376 WP_003412205.1.75391 WP_003412205.1.75395 WP_003412205.1.75441 WP_003412205.1.75510 WP_003412205.1.75581 WP_003412205.1.75598 WP_003412205.1.75635 WP_003412205.1.75645 WP_003412205.1.75665 WP_003412205.1.75671 WP_003412205.1.75741 WP_003412205.1.75749 WP_003412205.1.75772 WP_003412205.1.75774 WP_003412205.1.75811 WP_003412205.1.75833 WP_003412205.1.7585 WP_003412205.1.75864 WP_003412205.1.75868 WP_003412205.1.75878 WP_003412205.1.75927 WP_003412205.1.75946 WP_003412205.1.75968 WP_003412205.1.75974 WP_003412205.1.76007 WP_003412205.1.76016 WP_003412205.1.76032 WP_003412205.1.76037 WP_003412205.1.7604 WP_003412205.1.76045 WP_003412205.1.76052 WP_003412205.1.76058 WP_003412205.1.76064 WP_003412205.1.76110 WP_003412205.1.76126 WP_003412205.1.76133 WP_003412205.1.76138 WP_003412205.1.76157 WP_003412205.1.76172 WP_003412205.1.76177 WP_003412205.1.76183 WP_003412205.1.76209 WP_003412205.1.76239 WP_003412205.1.76272 WP_003412205.1.76277 WP_003412205.1.76280 WP_003412205.1.76281 WP_003412205.1.76291 WP_003412205.1.76297 WP_003412205.1.76360 WP_003412205.1.76379 WP_003412205.1.76403 WP_003412205.1.76413 WP_003412205.1.76414 WP_003412205.1.76427 WP_003412205.1.76436 WP_003412205.1.76442 WP_003412205.1.76443 WP_003412205.1.76456 WP_003412205.1.76521 WP_003412205.1.76533 WP_003412205.1.76616 WP_003412205.1.76625 WP_003412205.1.76629 WP_003412205.1.76635 WP_003412205.1.76638 WP_003412205.1.76639 WP_003412205.1.76640 WP_003412205.1.76644 WP_003412205.1.76677 WP_003412205.1.76678 WP_003412205.1.76679 WP_003412205.1.76734 WP_003412205.1.76744 WP_003412205.1.76750 WP_003412205.1.76754 WP_003412205.1.76757 WP_003412205.1.76781 WP_003412205.1.76818 WP_003412205.1.76824 WP_003412205.1.76835 WP_003412205.1.76873 WP_003412205.1.76881 WP_003412205.1.76888 WP_003412205.1.76900 WP_003412205.1.7691 WP_003412205.1.76947 WP_003412205.1.76954 WP_003412205.1.76955 WP_003412205.1.76963 WP_003412205.1.76976 WP_003412205.1.770 WP_003412205.1.77000 WP_003412205.1.77008 WP_003412205.1.77021 WP_003412205.1.77056 WP_003412205.1.77065 WP_003412205.1.77075 WP_003412205.1.77093 WP_003412205.1.77107 WP_003412205.1.77115 WP_003412205.1.77118 WP_003412205.1.77125 WP_003412205.1.77141 WP_003412205.1.77142 WP_003412205.1.77166 WP_003412205.1.77250 WP_003412205.1.77252 WP_003412205.1.77260 WP_003412205.1.77266 WP_003412205.1.77280 WP_003412205.1.77285 WP_003412205.1.77312 WP_003412205.1.77348 WP_003412205.1.77351 WP_003412205.1.77352 WP_003412205.1.77361 WP_003412205.1.774 WP_003412205.1.7740 WP_003412205.1.77404 WP_003412205.1.77425 WP_003412205.1.77463 WP_003412205.1.77474 WP_003412205.1.7748 WP_003412205.1.77484 WP_003412205.1.77491 WP_003412205.1.77499 WP_003412205.1.77510 WP_003412205.1.77530 WP_003412205.1.77554 WP_003412205.1.77559 WP_003412205.1.77599 WP_003412205.1.77605 WP_003412205.1.7762 WP_003412205.1.77627 WP_003412205.1.77649 WP_003412205.1.77654 WP_003412205.1.7766 WP_003412205.1.77667 WP_003412205.1.77704 WP_003412205.1.77706 WP_003412205.1.77726 WP_003412205.1.77774 WP_003412205.1.7778 WP_003412205.1.77790 WP_003412205.1.77809 WP_003412205.1.77820 WP_003412205.1.77843 WP_003412205.1.77855 WP_003412205.1.77865 WP_003412205.1.77868 WP_003412205.1.77879 WP_003412205.1.77890 WP_003412205.1.77909 WP_003412205.1.77911 WP_003412205.1.77931 WP_003412205.1.77984 WP_003412205.1.78020 WP_003412205.1.78024 WP_003412205.1.78075 WP_003412205.1.78084 WP_003412205.1.78086 WP_003412205.1.7809 WP_003412205.1.78098 WP_003412205.1.78105 WP_003412205.1.78113 WP_003412205.1.78136 WP_003412205.1.78162 WP_003412205.1.7817 WP_003412205.1.78200 WP_003412205.1.78216 WP_003412205.1.78236 WP_003412205.1.78238 WP_003412205.1.78322 WP_003412205.1.78338 WP_003412205.1.7836 WP_003412205.1.78360 WP_003412205.1.78386 WP_003412205.1.78429 WP_003412205.1.78435 WP_003412205.1.7844 WP_003412205.1.78459 WP_003412205.1.78488 WP_003412205.1.7849 WP_003412205.1.78499 WP_003412205.1.785 WP_003412205.1.78516 WP_003412205.1.78524 WP_003412205.1.78526 WP_003412205.1.78538 WP_003412205.1.78544 WP_003412205.1.78545 WP_003412205.1.78547 WP_003412205.1.78574 WP_003412205.1.78580 WP_003412205.1.7860 WP_003412205.1.78620 WP_003412205.1.78646 WP_003412205.1.78648 WP_003412205.1.78649 WP_003412205.1.78655 WP_003412205.1.78657 WP_003412205.1.78659 WP_003412205.1.7869 WP_003412205.1.78692 WP_003412205.1.78760 WP_003412205.1.78766 WP_003412205.1.78776 WP_003412205.1.78778 WP_003412205.1.78784 WP_003412205.1.78788 WP_003412205.1.78790 WP_003412205.1.78793 WP_003412205.1.78848 WP_003412205.1.78860 WP_003412205.1.7887 WP_003412205.1.78884 WP_003412205.1.78932 WP_003412205.1.78969 WP_003412205.1.78977 WP_003412205.1.78980 WP_003412205.1.79005 WP_003412205.1.79016 WP_003412205.1.79033 WP_003412205.1.79064 WP_003412205.1.79066 WP_003412205.1.79068 WP_003412205.1.79077 WP_003412205.1.79095 WP_003412205.1.79112 WP_003412205.1.79122 WP_003412205.1.79145 WP_003412205.1.79152 WP_003412205.1.79163 WP_003412205.1.79182 WP_003412205.1.79198 WP_003412205.1.79213 WP_003412205.1.79218 WP_003412205.1.79268 WP_003412205.1.79273 WP_003412205.1.79278 WP_003412205.1.79290 WP_003412205.1.79319 WP_003412205.1.79325 WP_003412205.1.79326 WP_003412205.1.7933 WP_003412205.1.79330 WP_003412205.1.79339 WP_003412205.1.79394 WP_003412205.1.79399 WP_003412205.1.79413 WP_003412205.1.79422 WP_003412205.1.79445 WP_003412205.1.79447 WP_003412205.1.79455 WP_003412205.1.79471 WP_003412205.1.79480 WP_003412205.1.79482 WP_003412205.1.79488 WP_003412205.1.79500 WP_003412205.1.79502 WP_003412205.1.79508 WP_003412205.1.79514 WP_003412205.1.79561 WP_003412205.1.79565 WP_003412205.1.79578 WP_003412205.1.79588 WP_003412205.1.79598 WP_003412205.1.79615 WP_003412205.1.79684 WP_003412205.1.79698 WP_003412205.1.797 WP_003412205.1.79744 WP_003412205.1.79784 WP_003412205.1.79802 WP_003412205.1.79806 WP_003412205.1.79819 WP_003412205.1.79826 WP_003412205.1.79828 WP_003412205.1.79851 WP_003412205.1.79853 WP_003412205.1.79863 WP_003412205.1.79881 WP_003412205.1.79885 WP_003412205.1.79898 WP_003412205.1.7990 WP_003412205.1.79900 WP_003412205.1.79913 WP_003412205.1.79918 WP_003412205.1.79947 WP_003412205.1.79948 WP_003412205.1.7995 WP_003412205.1.7997 WP_003412205.1.80004 WP_003412205.1.80015 WP_003412205.1.80022 WP_003412205.1.80030 WP_003412205.1.80054 WP_003412205.1.80084 WP_003412205.1.80099 WP_003412205.1.80129 WP_003412205.1.80177 WP_003412205.1.80234 WP_003412205.1.8026 WP_003412205.1.80275 WP_003412205.1.8029 WP_003412205.1.80299 WP_003412205.1.80300 WP_003412205.1.80304 WP_003412205.1.80326 WP_003412205.1.80351 WP_003412205.1.8037 WP_003412205.1.80370 WP_003412205.1.8044 WP_003412205.1.80451 WP_003412205.1.80458 WP_003412205.1.80461 WP_003412205.1.80490 WP_003412205.1.80503 WP_003412205.1.80507 WP_003412205.1.80552 WP_003412205.1.80576 WP_003412205.1.80588 WP_003412205.1.80599 WP_003412205.1.8060 WP_003412205.1.80624 WP_003412205.1.80636 WP_003412205.1.80669 WP_003412205.1.80673 WP_003412205.1.80711 WP_003412205.1.80714 WP_003412205.1.80743 WP_003412205.1.80784 WP_003412205.1.80815 WP_003412205.1.80853 WP_003412205.1.80918 WP_003412205.1.8093 WP_003412205.1.80967 WP_003412205.1.8097 WP_003412205.1.80988 WP_003412205.1.81007 WP_003412205.1.81013 WP_003412205.1.8105 WP_003412205.1.81059 WP_003412205.1.81063 WP_003412205.1.81066 WP_003412205.1.81075 WP_003412205.1.81091 WP_003412205.1.81119 WP_003412205.1.81125 WP_003412205.1.81136 WP_003412205.1.8114 WP_003412205.1.81189 WP_003412205.1.81192 WP_003412205.1.812 WP_003412205.1.81230 WP_003412205.1.81249 WP_003412205.1.81250 WP_003412205.1.81264 WP_003412205.1.8128 WP_003412205.1.81287 WP_003412205.1.81297 WP_003412205.1.8138 WP_003412205.1.81407 WP_003412205.1.8143 WP_003412205.1.81439 WP_003412205.1.81465 WP_003412205.1.81505 WP_003412205.1.81529 WP_003412205.1.81538 WP_003412205.1.81541 WP_003412205.1.81560 WP_003412205.1.81561 WP_003412205.1.81567 WP_003412205.1.81583 WP_003412205.1.81686 WP_003412205.1.81712 WP_003412205.1.81720 WP_003412205.1.81731 WP_003412205.1.81774 WP_003412205.1.81788 WP_003412205.1.81809 WP_003412205.1.81820 WP_003412205.1.81850 WP_003412205.1.81883 WP_003412205.1.81891 WP_003412205.1.81911 WP_003412205.1.81918 WP_003412205.1.82011 WP_003412205.1.82048 WP_003412205.1.82069 WP_003412205.1.82071 WP_003412205.1.82108 WP_003412205.1.82136 WP_003412205.1.82142 WP_003412205.1.8215 WP_003412205.1.82158 WP_003412205.1.8217 WP_003412205.1.82209 WP_003412205.1.82210 WP_003412205.1.82228 WP_003412205.1.82236 WP_003412205.1.82251 WP_003412205.1.82271 WP_003412205.1.82305 WP_003412205.1.82307 WP_003412205.1.82309 WP_003412205.1.82317 WP_003412205.1.8232 WP_003412205.1.82346 WP_003412205.1.82374 WP_003412205.1.82385 WP_003412205.1.82429 WP_003412205.1.82460 WP_003412205.1.82462 WP_003412205.1.82483 WP_003412205.1.82494 WP_003412205.1.82531 WP_003412205.1.82546 WP_003412205.1.82547 WP_003412205.1.82549 WP_003412205.1.82577 WP_003412205.1.82592 WP_003412205.1.82597 WP_003412205.1.82598 WP_003412205.1.82625 WP_003412205.1.82642 WP_003412205.1.82651 WP_003412205.1.82653 WP_003412205.1.82681 WP_003412205.1.82685 WP_003412205.1.8271 WP_003412205.1.82712 WP_003412205.1.8273 WP_003412205.1.82743 WP_003412205.1.82757 WP_003412205.1.82774 WP_003412205.1.82803 WP_003412205.1.82836 WP_003412205.1.82860 WP_003412205.1.82871 WP_003412205.1.82892 WP_003412205.1.82935 WP_003412205.1.82957 WP_003412205.1.82973 WP_003412205.1.82981 WP_003412205.1.82983 WP_003412205.1.83004 WP_003412205.1.83009 WP_003412205.1.83044 WP_003412205.1.83065 WP_003412205.1.83074 WP_003412205.1.83110 WP_003412205.1.83146 WP_003412205.1.83149 WP_003412205.1.83159 WP_003412205.1.8317 WP_003412205.1.83173 WP_003412205.1.83181 WP_003412205.1.83182 WP_003412205.1.83191 WP_003412205.1.83197 WP_003412205.1.83212 WP_003412205.1.8326 WP_003412205.1.83262 WP_003412205.1.83268 WP_003412205.1.83273 WP_003412205.1.83309 WP_003412205.1.83332 WP_003412205.1.83334 WP_003412205.1.83341 WP_003412205.1.83349 WP_003412205.1.8335 WP_003412205.1.83353 WP_003412205.1.83367 WP_003412205.1.83380 WP_003412205.1.83381 WP_003412205.1.83389 WP_003412205.1.83408 WP_003412205.1.83409 WP_003412205.1.83435 WP_003412205.1.83470 WP_003412205.1.83524 WP_003412205.1.83526 WP_003412205.1.8358 WP_003412205.1.83589 WP_003412205.1.83601 WP_003412205.1.83611 WP_003412205.1.83638 WP_003412205.1.83648 WP_003412205.1.83656 WP_003412205.1.83667 WP_003412205.1.83689 WP_003412205.1.83692 WP_003412205.1.83704 WP_003412205.1.83705 WP_003412205.1.83766 WP_003412205.1.83793 WP_003412205.1.83794 WP_003412205.1.83802 WP_003412205.1.83805 WP_003412205.1.83839 WP_003412205.1.83842 WP_003412205.1.83850 WP_003412205.1.83884 WP_003412205.1.83920 WP_003412205.1.83929 WP_003412205.1.83930 WP_003412205.1.83975 WP_003412205.1.83991 WP_003412205.1.8400 WP_003412205.1.84027 WP_003412205.1.8404 WP_003412205.1.84057 WP_003412205.1.84070 WP_003412205.1.8409 WP_003412205.1.84112 WP_003412205.1.84146 WP_003412205.1.8415 WP_003412205.1.84176 WP_003412205.1.84186 WP_003412205.1.84192 WP_003412205.1.84228 WP_003412205.1.8424 WP_003412205.1.84244 WP_003412205.1.84259 WP_003412205.1.8426 WP_003412205.1.84277 WP_003412205.1.84287 WP_003412205.1.8434 WP_003412205.1.84388 WP_003412205.1.84408 WP_003412205.1.84409 WP_003412205.1.84438 WP_003412205.1.84460 WP_003412205.1.84488 WP_003412205.1.84504 WP_003412205.1.84525 WP_003412205.1.84620 WP_003412205.1.84623 WP_003412205.1.84641 WP_003412205.1.84655 WP_003412205.1.84666 WP_003412205.1.84670 WP_003412205.1.84739 WP_003412205.1.84748 WP_003412205.1.84766 WP_003412205.1.84772 WP_003412205.1.84774 WP_003412205.1.848 WP_003412205.1.84812 WP_003412205.1.84836 WP_003412205.1.84839 WP_003412205.1.84846 WP_003412205.1.84873 WP_003412205.1.84911 WP_003412205.1.84938 WP_003412205.1.84968 WP_003412205.1.84973 WP_003412205.1.84981 WP_003412205.1.84985 WP_003412205.1.8503 WP_003412205.1.85038 WP_003412205.1.85041 WP_003412205.1.85043 WP_003412205.1.8505 WP_003412205.1.85074 WP_003412205.1.8509 WP_003412205.1.8512 WP_003412205.1.85148 WP_003412205.1.8518 WP_003412205.1.8522 WP_003412205.1.85242 WP_003412205.1.85276 WP_003412205.1.85281 WP_003412205.1.85284 WP_003412205.1.85314 WP_003412205.1.85319 WP_003412205.1.85330 WP_003412205.1.85341 WP_003412205.1.85346 WP_003412205.1.8535 WP_003412205.1.85363 WP_003412205.1.85371 WP_003412205.1.85377 WP_003412205.1.85387 WP_003412205.1.85399 WP_003412205.1.85458 WP_003412205.1.8546 WP_003412205.1.85464 WP_003412205.1.85478 WP_003412205.1.85480 WP_003412205.1.85488 WP_003412205.1.85495 WP_003412205.1.85551 WP_003412205.1.85557 WP_003412205.1.85577 WP_003412205.1.85597 WP_003412205.1.85599 WP_003412205.1.85610 WP_003412205.1.8563 WP_003412205.1.85648 WP_003412205.1.85679 WP_003412205.1.85704 WP_003412205.1.85717 WP_003412205.1.85727 WP_003412205.1.85737 WP_003412205.1.85763 WP_003412205.1.85808 WP_003412205.1.85819 WP_003412205.1.85820 WP_003412205.1.85823 WP_003412205.1.85832 WP_003412205.1.8586 WP_003412205.1.85872 WP_003412205.1.85894 WP_003412205.1.85909 WP_003412205.1.85913 WP_003412205.1.85953 WP_003412205.1.85986 WP_003412205.1.86000 WP_003412205.1.86024 WP_003412205.1.86025 WP_003412205.1.86032 WP_003412205.1.86048 WP_003412205.1.86052 WP_003412205.1.86067 WP_003412205.1.86103 WP_003412205.1.86122 WP_003412205.1.86124 WP_003412205.1.86160 WP_003412205.1.86164 WP_003412205.1.86168 WP_003412205.1.86190 WP_003412205.1.86204 WP_003412205.1.86208 WP_003412205.1.86235 WP_003412205.1.86249 WP_003412205.1.86260 WP_003412205.1.86290 WP_003412205.1.863 WP_003412205.1.86327 WP_003412205.1.86334 WP_003412205.1.86337 WP_003412205.1.86368 WP_003412205.1.86377 WP_003412205.1.86425 WP_003412205.1.86459 WP_003412205.1.8649 WP_003412205.1.86499 WP_003412205.1.86520 WP_003412205.1.86561 WP_003412205.1.86568 WP_003412205.1.86575 WP_003412205.1.86584 WP_003412205.1.86605 WP_003412205.1.86626 WP_003412205.1.86648 WP_003412205.1.8666 WP_003412205.1.86684 WP_003412205.1.86696 WP_003412205.1.86705 WP_003412205.1.86718 WP_003412205.1.86725 WP_003412205.1.86757 WP_003412205.1.86766 WP_003412205.1.86801 WP_003412205.1.86814 WP_003412205.1.86820 WP_003412205.1.86825 WP_003412205.1.86834 WP_003412205.1.8685 WP_003412205.1.86851 WP_003412205.1.86855 WP_003412205.1.86867 WP_003412205.1.86877 WP_003412205.1.86883 WP_003412205.1.8689 WP_003412205.1.86892 WP_003412205.1.86933 WP_003412205.1.86941 WP_003412205.1.86950 WP_003412205.1.86962 WP_003412205.1.86963 WP_003412205.1.86979 WP_003412205.1.8700 WP_003412205.1.87001 WP_003412205.1.87002 WP_003412205.1.87031 WP_003412205.1.87116 WP_003412205.1.87117 WP_003412205.1.8714 WP_003412205.1.87162 WP_003412205.1.87178 WP_003412205.1.87191 WP_003412205.1.87201 WP_003412205.1.87209 WP_003412205.1.87240 WP_003412205.1.87266 WP_003412205.1.87273 WP_003412205.1.87275 WP_003412205.1.8733 WP_003412205.1.87345 WP_003412205.1.87369 WP_003412205.1.8737 WP_003412205.1.87401 WP_003412205.1.87404 WP_003412205.1.87406 WP_003412205.1.87409 WP_003412205.1.87444 WP_003412205.1.87446 WP_003412205.1.87459 WP_003412205.1.87472 WP_003412205.1.87489 WP_003412205.1.87494 WP_003412205.1.87496 WP_003412205.1.87582 WP_003412205.1.87588 WP_003412205.1.87617 WP_003412205.1.87619 WP_003412205.1.87620 WP_003412205.1.87634 WP_003412205.1.87643 WP_003412205.1.8765 WP_003412205.1.87650 WP_003412205.1.87654 WP_003412205.1.87658 WP_003412205.1.87665 WP_003412205.1.87676 WP_003412205.1.87677 WP_003412205.1.87684 WP_003412205.1.87692 WP_003412205.1.87707 WP_003412205.1.87732 WP_003412205.1.87784 WP_003412205.1.87796 WP_003412205.1.87809 WP_003412205.1.87817 WP_003412205.1.87827 WP_003412205.1.87831 WP_003412205.1.87835 WP_003412205.1.87837 WP_003412205.1.87866 WP_003412205.1.8789 WP_003412205.1.87911 WP_003412205.1.87924 WP_003412205.1.87951 WP_003412205.1.87955 WP_003412205.1.87956 WP_003412205.1.87991 WP_003412205.1.88 WP_003412205.1.88002 WP_003412205.1.88037 WP_003412205.1.88039 WP_003412205.1.88072 WP_003412205.1.88077 WP_003412205.1.88121 WP_003412205.1.88180 WP_003412205.1.88191 WP_003412205.1.88205 WP_003412205.1.88217 WP_003412205.1.88219 WP_003412205.1.88245 WP_003412205.1.88253 WP_003412205.1.88294 WP_003412205.1.88315 WP_003412205.1.88316 WP_003412205.1.88320 WP_003412205.1.88338 WP_003412205.1.8840 WP_003412205.1.88437 WP_003412205.1.88453 WP_003412205.1.88469 WP_003412205.1.88489 WP_003412205.1.88507 WP_003412205.1.88521 WP_003412205.1.88530 WP_003412205.1.88537 WP_003412205.1.88541 WP_003412205.1.88592 WP_003412205.1.88616 WP_003412205.1.88618 WP_003412205.1.8862 WP_003412205.1.88625 WP_003412205.1.88632 WP_003412205.1.88634 WP_003412205.1.88649 WP_003412205.1.8870 WP_003412205.1.88737 WP_003412205.1.88756 WP_003412205.1.888 WP_003412205.1.88824 WP_003412205.1.88886 WP_003412205.1.88965 WP_003412205.1.88985 WP_003412205.1.8902 WP_003412205.1.89025 WP_003412205.1.89041 WP_003412205.1.89046 WP_003412205.1.89082 WP_003412205.1.89162 WP_003412205.1.89168 WP_003412205.1.8917 WP_003412205.1.89193 WP_003412205.1.89205 WP_003412205.1.89207 WP_003412205.1.89225 WP_003412205.1.8925 WP_003412205.1.89277 WP_003412205.1.89286 WP_003412205.1.89293 WP_003412205.1.89320 WP_003412205.1.8935 WP_003412205.1.89371 WP_003412205.1.89378 WP_003412205.1.89392 WP_003412205.1.89406 WP_003412205.1.8943 WP_003412205.1.89451 WP_003412205.1.89453 WP_003412205.1.89473 WP_003412205.1.89475 WP_003412205.1.89483 WP_003412205.1.895 WP_003412205.1.89513 WP_003412205.1.89517 WP_003412205.1.89522 WP_003412205.1.8954 WP_003412205.1.89543 WP_003412205.1.89567 WP_003412205.1.8957 WP_003412205.1.89572 WP_003412205.1.89589 WP_003412205.1.89607 WP_003412205.1.89613 WP_003412205.1.89625 WP_003412205.1.89648 WP_003412205.1.8967 WP_003412205.1.89670 WP_003412205.1.89676 WP_003412205.1.89729 WP_003412205.1.89739 WP_003412205.1.89762 WP_003412205.1.8977 WP_003412205.1.89802 WP_003412205.1.89808 WP_003412205.1.8982 WP_003412205.1.89829 WP_003412205.1.89831 WP_003412205.1.89844 WP_003412205.1.89849 WP_003412205.1.8989 WP_003412205.1.89901 WP_003412205.1.89903 WP_003412205.1.89909 WP_003412205.1.8992 WP_003412205.1.89922 WP_003412205.1.89926 WP_003412205.1.89963 WP_003412205.1.89971 WP_003412205.1.8998 WP_003412205.1.89987 WP_003412205.1.900 WP_003412205.1.90048 WP_003412205.1.9007 WP_003412205.1.90080 WP_003412205.1.90130 WP_003412205.1.90134 WP_003412205.1.90137 WP_003412205.1.90157 WP_003412205.1.90184 WP_003412205.1.90199 WP_003412205.1.90231 WP_003412205.1.90245 WP_003412205.1.90308 WP_003412205.1.90322 WP_003412205.1.90328 WP_003412205.1.90372 WP_003412205.1.90439 WP_003412205.1.90481 WP_003412205.1.90499 WP_003412205.1.9050 WP_003412205.1.90527 WP_003412205.1.90550 WP_003412205.1.90560 WP_003412205.1.90612 WP_003412205.1.90640 WP_003412205.1.90672 WP_003412205.1.90687 WP_003412205.1.90691 WP_003412205.1.90711 WP_003412205.1.90722 WP_003412205.1.90744 WP_003412205.1.9075 WP_003412205.1.90756 WP_003412205.1.90767 WP_003412205.1.90771 WP_003412205.1.90785 WP_003412205.1.90788 WP_003412205.1.90800 WP_003412205.1.90810 WP_003412205.1.90816 WP_003412205.1.90819 WP_003412205.1.9082 WP_003412205.1.90884 WP_003412205.1.90899 WP_003412205.1.90906 WP_003412205.1.90958 WP_003412205.1.90976 WP_003412205.1.90987 WP_003412205.1.9102 WP_003412205.1.91026 WP_003412205.1.91032 WP_003412205.1.91043 WP_003412205.1.91053 WP_003412205.1.91082 WP_003412205.1.91106 WP_003412205.1.91112 WP_003412205.1.91144 WP_003412205.1.91151 WP_003412205.1.91157 WP_003412205.1.91167 WP_003412205.1.91169 WP_003412205.1.91192 WP_003412205.1.91201 WP_003412205.1.91207 WP_003412205.1.91208 WP_003412205.1.91211 WP_003412205.1.91214 WP_003412205.1.91230 WP_003412205.1.91244 WP_003412205.1.91251 WP_003412205.1.91260 WP_003412205.1.91265 WP_003412205.1.9128 WP_003412205.1.91284 WP_003412205.1.91294 WP_003412205.1.91303 WP_003412205.1.91322 WP_003412205.1.91352 WP_003412205.1.91386 WP_003412205.1.9139 WP_003412205.1.91398 WP_003412205.1.91411 WP_003412205.1.91430 WP_003412205.1.91436 WP_003412205.1.91483 WP_003412205.1.91496 WP_003412205.1.91507 WP_003412205.1.91508 WP_003412205.1.91576 WP_003412205.1.91589 WP_003412205.1.91694 WP_003412205.1.91695 WP_003412205.1.91713 WP_003412205.1.91716 WP_003412205.1.91717 WP_003412205.1.91728 WP_003412205.1.91743 WP_003412205.1.91759 WP_003412205.1.91784 WP_003412205.1.91785 WP_003412205.1.91786 WP_003412205.1.91802 WP_003412205.1.91822 WP_003412205.1.91828 WP_003412205.1.9189 WP_003412205.1.91896 WP_003412205.1.9190 WP_003412205.1.91915 WP_003412205.1.91931 WP_003412205.1.91937 WP_003412205.1.91944 WP_003412205.1.91953 WP_003412205.1.91957 WP_003412205.1.91976 WP_003412205.1.91978 WP_003412205.1.92021 WP_003412205.1.92083 WP_003412205.1.92127 WP_003412205.1.92144 WP_003412205.1.92150 WP_003412205.1.92153 WP_003412205.1.92190 WP_003412205.1.92192 WP_003412205.1.92200 WP_003412205.1.92220 WP_003412205.1.92221 WP_003412205.1.92222 WP_003412205.1.92273 WP_003412205.1.92289 WP_003412205.1.9229 WP_003412205.1.92294 WP_003412205.1.92300 WP_003412205.1.92317 WP_003412205.1.92334 WP_003412205.1.92338 WP_003412205.1.92345 WP_003412205.1.92356 WP_003412205.1.92364 WP_003412205.1.92380 WP_003412205.1.92416 WP_003412205.1.92428 WP_003412205.1.92447 WP_003412205.1.92456 WP_003412205.1.92467 WP_003412205.1.92471 WP_003412205.1.92490 WP_003412205.1.92508 WP_003412205.1.9251 WP_003412205.1.92511 WP_003412205.1.92523 WP_003412205.1.92527 WP_003412205.1.92536 WP_003412205.1.92592 WP_003412205.1.92597 WP_003412205.1.92603 WP_003412205.1.92606 WP_003412205.1.92610 WP_003412205.1.92613 WP_003412205.1.9263 WP_003412205.1.9265 WP_003412205.1.92650 WP_003412205.1.92660 WP_003412205.1.92677 WP_003412205.1.92685 WP_003412205.1.92689 WP_003412205.1.92690 WP_003412205.1.92706 WP_003412205.1.92714 WP_003412205.1.92736 WP_003412205.1.9274 WP_003412205.1.92752 WP_003412205.1.92760 WP_003412205.1.92777 WP_003412205.1.92803 WP_003412205.1.92833 WP_003412205.1.92856 WP_003412205.1.92881 WP_003412205.1.92892 WP_003412205.1.92907 WP_003412205.1.92908 WP_003412205.1.9291 WP_003412205.1.92917 WP_003412205.1.92996 WP_003412205.1.93006 WP_003412205.1.93008 WP_003412205.1.93009 WP_003412205.1.93015 WP_003412205.1.93043 WP_003412205.1.9307 WP_003412205.1.93083 WP_003412205.1.93097 WP_003412205.1.93137 WP_003412205.1.93192 WP_003412205.1.93199 WP_003412205.1.93203 WP_003412205.1.93212 WP_003412205.1.93234 WP_003412205.1.93245 WP_003412205.1.93257 WP_003412205.1.93265 WP_003412205.1.93297 WP_003412205.1.93320 WP_003412205.1.93328 WP_003412205.1.93337 WP_003412205.1.93343 WP_003412205.1.93349 WP_003412205.1.93363 WP_003412205.1.93377 WP_003412205.1.9338 WP_003412205.1.93407 WP_003412205.1.93417 WP_003412205.1.93419 WP_003412205.1.93426 WP_003412205.1.9344 WP_003412205.1.93443 WP_003412205.1.93447 WP_003412205.1.93470 WP_003412205.1.93483 WP_003412205.1.93487 WP_003412205.1.93495 WP_003412205.1.93499 WP_003412205.1.93516 WP_003412205.1.93536 WP_003412205.1.93544 WP_003412205.1.93555 WP_003412205.1.93560 WP_003412205.1.93564 WP_003412205.1.9357 WP_003412205.1.93573 WP_003412205.1.93576 WP_003412205.1.93588 WP_003412205.1.9363 WP_003412205.1.93645 WP_003412205.1.93649 WP_003412205.1.93659 WP_003412205.1.93677 WP_003412205.1.9368 WP_003412205.1.93689 WP_003412205.1.93693 WP_003412205.1.93698 WP_003412205.1.93706 WP_003412205.1.9371 WP_003412205.1.93792 WP_003412205.1.93823 WP_003412205.1.93871 WP_003412205.1.9388 WP_003412205.1.93894 WP_003412205.1.93903 WP_003412205.1.93907 WP_003412205.1.93913 WP_003412205.1.93946 WP_003412205.1.93950 WP_003412205.1.93953 WP_003412205.1.93954 WP_003412205.1.93988 WP_003412205.1.9407 WP_003412205.1.94143 WP_003412205.1.94154 WP_003412205.1.94184 WP_003412205.1.94204 WP_003412205.1.94205 WP_003412205.1.94226 WP_003412205.1.94231 WP_003412205.1.94256 WP_003412205.1.94261 WP_003412205.1.94281 WP_003412205.1.94292 WP_003412205.1.94297 WP_003412205.1.9431 WP_003412205.1.94326 WP_003412205.1.94339 WP_003412205.1.94392 WP_003412205.1.94416 WP_003412205.1.94421 WP_003412205.1.94456 WP_003412205.1.94470 WP_003412205.1.94480 WP_003412205.1.94495 WP_003412205.1.94511 WP_003412205.1.94512 WP_003412205.1.94525 WP_003412205.1.94528 WP_003412205.1.94564 WP_003412205.1.946 WP_003412205.1.94602 WP_003412205.1.94623 WP_003412205.1.94629 WP_003412205.1.9465 WP_003412205.1.94673 WP_003412205.1.94714 WP_003412205.1.94730 WP_003412205.1.94736 WP_003412205.1.94776 WP_003412205.1.9478 WP_003412205.1.94834 WP_003412205.1.94852 WP_003412205.1.94872 WP_003412205.1.9488 WP_003412205.1.94902 WP_003412205.1.94916 WP_003412205.1.94979 WP_003412205.1.94994 WP_003412205.1.94996 WP_003412205.1.94998 WP_003412205.1.95007 WP_003412205.1.95010 WP_003412205.1.95015 WP_003412205.1.95034 WP_003412205.1.95068 WP_003412205.1.95081 WP_003412205.1.95082 WP_003412205.1.9509 WP_003412205.1.95096 WP_003412205.1.95112 WP_003412205.1.95138 WP_003412205.1.9514 WP_003412205.1.95179 WP_003412205.1.95188 WP_003412205.1.95190 WP_003412205.1.95234 WP_003412205.1.95241 WP_003412205.1.95245 WP_003412205.1.95257 WP_003412205.1.95279 WP_003412205.1.9531 WP_003412205.1.95335 WP_003412205.1.95344 WP_003412205.1.9535 WP_003412205.1.95370 WP_003412205.1.95392 WP_003412205.1.95416 WP_003412205.1.95417 WP_003412205.1.95454 WP_003412205.1.95455 WP_003412205.1.95491 WP_003412205.1.95497 WP_003412205.1.95508 WP_003412205.1.95509 WP_003412205.1.95529 WP_003412205.1.95556 WP_003412205.1.95557 WP_003412205.1.95565 WP_003412205.1.95578 WP_003412205.1.95580 WP_003412205.1.95585 WP_003412205.1.95643 WP_003412205.1.95679 WP_003412205.1.95685 WP_003412205.1.957 WP_003412205.1.95724 WP_003412205.1.95727 WP_003412205.1.95730 WP_003412205.1.95735 WP_003412205.1.95758 WP_003412205.1.95772 WP_003412205.1.95797 WP_003412205.1.95839 WP_003412205.1.9585 WP_003412205.1.9590 WP_003412205.1.95902 WP_003412205.1.95908 WP_003412205.1.95924 WP_003412205.1.95926 WP_003412205.1.95953 WP_003412205.1.95958 WP_003412205.1.95964 WP_003412205.1.95973 WP_003412205.1.96006 WP_003412205.1.9602 WP_003412205.1.96036 WP_003412205.1.96062 WP_003412205.1.96065 WP_003412205.1.96098 WP_003412205.1.96146 WP_003412205.1.96166 WP_003412205.1.96171 WP_003412205.1.96182 WP_003412205.1.96204 WP_003412205.1.96230 WP_003412205.1.96235 WP_003412205.1.96242 WP_003412205.1.96245 WP_003412205.1.96254 WP_003412205.1.96259 WP_003412205.1.96286 WP_003412205.1.96313 WP_003412205.1.96318 WP_003412205.1.96345 WP_003412205.1.96360 WP_003412205.1.96373 WP_003412205.1.96456 WP_003412205.1.96486 WP_003412205.1.96560 WP_003412205.1.96569 WP_003412205.1.96573 WP_003412205.1.96575 WP_003412205.1.96576 WP_003412205.1.96611 WP_003412205.1.96621 WP_003412205.1.9667 WP_003412205.1.96681 WP_003412205.1.96726 WP_003412205.1.96733 WP_003412205.1.96742 WP_003412205.1.96754 WP_003412205.1.9678 WP_003412205.1.96832 WP_003412205.1.9685 WP_003412205.1.97008 WP_003412205.1.97009 WP_003412205.1.97056 WP_003412205.1.97084 WP_003412205.1.97087 WP_003412205.1.97094 WP_003412205.1.97096 WP_003412205.1.97099 WP_003412205.1.97108 WP_003412205.1.97113 WP_003412205.1.97122 WP_003412205.1.97127 WP_003412205.1.97129 WP_003412205.1.97136 WP_003412205.1.9716 WP_003412205.1.97176 WP_003412205.1.97222 WP_003412205.1.97223 WP_003412205.1.97237 WP_003412205.1.97242 WP_003412205.1.97270 WP_003412205.1.97283 WP_003412205.1.97296 WP_003412205.1.97321 WP_003412205.1.97325 WP_003412205.1.97330 WP_003412205.1.97366 WP_003412205.1.97376 WP_003412205.1.97380 WP_003412205.1.9739 WP_003412205.1.97462 WP_003412205.1.97517 WP_003412205.1.97519 WP_003412205.1.97535 WP_003412205.1.97540 WP_003412205.1.97545 WP_003412205.1.97546 WP_003412205.1.97550 WP_003412205.1.97568 WP_003412205.1.97577 WP_003412205.1.97584 WP_003412205.1.9759 WP_003412205.1.97591 WP_003412205.1.97596 WP_003412205.1.97609 WP_003412205.1.97618 WP_003412205.1.9763 WP_003412205.1.97669 WP_003412205.1.97673 WP_003412205.1.97700 WP_003412205.1.97701 WP_003412205.1.9773 WP_003412205.1.97730 WP_003412205.1.97740 WP_003412205.1.97751 WP_003412205.1.97754 WP_003412205.1.97797 WP_003412205.1.9782 WP_003412205.1.9784 WP_003412205.1.97888 WP_003412205.1.9790 WP_003412205.1.9795 WP_003412205.1.97951 WP_003412205.1.97958 WP_003412205.1.97966 WP_003412205.1.97977 WP_003412205.1.97979 WP_003412205.1.97995 WP_003412205.1.98018 WP_003412205.1.98034 WP_003412205.1.98052 WP_003412205.1.98071 WP_003412205.1.98072 WP_003412205.1.98113 WP_003412205.1.98114 WP_003412205.1.98128 WP_003412205.1.98181 WP_003412205.1.98188 WP_003412205.1.98189 WP_003412205.1.98213 WP_003412205.1.98225 WP_003412205.1.98291 WP_003412205.1.98335 WP_003412205.1.98350 WP_003412205.1.98395 WP_003412205.1.98412 WP_003412205.1.98441 WP_003412205.1.98443 WP_003412205.1.98462 WP_003412205.1.9848 WP_003412205.1.98482 WP_003412205.1.98486 WP_003412205.1.98488 WP_003412205.1.98503 WP_003412205.1.98516 WP_003412205.1.98524 WP_003412205.1.98536 WP_003412205.1.98541 WP_003412205.1.98566 WP_003412205.1.98576 WP_003412205.1.98590 WP_003412205.1.98594 WP_003412205.1.98599 WP_003412205.1.98629 WP_003412205.1.98645 WP_003412205.1.98646 WP_003412205.1.98649 WP_003412205.1.98656 WP_003412205.1.9867 WP_003412205.1.98674 WP_003412205.1.98697 WP_003412205.1.98701 WP_003412205.1.98739 WP_003412205.1.98749 WP_003412205.1.98765 WP_003412205.1.98770 WP_003412205.1.98777 WP_003412205.1.98778 WP_003412205.1.98802 WP_003412205.1.98838 WP_003412205.1.98850 WP_003412205.1.98906 WP_003412205.1.98935 WP_003412205.1.98948 WP_003412205.1.98953 WP_003412205.1.98984 WP_003412205.1.99000 WP_003412205.1.99023 WP_003412205.1.99030 WP_003412205.1.99037 WP_003412205.1.99055 WP_003412205.1.99062 WP_003412205.1.99086 WP_003412205.1.99115 WP_003412205.1.99117 WP_003412205.1.99161 WP_003412205.1.99176 WP_003412205.1.99205 WP_003412205.1.99211 WP_003412205.1.99216 WP_003412205.1.99222 WP_003412205.1.99251 WP_003412205.1.99269 WP_003412205.1.99294 WP_003412205.1.99312 WP_003412205.1.99315 WP_003412205.1.99316 WP_003412205.1.99322 WP_003412205.1.99328 WP_003412205.1.99365 WP_003412205.1.99368 WP_003412205.1.99379 WP_003412205.1.99396 WP_003412205.1.99402 WP_003412205.1.99404 WP_003412205.1.99419 WP_003412205.1.99438 WP_003412205.1.99460 WP_003412205.1.99468 WP_003412205.1.99473 WP_003412205.1.99513 WP_003412205.1.99529 WP_003412205.1.99548 WP_003412205.1.99572 WP_003412205.1.99575 WP_003412205.1.99578 WP_003412205.1.99605 WP_003412205.1.99609 WP_003412205.1.99617 WP_003412205.1.99635 WP_003412205.1.99650 WP_003412205.1.99672 WP_003412205.1.99701 WP_003412205.1.99711 WP_003412205.1.99716 WP_003412205.1.99740 WP_003412205.1.99745 WP_003412205.1.99749 WP_003412205.1.9976 WP_003412205.1.99798 WP_003412205.1.99817 WP_003412205.1.99832 WP_003412205.1.99847 WP_003412205.1.99852 WP_003412205.1.99886 WP_003412205.1.99897 WP_003412205.1.99899 WP_003412205.1.99915 WP_003412205.1.9993 WP_003412205.1.99982 WP_003412205.1.99991 gi|506926883|ref|YP_008007333.1| gi|449064419|ref|YP_007431502.1| gi|148662190|ref|YP_001283713.1| gi|385999138|ref|YP_005917437.1| gi|392386999|ref|YP_005308628.1| gi|121638237|ref|YP_978461.1| gi|15841870|ref|NP_336907.1| gi|433627487|ref|YP_007261116.1| Rv2358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]