SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740953|ref|YP_002162267.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740953|ref|YP_002162267.1|
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.22e-38
Family FUR-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197740953|ref|YP_002162267.1|
Sequence length 130
Comment zinc uptake regulation protein Zur [Mycobacterium tuberculosis str. Haarlem]
Sequence
MSAAGVRSTRQRAAISTLLETLDDFRSAQELHDELRRRGENIGLTTVYRTLQSMASSGLV
DTLHTDTGESVYRRCSEHHHHHLVCRSCGSTIEVGDHEVEAWAAEVATKHGFSDVSHTIE
IFGTCSDCRS
Download sequence
Identical sequences A0A045HBZ9 A0A0H3LCD0 A5U552 I6Y934 P9WN84 P9WN85 R4M489 R4MAE1
gi|479056321|ref|YP_007352127.1| gi|148662191|ref|YP_001283714.1| gi|479315301|ref|YP_007855353.1| gi|15841871|ref|NP_336908.1| gi|148823562|ref|YP_001288316.1| gi|15609496|ref|NP_216875.1| gi|197740953|ref|YP_002162267.1| gi|494696738|ref|YP_007962241.1| NP_216875.1.84033 WP_003899290.1.100021 WP_003899290.1.100069 WP_003899290.1.100087 WP_003899290.1.10015 WP_003899290.1.100208 WP_003899290.1.100216 WP_003899290.1.10022 WP_003899290.1.100255 WP_003899290.1.100260 WP_003899290.1.100270 WP_003899290.1.100279 WP_003899290.1.100286 WP_003899290.1.100308 WP_003899290.1.100309 WP_003899290.1.100318 WP_003899290.1.100338 WP_003899290.1.10037 WP_003899290.1.100383 WP_003899290.1.100396 WP_003899290.1.1004 WP_003899290.1.100401 WP_003899290.1.100459 WP_003899290.1.100460 WP_003899290.1.100552 WP_003899290.1.100581 WP_003899290.1.100600 WP_003899290.1.100625 WP_003899290.1.10064 WP_003899290.1.100666 WP_003899290.1.100671 WP_003899290.1.100677 WP_003899290.1.100697 WP_003899290.1.100703 WP_003899290.1.100716 WP_003899290.1.100722 WP_003899290.1.100754 WP_003899290.1.100757 WP_003899290.1.100772 WP_003899290.1.1008 WP_003899290.1.100812 WP_003899290.1.100845 WP_003899290.1.100866 WP_003899290.1.10088 WP_003899290.1.100889 WP_003899290.1.10090 WP_003899290.1.100910 WP_003899290.1.100915 WP_003899290.1.100918 WP_003899290.1.100935 WP_003899290.1.100984 WP_003899290.1.100992 WP_003899290.1.100998 WP_003899290.1.101 WP_003899290.1.101025 WP_003899290.1.101028 WP_003899290.1.10104 WP_003899290.1.101048 WP_003899290.1.101054 WP_003899290.1.101075 WP_003899290.1.101143 WP_003899290.1.10116 WP_003899290.1.10117 WP_003899290.1.101209 WP_003899290.1.10125 WP_003899290.1.101290 WP_003899290.1.101323 WP_003899290.1.101324 WP_003899290.1.101350 WP_003899290.1.101367 WP_003899290.1.101398 WP_003899290.1.101403 WP_003899290.1.101421 WP_003899290.1.10144 WP_003899290.1.101442 WP_003899290.1.10145 WP_003899290.1.101452 WP_003899290.1.101456 WP_003899290.1.101481 WP_003899290.1.101493 WP_003899290.1.101496 WP_003899290.1.101525 WP_003899290.1.101533 WP_003899290.1.101535 WP_003899290.1.101553 WP_003899290.1.101558 WP_003899290.1.10156 WP_003899290.1.101573 WP_003899290.1.101576 WP_003899290.1.10159 WP_003899290.1.101592 WP_003899290.1.101604 WP_003899290.1.101607 WP_003899290.1.101622 WP_003899290.1.101644 WP_003899290.1.101659 WP_003899290.1.101671 WP_003899290.1.101687 WP_003899290.1.101698 WP_003899290.1.10170 WP_003899290.1.101713 WP_003899290.1.101722 WP_003899290.1.101733 WP_003899290.1.101743 WP_003899290.1.101753 WP_003899290.1.101754 WP_003899290.1.101764 WP_003899290.1.101773 WP_003899290.1.101795 WP_003899290.1.101797 WP_003899290.1.101798 WP_003899290.1.101802 WP_003899290.1.101826 WP_003899290.1.101836 WP_003899290.1.101858 WP_003899290.1.101859 WP_003899290.1.101862 WP_003899290.1.101888 WP_003899290.1.101894 WP_003899290.1.101899 WP_003899290.1.1019 WP_003899290.1.101923 WP_003899290.1.101925 WP_003899290.1.10193 WP_003899290.1.102 WP_003899290.1.102008 WP_003899290.1.102017 WP_003899290.1.102053 WP_003899290.1.102055 WP_003899290.1.102063 WP_003899290.1.102099 WP_003899290.1.1021 WP_003899290.1.10211 WP_003899290.1.102119 WP_003899290.1.102121 WP_003899290.1.102143 WP_003899290.1.10216 WP_003899290.1.10224 WP_003899290.1.10253 WP_003899290.1.10262 WP_003899290.1.10272 WP_003899290.1.10277 WP_003899290.1.1033 WP_003899290.1.10350 WP_003899290.1.10362 WP_003899290.1.10366 WP_003899290.1.10376 WP_003899290.1.10396 WP_003899290.1.10410 WP_003899290.1.10430 WP_003899290.1.1044 WP_003899290.1.10440 WP_003899290.1.10445 WP_003899290.1.10471 WP_003899290.1.10472 WP_003899290.1.10489 WP_003899290.1.105 WP_003899290.1.10518 WP_003899290.1.10523 WP_003899290.1.10545 WP_003899290.1.1057 WP_003899290.1.10594 WP_003899290.1.10603 WP_003899290.1.10606 WP_003899290.1.10615 WP_003899290.1.10623 WP_003899290.1.10635 WP_003899290.1.10643 WP_003899290.1.10648 WP_003899290.1.10662 WP_003899290.1.10709 WP_003899290.1.10735 WP_003899290.1.10740 WP_003899290.1.10756 WP_003899290.1.1078 WP_003899290.1.10791 WP_003899290.1.10799 WP_003899290.1.10825 WP_003899290.1.10848 WP_003899290.1.10863 WP_003899290.1.10879 WP_003899290.1.10912 WP_003899290.1.10916 WP_003899290.1.10923 WP_003899290.1.10927 WP_003899290.1.1095 WP_003899290.1.10956 WP_003899290.1.10958 WP_003899290.1.10962 WP_003899290.1.10980 WP_003899290.1.10993 WP_003899290.1.1100 WP_003899290.1.11040 WP_003899290.1.11061 WP_003899290.1.11070 WP_003899290.1.11171 WP_003899290.1.11175 WP_003899290.1.11176 WP_003899290.1.11236 WP_003899290.1.11329 WP_003899290.1.1133 WP_003899290.1.11342 WP_003899290.1.11373 WP_003899290.1.11376 WP_003899290.1.11390 WP_003899290.1.11402 WP_003899290.1.11481 WP_003899290.1.11487 WP_003899290.1.11489 WP_003899290.1.11514 WP_003899290.1.11589 WP_003899290.1.11596 WP_003899290.1.11604 WP_003899290.1.11610 WP_003899290.1.11697 WP_003899290.1.11707 WP_003899290.1.11752 WP_003899290.1.11758 WP_003899290.1.11775 WP_003899290.1.11804 WP_003899290.1.11822 WP_003899290.1.11826 WP_003899290.1.11856 WP_003899290.1.11898 WP_003899290.1.11906 WP_003899290.1.11939 WP_003899290.1.11960 WP_003899290.1.11961 WP_003899290.1.11972 WP_003899290.1.120 WP_003899290.1.12001 WP_003899290.1.12049 WP_003899290.1.12052 WP_003899290.1.12100 WP_003899290.1.12116 WP_003899290.1.12133 WP_003899290.1.12161 WP_003899290.1.12165 WP_003899290.1.12184 WP_003899290.1.12190 WP_003899290.1.12216 WP_003899290.1.12265 WP_003899290.1.12275 WP_003899290.1.12293 WP_003899290.1.12294 WP_003899290.1.123 WP_003899290.1.1231 WP_003899290.1.12314 WP_003899290.1.12327 WP_003899290.1.12338 WP_003899290.1.1236 WP_003899290.1.12371 WP_003899290.1.12372 WP_003899290.1.12389 WP_003899290.1.12406 WP_003899290.1.1241 WP_003899290.1.12421 WP_003899290.1.12446 WP_003899290.1.12464 WP_003899290.1.12479 WP_003899290.1.12519 WP_003899290.1.12523 WP_003899290.1.12526 WP_003899290.1.1255 WP_003899290.1.12550 WP_003899290.1.12551 WP_003899290.1.12563 WP_003899290.1.12611 WP_003899290.1.12669 WP_003899290.1.1267 WP_003899290.1.12672 WP_003899290.1.12692 WP_003899290.1.1271 WP_003899290.1.12768 WP_003899290.1.1279 WP_003899290.1.12794 WP_003899290.1.12804 WP_003899290.1.12821 WP_003899290.1.12841 WP_003899290.1.12854 WP_003899290.1.12871 WP_003899290.1.12901 WP_003899290.1.12941 WP_003899290.1.12947 WP_003899290.1.12957 WP_003899290.1.12972 WP_003899290.1.13028 WP_003899290.1.13043 WP_003899290.1.13086 WP_003899290.1.13087 WP_003899290.1.13090 WP_003899290.1.13096 WP_003899290.1.13163 WP_003899290.1.13175 WP_003899290.1.13183 WP_003899290.1.132 WP_003899290.1.13249 WP_003899290.1.13282 WP_003899290.1.13284 WP_003899290.1.13296 WP_003899290.1.13298 WP_003899290.1.13306 WP_003899290.1.13312 WP_003899290.1.13313 WP_003899290.1.13321 WP_003899290.1.13345 WP_003899290.1.13358 WP_003899290.1.13370 WP_003899290.1.13375 WP_003899290.1.1338 WP_003899290.1.13420 WP_003899290.1.13433 WP_003899290.1.13435 WP_003899290.1.13438 WP_003899290.1.13461 WP_003899290.1.13466 WP_003899290.1.13489 WP_003899290.1.13551 WP_003899290.1.13561 WP_003899290.1.13564 WP_003899290.1.13579 WP_003899290.1.13647 WP_003899290.1.13687 WP_003899290.1.13697 WP_003899290.1.13719 WP_003899290.1.13763 WP_003899290.1.1377 WP_003899290.1.13774 WP_003899290.1.13786 WP_003899290.1.13793 WP_003899290.1.13794 WP_003899290.1.13817 WP_003899290.1.13834 WP_003899290.1.13866 WP_003899290.1.13880 WP_003899290.1.13899 WP_003899290.1.13909 WP_003899290.1.13910 WP_003899290.1.13919 WP_003899290.1.13920 WP_003899290.1.13952 WP_003899290.1.13953 WP_003899290.1.13962 WP_003899290.1.1398 WP_003899290.1.13988 WP_003899290.1.14027 WP_003899290.1.14046 WP_003899290.1.14115 WP_003899290.1.1415 WP_003899290.1.14152 WP_003899290.1.14158 WP_003899290.1.14162 WP_003899290.1.14175 WP_003899290.1.14178 WP_003899290.1.14194 WP_003899290.1.14195 WP_003899290.1.14208 WP_003899290.1.14238 WP_003899290.1.14266 WP_003899290.1.14273 WP_003899290.1.14303 WP_003899290.1.14306 WP_003899290.1.14307 WP_003899290.1.14310 WP_003899290.1.14382 WP_003899290.1.14416 WP_003899290.1.14428 WP_003899290.1.14441 WP_003899290.1.14469 WP_003899290.1.14477 WP_003899290.1.14504 WP_003899290.1.14514 WP_003899290.1.1452 WP_003899290.1.14527 WP_003899290.1.1454 WP_003899290.1.14544 WP_003899290.1.14548 WP_003899290.1.14551 WP_003899290.1.14561 WP_003899290.1.14573 WP_003899290.1.1462 WP_003899290.1.14667 WP_003899290.1.14668 WP_003899290.1.14675 WP_003899290.1.14694 WP_003899290.1.14695 WP_003899290.1.14709 WP_003899290.1.14766 WP_003899290.1.14783 WP_003899290.1.14865 WP_003899290.1.14872 WP_003899290.1.14905 WP_003899290.1.14926 WP_003899290.1.14951 WP_003899290.1.14955 WP_003899290.1.15003 WP_003899290.1.15009 WP_003899290.1.15028 WP_003899290.1.15040 WP_003899290.1.15052 WP_003899290.1.15065 WP_003899290.1.15072 WP_003899290.1.15089 WP_003899290.1.1509 WP_003899290.1.15126 WP_003899290.1.15131 WP_003899290.1.15168 WP_003899290.1.15174 WP_003899290.1.15187 WP_003899290.1.15196 WP_003899290.1.15210 WP_003899290.1.15216 WP_003899290.1.15217 WP_003899290.1.1523 WP_003899290.1.15232 WP_003899290.1.15238 WP_003899290.1.15240 WP_003899290.1.15253 WP_003899290.1.1527 WP_003899290.1.15292 WP_003899290.1.15299 WP_003899290.1.15302 WP_003899290.1.15322 WP_003899290.1.1534 WP_003899290.1.15365 WP_003899290.1.15386 WP_003899290.1.15387 WP_003899290.1.15442 WP_003899290.1.15447 WP_003899290.1.15449 WP_003899290.1.15477 WP_003899290.1.15481 WP_003899290.1.15492 WP_003899290.1.15511 WP_003899290.1.15512 WP_003899290.1.15558 WP_003899290.1.15559 WP_003899290.1.15566 WP_003899290.1.15599 WP_003899290.1.1560 WP_003899290.1.15611 WP_003899290.1.1563 WP_003899290.1.15633 WP_003899290.1.15643 WP_003899290.1.15688 WP_003899290.1.15755 WP_003899290.1.15763 WP_003899290.1.15774 WP_003899290.1.1578 WP_003899290.1.15780 WP_003899290.1.15834 WP_003899290.1.15842 WP_003899290.1.15848 WP_003899290.1.15853 WP_003899290.1.15870 WP_003899290.1.15877 WP_003899290.1.15893 WP_003899290.1.15896 WP_003899290.1.15926 WP_003899290.1.15933 WP_003899290.1.15946 WP_003899290.1.15958 WP_003899290.1.15973 WP_003899290.1.15987 WP_003899290.1.15993 WP_003899290.1.16009 WP_003899290.1.16025 WP_003899290.1.16043 WP_003899290.1.16066 WP_003899290.1.16069 WP_003899290.1.16077 WP_003899290.1.16106 WP_003899290.1.16108 WP_003899290.1.16130 WP_003899290.1.16136 WP_003899290.1.16139 WP_003899290.1.16141 WP_003899290.1.16143 WP_003899290.1.1630 WP_003899290.1.16318 WP_003899290.1.1632 WP_003899290.1.16327 WP_003899290.1.16334 WP_003899290.1.16341 WP_003899290.1.16345 WP_003899290.1.16374 WP_003899290.1.16384 WP_003899290.1.16386 WP_003899290.1.164 WP_003899290.1.1642 WP_003899290.1.16424 WP_003899290.1.16431 WP_003899290.1.1644 WP_003899290.1.16442 WP_003899290.1.16448 WP_003899290.1.16451 WP_003899290.1.16476 WP_003899290.1.16480 WP_003899290.1.16494 WP_003899290.1.1652 WP_003899290.1.16549 WP_003899290.1.16560 WP_003899290.1.16598 WP_003899290.1.16609 WP_003899290.1.16619 WP_003899290.1.16620 WP_003899290.1.16622 WP_003899290.1.16637 WP_003899290.1.1669 WP_003899290.1.16707 WP_003899290.1.16724 WP_003899290.1.16731 WP_003899290.1.16743 WP_003899290.1.1683 WP_003899290.1.16837 WP_003899290.1.16852 WP_003899290.1.16937 WP_003899290.1.16940 WP_003899290.1.16950 WP_003899290.1.16959 WP_003899290.1.16968 WP_003899290.1.1697 WP_003899290.1.16977 WP_003899290.1.16987 WP_003899290.1.17005 WP_003899290.1.17006 WP_003899290.1.17010 WP_003899290.1.17015 WP_003899290.1.17019 WP_003899290.1.17041 WP_003899290.1.17052 WP_003899290.1.17057 WP_003899290.1.17062 WP_003899290.1.1707 WP_003899290.1.17094 WP_003899290.1.17130 WP_003899290.1.17138 WP_003899290.1.17147 WP_003899290.1.17224 WP_003899290.1.17251 WP_003899290.1.17288 WP_003899290.1.17304 WP_003899290.1.17345 WP_003899290.1.17381 WP_003899290.1.17391 WP_003899290.1.17412 WP_003899290.1.1743 WP_003899290.1.17440 WP_003899290.1.17466 WP_003899290.1.17477 WP_003899290.1.17483 WP_003899290.1.17505 WP_003899290.1.17527 WP_003899290.1.17535 WP_003899290.1.17540 WP_003899290.1.17553 WP_003899290.1.17558 WP_003899290.1.17599 WP_003899290.1.17635 WP_003899290.1.17655 WP_003899290.1.17679 WP_003899290.1.17687 WP_003899290.1.17700 WP_003899290.1.17710 WP_003899290.1.17713 WP_003899290.1.17722 WP_003899290.1.17746 WP_003899290.1.17788 WP_003899290.1.17798 WP_003899290.1.17803 WP_003899290.1.17816 WP_003899290.1.17821 WP_003899290.1.17830 WP_003899290.1.17868 WP_003899290.1.17878 WP_003899290.1.1792 WP_003899290.1.17923 WP_003899290.1.1795 WP_003899290.1.17955 WP_003899290.1.17973 WP_003899290.1.18009 WP_003899290.1.18033 WP_003899290.1.18057 WP_003899290.1.18065 WP_003899290.1.18070 WP_003899290.1.18116 WP_003899290.1.18120 WP_003899290.1.18126 WP_003899290.1.1817 WP_003899290.1.18170 WP_003899290.1.18206 WP_003899290.1.18216 WP_003899290.1.18240 WP_003899290.1.18257 WP_003899290.1.18297 WP_003899290.1.18306 WP_003899290.1.18364 WP_003899290.1.18399 WP_003899290.1.18411 WP_003899290.1.18444 WP_003899290.1.18448 WP_003899290.1.18467 WP_003899290.1.18476 WP_003899290.1.18522 WP_003899290.1.18580 WP_003899290.1.18582 WP_003899290.1.18587 WP_003899290.1.186 WP_003899290.1.18601 WP_003899290.1.18639 WP_003899290.1.18646 WP_003899290.1.18647 WP_003899290.1.1868 WP_003899290.1.18694 WP_003899290.1.18710 WP_003899290.1.18751 WP_003899290.1.18781 WP_003899290.1.18793 WP_003899290.1.18804 WP_003899290.1.18816 WP_003899290.1.18823 WP_003899290.1.18827 WP_003899290.1.18838 WP_003899290.1.18849 WP_003899290.1.18856 WP_003899290.1.18945 WP_003899290.1.1898 WP_003899290.1.19005 WP_003899290.1.19056 WP_003899290.1.19066 WP_003899290.1.19071 WP_003899290.1.19085 WP_003899290.1.19094 WP_003899290.1.19144 WP_003899290.1.19159 WP_003899290.1.19193 WP_003899290.1.19231 WP_003899290.1.19243 WP_003899290.1.19264 WP_003899290.1.19295 WP_003899290.1.19307 WP_003899290.1.19326 WP_003899290.1.1933 WP_003899290.1.19364 WP_003899290.1.19382 WP_003899290.1.19400 WP_003899290.1.19426 WP_003899290.1.19429 WP_003899290.1.19464 WP_003899290.1.19480 WP_003899290.1.19553 WP_003899290.1.19562 WP_003899290.1.19564 WP_003899290.1.19568 WP_003899290.1.19572 WP_003899290.1.19595 WP_003899290.1.19596 WP_003899290.1.19600 WP_003899290.1.19630 WP_003899290.1.1967 WP_003899290.1.19694 WP_003899290.1.1970 WP_003899290.1.19707 WP_003899290.1.19742 WP_003899290.1.19820 WP_003899290.1.19868 WP_003899290.1.19874 WP_003899290.1.19890 WP_003899290.1.19900 WP_003899290.1.19922 WP_003899290.1.19936 WP_003899290.1.19946 WP_003899290.1.19949 WP_003899290.1.19960 WP_003899290.1.19964 WP_003899290.1.20007 WP_003899290.1.20016 WP_003899290.1.2003 WP_003899290.1.20037 WP_003899290.1.20039 WP_003899290.1.20082 WP_003899290.1.20085 WP_003899290.1.20097 WP_003899290.1.20116 WP_003899290.1.20130 WP_003899290.1.20140 WP_003899290.1.20141 WP_003899290.1.20142 WP_003899290.1.20158 WP_003899290.1.20239 WP_003899290.1.20243 WP_003899290.1.20259 WP_003899290.1.20262 WP_003899290.1.20272 WP_003899290.1.20280 WP_003899290.1.20294 WP_003899290.1.20300 WP_003899290.1.20309 WP_003899290.1.20322 WP_003899290.1.2037 WP_003899290.1.20372 WP_003899290.1.20381 WP_003899290.1.204 WP_003899290.1.20427 WP_003899290.1.20457 WP_003899290.1.20459 WP_003899290.1.20460 WP_003899290.1.20542 WP_003899290.1.20578 WP_003899290.1.20608 WP_003899290.1.20624 WP_003899290.1.20628 WP_003899290.1.2066 WP_003899290.1.20707 WP_003899290.1.20722 WP_003899290.1.20729 WP_003899290.1.20742 WP_003899290.1.20751 WP_003899290.1.20776 WP_003899290.1.20843 WP_003899290.1.20850 WP_003899290.1.2086 WP_003899290.1.20868 WP_003899290.1.20876 WP_003899290.1.20897 WP_003899290.1.20898 WP_003899290.1.2090 WP_003899290.1.20911 WP_003899290.1.20921 WP_003899290.1.20926 WP_003899290.1.20927 WP_003899290.1.20951 WP_003899290.1.20970 WP_003899290.1.2104 WP_003899290.1.21070 WP_003899290.1.21127 WP_003899290.1.21135 WP_003899290.1.21173 WP_003899290.1.21187 WP_003899290.1.212 WP_003899290.1.2120 WP_003899290.1.21218 WP_003899290.1.21219 WP_003899290.1.2123 WP_003899290.1.21231 WP_003899290.1.21234 WP_003899290.1.2126 WP_003899290.1.21292 WP_003899290.1.21307 WP_003899290.1.2131 WP_003899290.1.21311 WP_003899290.1.21321 WP_003899290.1.21365 WP_003899290.1.21392 WP_003899290.1.21397 WP_003899290.1.21403 WP_003899290.1.21415 WP_003899290.1.21430 WP_003899290.1.21434 WP_003899290.1.21444 WP_003899290.1.21468 WP_003899290.1.21498 WP_003899290.1.21509 WP_003899290.1.21513 WP_003899290.1.21560 WP_003899290.1.21565 WP_003899290.1.21586 WP_003899290.1.21591 WP_003899290.1.21594 WP_003899290.1.21602 WP_003899290.1.21615 WP_003899290.1.21638 WP_003899290.1.21639 WP_003899290.1.21655 WP_003899290.1.21658 WP_003899290.1.2168 WP_003899290.1.2174 WP_003899290.1.21741 WP_003899290.1.21777 WP_003899290.1.21786 WP_003899290.1.21795 WP_003899290.1.218 WP_003899290.1.21826 WP_003899290.1.21829 WP_003899290.1.21840 WP_003899290.1.21843 WP_003899290.1.21872 WP_003899290.1.21873 WP_003899290.1.2188 WP_003899290.1.21882 WP_003899290.1.21906 WP_003899290.1.21912 WP_003899290.1.2194 WP_003899290.1.21941 WP_003899290.1.21956 WP_003899290.1.21958 WP_003899290.1.21960 WP_003899290.1.21971 WP_003899290.1.21973 WP_003899290.1.21983 WP_003899290.1.22003 WP_003899290.1.22013 WP_003899290.1.22025 WP_003899290.1.22036 WP_003899290.1.22075 WP_003899290.1.22092 WP_003899290.1.2212 WP_003899290.1.22127 WP_003899290.1.22140 WP_003899290.1.22233 WP_003899290.1.22255 WP_003899290.1.22277 WP_003899290.1.22348 WP_003899290.1.22366 WP_003899290.1.2238 WP_003899290.1.22380 WP_003899290.1.22437 WP_003899290.1.22438 WP_003899290.1.22511 WP_003899290.1.22524 WP_003899290.1.22585 WP_003899290.1.22606 WP_003899290.1.22608 WP_003899290.1.22609 WP_003899290.1.22618 WP_003899290.1.2262 WP_003899290.1.22624 WP_003899290.1.22629 WP_003899290.1.22647 WP_003899290.1.22664 WP_003899290.1.22665 WP_003899290.1.22670 WP_003899290.1.22725 WP_003899290.1.22728 WP_003899290.1.22733 WP_003899290.1.22737 WP_003899290.1.2275 WP_003899290.1.22754 WP_003899290.1.22800 WP_003899290.1.22804 WP_003899290.1.22829 WP_003899290.1.22840 WP_003899290.1.22844 WP_003899290.1.22970 WP_003899290.1.22996 WP_003899290.1.22997 WP_003899290.1.22999 WP_003899290.1.23015 WP_003899290.1.23032 WP_003899290.1.231 WP_003899290.1.23101 WP_003899290.1.2312 WP_003899290.1.23153 WP_003899290.1.23171 WP_003899290.1.23199 WP_003899290.1.2320 WP_003899290.1.23204 WP_003899290.1.23216 WP_003899290.1.23229 WP_003899290.1.23233 WP_003899290.1.2326 WP_003899290.1.23261 WP_003899290.1.23272 WP_003899290.1.23289 WP_003899290.1.2329 WP_003899290.1.23308 WP_003899290.1.23316 WP_003899290.1.23321 WP_003899290.1.23325 WP_003899290.1.2339 WP_003899290.1.23406 WP_003899290.1.23438 WP_003899290.1.23445 WP_003899290.1.23447 WP_003899290.1.23452 WP_003899290.1.23461 WP_003899290.1.2349 WP_003899290.1.23496 WP_003899290.1.23506 WP_003899290.1.23530 WP_003899290.1.23539 WP_003899290.1.23546 WP_003899290.1.23551 WP_003899290.1.23573 WP_003899290.1.23583 WP_003899290.1.23588 WP_003899290.1.23628 WP_003899290.1.23677 WP_003899290.1.23683 WP_003899290.1.23692 WP_003899290.1.23694 WP_003899290.1.23699 WP_003899290.1.2371 WP_003899290.1.23807 WP_003899290.1.23825 WP_003899290.1.23832 WP_003899290.1.2384 WP_003899290.1.23843 WP_003899290.1.23863 WP_003899290.1.23894 WP_003899290.1.23993 WP_003899290.1.2400 WP_003899290.1.24007 WP_003899290.1.24008 WP_003899290.1.24046 WP_003899290.1.24057 WP_003899290.1.24113 WP_003899290.1.24119 WP_003899290.1.24140 WP_003899290.1.24176 WP_003899290.1.24190 WP_003899290.1.24202 WP_003899290.1.24261 WP_003899290.1.24284 WP_003899290.1.24294 WP_003899290.1.24357 WP_003899290.1.24396 WP_003899290.1.24423 WP_003899290.1.2443 WP_003899290.1.24446 WP_003899290.1.24461 WP_003899290.1.24500 WP_003899290.1.24507 WP_003899290.1.24509 WP_003899290.1.24529 WP_003899290.1.24553 WP_003899290.1.24599 WP_003899290.1.24638 WP_003899290.1.24648 WP_003899290.1.2466 WP_003899290.1.24824 WP_003899290.1.24831 WP_003899290.1.24840 WP_003899290.1.24848 WP_003899290.1.24857 WP_003899290.1.2487 WP_003899290.1.24893 WP_003899290.1.24933 WP_003899290.1.24956 WP_003899290.1.24958 WP_003899290.1.24985 WP_003899290.1.2499 WP_003899290.1.25004 WP_003899290.1.2505 WP_003899290.1.25051 WP_003899290.1.2507 WP_003899290.1.25096 WP_003899290.1.25103 WP_003899290.1.25129 WP_003899290.1.25171 WP_003899290.1.25184 WP_003899290.1.25247 WP_003899290.1.25278 WP_003899290.1.25309 WP_003899290.1.25313 WP_003899290.1.25338 WP_003899290.1.25342 WP_003899290.1.25343 WP_003899290.1.25367 WP_003899290.1.25393 WP_003899290.1.25406 WP_003899290.1.25435 WP_003899290.1.25437 WP_003899290.1.25445 WP_003899290.1.25455 WP_003899290.1.25473 WP_003899290.1.25504 WP_003899290.1.25513 WP_003899290.1.25542 WP_003899290.1.25579 WP_003899290.1.25594 WP_003899290.1.25606 WP_003899290.1.25645 WP_003899290.1.2566 WP_003899290.1.25673 WP_003899290.1.25674 WP_003899290.1.25693 WP_003899290.1.25699 WP_003899290.1.25727 WP_003899290.1.25736 WP_003899290.1.25738 WP_003899290.1.25756 WP_003899290.1.25759 WP_003899290.1.2580 WP_003899290.1.25813 WP_003899290.1.25854 WP_003899290.1.25874 WP_003899290.1.25885 WP_003899290.1.25892 WP_003899290.1.25906 WP_003899290.1.25914 WP_003899290.1.25916 WP_003899290.1.2594 WP_003899290.1.25954 WP_003899290.1.25972 WP_003899290.1.26017 WP_003899290.1.26032 WP_003899290.1.26038 WP_003899290.1.26072 WP_003899290.1.26089 WP_003899290.1.26097 WP_003899290.1.26098 WP_003899290.1.26108 WP_003899290.1.26118 WP_003899290.1.26126 WP_003899290.1.2614 WP_003899290.1.26168 WP_003899290.1.26182 WP_003899290.1.26190 WP_003899290.1.2620 WP_003899290.1.26243 WP_003899290.1.26267 WP_003899290.1.26292 WP_003899290.1.26310 WP_003899290.1.26328 WP_003899290.1.26349 WP_003899290.1.26366 WP_003899290.1.26374 WP_003899290.1.26407 WP_003899290.1.26454 WP_003899290.1.26464 WP_003899290.1.2653 WP_003899290.1.26560 WP_003899290.1.26571 WP_003899290.1.2659 WP_003899290.1.26597 WP_003899290.1.26603 WP_003899290.1.26629 WP_003899290.1.26651 WP_003899290.1.26702 WP_003899290.1.26707 WP_003899290.1.26710 WP_003899290.1.26719 WP_003899290.1.26737 WP_003899290.1.26738 WP_003899290.1.26745 WP_003899290.1.26756 WP_003899290.1.2676 WP_003899290.1.2677 WP_003899290.1.26779 WP_003899290.1.26780 WP_003899290.1.26854 WP_003899290.1.26868 WP_003899290.1.26888 WP_003899290.1.26914 WP_003899290.1.26945 WP_003899290.1.26959 WP_003899290.1.26969 WP_003899290.1.26984 WP_003899290.1.26992 WP_003899290.1.27017 WP_003899290.1.27045 WP_003899290.1.27074 WP_003899290.1.27075 WP_003899290.1.27128 WP_003899290.1.27130 WP_003899290.1.27139 WP_003899290.1.27152 WP_003899290.1.27162 WP_003899290.1.27164 WP_003899290.1.27193 WP_003899290.1.27235 WP_003899290.1.27278 WP_003899290.1.27343 WP_003899290.1.27352 WP_003899290.1.27369 WP_003899290.1.27391 WP_003899290.1.27398 WP_003899290.1.27402 WP_003899290.1.27410 WP_003899290.1.27411 WP_003899290.1.27449 WP_003899290.1.27460 WP_003899290.1.27463 WP_003899290.1.2749 WP_003899290.1.27492 WP_003899290.1.27528 WP_003899290.1.27541 WP_003899290.1.27576 WP_003899290.1.27582 WP_003899290.1.27596 WP_003899290.1.27607 WP_003899290.1.2766 WP_003899290.1.277 WP_003899290.1.27724 WP_003899290.1.27730 WP_003899290.1.27736 WP_003899290.1.27743 WP_003899290.1.27750 WP_003899290.1.27771 WP_003899290.1.27779 WP_003899290.1.27795 WP_003899290.1.27819 WP_003899290.1.27835 WP_003899290.1.27915 WP_003899290.1.27935 WP_003899290.1.27962 WP_003899290.1.28053 WP_003899290.1.28092 WP_003899290.1.28106 WP_003899290.1.28131 WP_003899290.1.28142 WP_003899290.1.28159 WP_003899290.1.2816 WP_003899290.1.28161 WP_003899290.1.28192 WP_003899290.1.28202 WP_003899290.1.28241 WP_003899290.1.28242 WP_003899290.1.28251 WP_003899290.1.28255 WP_003899290.1.28269 WP_003899290.1.28276 WP_003899290.1.28293 WP_003899290.1.28331 WP_003899290.1.28367 WP_003899290.1.28378 WP_003899290.1.28391 WP_003899290.1.2842 WP_003899290.1.28448 WP_003899290.1.2847 WP_003899290.1.28471 WP_003899290.1.28473 WP_003899290.1.28493 WP_003899290.1.28497 WP_003899290.1.28530 WP_003899290.1.28545 WP_003899290.1.28561 WP_003899290.1.28567 WP_003899290.1.28585 WP_003899290.1.286 WP_003899290.1.28610 WP_003899290.1.28617 WP_003899290.1.28634 WP_003899290.1.28642 WP_003899290.1.28671 WP_003899290.1.28698 WP_003899290.1.28703 WP_003899290.1.28739 WP_003899290.1.28781 WP_003899290.1.28787 WP_003899290.1.28827 WP_003899290.1.28839 WP_003899290.1.28847 WP_003899290.1.28850 WP_003899290.1.28851 WP_003899290.1.28865 WP_003899290.1.28897 WP_003899290.1.28914 WP_003899290.1.28935 WP_003899290.1.28936 WP_003899290.1.28939 WP_003899290.1.28943 WP_003899290.1.28952 WP_003899290.1.28975 WP_003899290.1.2899 WP_003899290.1.28993 WP_003899290.1.29000 WP_003899290.1.2901 WP_003899290.1.29028 WP_003899290.1.29033 WP_003899290.1.29058 WP_003899290.1.2916 WP_003899290.1.29217 WP_003899290.1.29234 WP_003899290.1.29264 WP_003899290.1.29275 WP_003899290.1.29306 WP_003899290.1.29339 WP_003899290.1.29348 WP_003899290.1.29364 WP_003899290.1.29367 WP_003899290.1.2938 WP_003899290.1.29426 WP_003899290.1.2944 WP_003899290.1.29449 WP_003899290.1.29450 WP_003899290.1.29452 WP_003899290.1.29510 WP_003899290.1.29515 WP_003899290.1.29525 WP_003899290.1.2953 WP_003899290.1.29587 WP_003899290.1.2959 WP_003899290.1.29592 WP_003899290.1.29599 WP_003899290.1.29611 WP_003899290.1.29632 WP_003899290.1.29649 WP_003899290.1.2965 WP_003899290.1.29659 WP_003899290.1.2969 WP_003899290.1.29696 WP_003899290.1.29698 WP_003899290.1.29718 WP_003899290.1.29745 WP_003899290.1.29747 WP_003899290.1.29769 WP_003899290.1.29830 WP_003899290.1.29847 WP_003899290.1.29861 WP_003899290.1.29869 WP_003899290.1.29883 WP_003899290.1.29890 WP_003899290.1.299 WP_003899290.1.29931 WP_003899290.1.30014 WP_003899290.1.3004 WP_003899290.1.30040 WP_003899290.1.30043 WP_003899290.1.30074 WP_003899290.1.30097 WP_003899290.1.30106 WP_003899290.1.30114 WP_003899290.1.30126 WP_003899290.1.30131 WP_003899290.1.30138 WP_003899290.1.30139 WP_003899290.1.30235 WP_003899290.1.30237 WP_003899290.1.3027 WP_003899290.1.30279 WP_003899290.1.30282 WP_003899290.1.30283 WP_003899290.1.30288 WP_003899290.1.30291 WP_003899290.1.30363 WP_003899290.1.30374 WP_003899290.1.30404 WP_003899290.1.30433 WP_003899290.1.30438 WP_003899290.1.30462 WP_003899290.1.30464 WP_003899290.1.30468 WP_003899290.1.30500 WP_003899290.1.3057 WP_003899290.1.30574 WP_003899290.1.30628 WP_003899290.1.30641 WP_003899290.1.30642 WP_003899290.1.30661 WP_003899290.1.30683 WP_003899290.1.30699 WP_003899290.1.30709 WP_003899290.1.30713 WP_003899290.1.30716 WP_003899290.1.30719 WP_003899290.1.30730 WP_003899290.1.30736 WP_003899290.1.30760 WP_003899290.1.30791 WP_003899290.1.308 WP_003899290.1.30807 WP_003899290.1.30818 WP_003899290.1.30824 WP_003899290.1.30848 WP_003899290.1.30877 WP_003899290.1.30888 WP_003899290.1.30901 WP_003899290.1.30903 WP_003899290.1.30912 WP_003899290.1.30913 WP_003899290.1.30914 WP_003899290.1.30919 WP_003899290.1.30977 WP_003899290.1.3100 WP_003899290.1.31002 WP_003899290.1.3101 WP_003899290.1.31034 WP_003899290.1.31047 WP_003899290.1.31070 WP_003899290.1.31074 WP_003899290.1.31102 WP_003899290.1.31127 WP_003899290.1.31184 WP_003899290.1.31199 WP_003899290.1.31226 WP_003899290.1.31230 WP_003899290.1.31233 WP_003899290.1.31263 WP_003899290.1.31264 WP_003899290.1.31270 WP_003899290.1.31287 WP_003899290.1.31290 WP_003899290.1.31304 WP_003899290.1.31346 WP_003899290.1.31348 WP_003899290.1.31354 WP_003899290.1.31390 WP_003899290.1.31414 WP_003899290.1.31417 WP_003899290.1.31428 WP_003899290.1.3143 WP_003899290.1.31458 WP_003899290.1.31483 WP_003899290.1.3149 WP_003899290.1.31498 WP_003899290.1.31507 WP_003899290.1.31537 WP_003899290.1.31548 WP_003899290.1.31569 WP_003899290.1.31573 WP_003899290.1.316 WP_003899290.1.31629 WP_003899290.1.31666 WP_003899290.1.31693 WP_003899290.1.31703 WP_003899290.1.31744 WP_003899290.1.31745 WP_003899290.1.31770 WP_003899290.1.31776 WP_003899290.1.31783 WP_003899290.1.318 WP_003899290.1.3184 WP_003899290.1.31840 WP_003899290.1.31880 WP_003899290.1.31911 WP_003899290.1.31930 WP_003899290.1.31932 WP_003899290.1.31955 WP_003899290.1.31985 WP_003899290.1.31991 WP_003899290.1.31995 WP_003899290.1.32004 WP_003899290.1.32039 WP_003899290.1.3204 WP_003899290.1.32045 WP_003899290.1.32071 WP_003899290.1.32098 WP_003899290.1.32132 WP_003899290.1.32157 WP_003899290.1.32179 WP_003899290.1.32198 WP_003899290.1.32297 WP_003899290.1.32317 WP_003899290.1.32383 WP_003899290.1.32400 WP_003899290.1.32403 WP_003899290.1.32416 WP_003899290.1.32421 WP_003899290.1.32433 WP_003899290.1.32461 WP_003899290.1.32482 WP_003899290.1.32503 WP_003899290.1.32556 WP_003899290.1.32562 WP_003899290.1.32569 WP_003899290.1.32592 WP_003899290.1.32620 WP_003899290.1.32647 WP_003899290.1.32653 WP_003899290.1.32654 WP_003899290.1.3268 WP_003899290.1.32695 WP_003899290.1.32706 WP_003899290.1.32716 WP_003899290.1.32738 WP_003899290.1.32752 WP_003899290.1.32780 WP_003899290.1.32781 WP_003899290.1.32793 WP_003899290.1.32799 WP_003899290.1.32833 WP_003899290.1.32862 WP_003899290.1.32880 WP_003899290.1.32897 WP_003899290.1.32909 WP_003899290.1.32935 WP_003899290.1.32974 WP_003899290.1.33007 WP_003899290.1.3302 WP_003899290.1.33028 WP_003899290.1.33044 WP_003899290.1.33054 WP_003899290.1.33082 WP_003899290.1.33141 WP_003899290.1.33148 WP_003899290.1.33155 WP_003899290.1.3321 WP_003899290.1.33215 WP_003899290.1.3325 WP_003899290.1.3327 WP_003899290.1.33278 WP_003899290.1.33288 WP_003899290.1.33305 WP_003899290.1.3331 WP_003899290.1.33319 WP_003899290.1.3333 WP_003899290.1.33393 WP_003899290.1.33403 WP_003899290.1.33452 WP_003899290.1.33467 WP_003899290.1.33477 WP_003899290.1.3349 WP_003899290.1.33519 WP_003899290.1.33542 WP_003899290.1.33601 WP_003899290.1.33602 WP_003899290.1.33633 WP_003899290.1.33646 WP_003899290.1.33673 WP_003899290.1.3369 WP_003899290.1.33705 WP_003899290.1.33762 WP_003899290.1.33783 WP_003899290.1.33789 WP_003899290.1.3383 WP_003899290.1.33832 WP_003899290.1.33839 WP_003899290.1.33848 WP_003899290.1.3387 WP_003899290.1.33886 WP_003899290.1.33895 WP_003899290.1.33912 WP_003899290.1.33954 WP_003899290.1.34042 WP_003899290.1.3405 WP_003899290.1.34055 WP_003899290.1.34056 WP_003899290.1.34065 WP_003899290.1.3408 WP_003899290.1.34090 WP_003899290.1.34109 WP_003899290.1.34152 WP_003899290.1.34163 WP_003899290.1.34181 WP_003899290.1.34197 WP_003899290.1.34198 WP_003899290.1.34215 WP_003899290.1.34219 WP_003899290.1.34255 WP_003899290.1.34260 WP_003899290.1.34275 WP_003899290.1.343 WP_003899290.1.34347 WP_003899290.1.34392 WP_003899290.1.344 WP_003899290.1.34428 WP_003899290.1.3443 WP_003899290.1.34435 WP_003899290.1.34446 WP_003899290.1.34499 WP_003899290.1.34505 WP_003899290.1.34516 WP_003899290.1.34529 WP_003899290.1.34551 WP_003899290.1.34563 WP_003899290.1.34576 WP_003899290.1.34581 WP_003899290.1.34588 WP_003899290.1.34596 WP_003899290.1.34599 WP_003899290.1.34639 WP_003899290.1.34673 WP_003899290.1.34724 WP_003899290.1.34740 WP_003899290.1.34755 WP_003899290.1.34777 WP_003899290.1.34783 WP_003899290.1.34841 WP_003899290.1.34908 WP_003899290.1.34919 WP_003899290.1.3492 WP_003899290.1.34933 WP_003899290.1.34945 WP_003899290.1.34946 WP_003899290.1.34954 WP_003899290.1.34960 WP_003899290.1.34961 WP_003899290.1.34963 WP_003899290.1.34965 WP_003899290.1.34968 WP_003899290.1.35023 WP_003899290.1.35069 WP_003899290.1.35072 WP_003899290.1.35078 WP_003899290.1.35156 WP_003899290.1.35160 WP_003899290.1.35162 WP_003899290.1.35176 WP_003899290.1.3520 WP_003899290.1.35213 WP_003899290.1.35221 WP_003899290.1.35246 WP_003899290.1.35278 WP_003899290.1.35301 WP_003899290.1.35311 WP_003899290.1.35312 WP_003899290.1.35317 WP_003899290.1.35319 WP_003899290.1.35347 WP_003899290.1.35363 WP_003899290.1.35382 WP_003899290.1.35385 WP_003899290.1.35396 WP_003899290.1.35397 WP_003899290.1.35426 WP_003899290.1.35439 WP_003899290.1.35455 WP_003899290.1.3548 WP_003899290.1.35484 WP_003899290.1.35492 WP_003899290.1.3553 WP_003899290.1.35553 WP_003899290.1.35555 WP_003899290.1.35561 WP_003899290.1.35610 WP_003899290.1.35635 WP_003899290.1.35657 WP_003899290.1.35687 WP_003899290.1.35689 WP_003899290.1.35707 WP_003899290.1.35732 WP_003899290.1.35754 WP_003899290.1.35767 WP_003899290.1.35770 WP_003899290.1.35771 WP_003899290.1.35780 WP_003899290.1.35805 WP_003899290.1.35821 WP_003899290.1.3584 WP_003899290.1.35848 WP_003899290.1.35864 WP_003899290.1.35874 WP_003899290.1.35876 WP_003899290.1.35899 WP_003899290.1.35954 WP_003899290.1.36005 WP_003899290.1.36014 WP_003899290.1.36023 WP_003899290.1.36051 WP_003899290.1.36053 WP_003899290.1.36075 WP_003899290.1.36089 WP_003899290.1.36097 WP_003899290.1.36098 WP_003899290.1.36116 WP_003899290.1.36145 WP_003899290.1.36205 WP_003899290.1.36228 WP_003899290.1.36252 WP_003899290.1.36260 WP_003899290.1.36271 WP_003899290.1.36303 WP_003899290.1.36309 WP_003899290.1.36315 WP_003899290.1.36319 WP_003899290.1.36321 WP_003899290.1.36326 WP_003899290.1.3634 WP_003899290.1.36356 WP_003899290.1.36357 WP_003899290.1.3636 WP_003899290.1.36385 WP_003899290.1.36399 WP_003899290.1.36436 WP_003899290.1.36465 WP_003899290.1.36469 WP_003899290.1.36473 WP_003899290.1.36485 WP_003899290.1.36508 WP_003899290.1.36540 WP_003899290.1.36561 WP_003899290.1.36571 WP_003899290.1.36573 WP_003899290.1.36578 WP_003899290.1.36585 WP_003899290.1.36597 WP_003899290.1.36614 WP_003899290.1.36674 WP_003899290.1.36720 WP_003899290.1.36727 WP_003899290.1.36733 WP_003899290.1.36785 WP_003899290.1.36810 WP_003899290.1.36862 WP_003899290.1.36901 WP_003899290.1.36921 WP_003899290.1.36935 WP_003899290.1.36941 WP_003899290.1.3695 WP_003899290.1.36968 WP_003899290.1.3700 WP_003899290.1.37004 WP_003899290.1.37012 WP_003899290.1.37071 WP_003899290.1.37088 WP_003899290.1.37131 WP_003899290.1.37157 WP_003899290.1.37175 WP_003899290.1.37188 WP_003899290.1.37213 WP_003899290.1.37229 WP_003899290.1.3724 WP_003899290.1.37277 WP_003899290.1.37305 WP_003899290.1.37330 WP_003899290.1.37389 WP_003899290.1.37400 WP_003899290.1.37440 WP_003899290.1.37459 WP_003899290.1.37468 WP_003899290.1.37475 WP_003899290.1.37484 WP_003899290.1.37601 WP_003899290.1.37612 WP_003899290.1.37632 WP_003899290.1.37643 WP_003899290.1.37655 WP_003899290.1.37660 WP_003899290.1.37674 WP_003899290.1.37700 WP_003899290.1.37701 WP_003899290.1.37709 WP_003899290.1.37711 WP_003899290.1.37721 WP_003899290.1.37722 WP_003899290.1.37747 WP_003899290.1.37765 WP_003899290.1.37772 WP_003899290.1.37804 WP_003899290.1.37809 WP_003899290.1.37859 WP_003899290.1.37877 WP_003899290.1.37912 WP_003899290.1.37913 WP_003899290.1.37943 WP_003899290.1.37950 WP_003899290.1.37973 WP_003899290.1.37975 WP_003899290.1.37983 WP_003899290.1.38 WP_003899290.1.38002 WP_003899290.1.3802 WP_003899290.1.38039 WP_003899290.1.38040 WP_003899290.1.38067 WP_003899290.1.38068 WP_003899290.1.38138 WP_003899290.1.38144 WP_003899290.1.38158 WP_003899290.1.38159 WP_003899290.1.38210 WP_003899290.1.38233 WP_003899290.1.38240 WP_003899290.1.38299 WP_003899290.1.38332 WP_003899290.1.38347 WP_003899290.1.38354 WP_003899290.1.38389 WP_003899290.1.38398 WP_003899290.1.38402 WP_003899290.1.38418 WP_003899290.1.38421 WP_003899290.1.38466 WP_003899290.1.38477 WP_003899290.1.38483 WP_003899290.1.3849 WP_003899290.1.385 WP_003899290.1.38530 WP_003899290.1.38594 WP_003899290.1.38611 WP_003899290.1.38638 WP_003899290.1.38639 WP_003899290.1.38646 WP_003899290.1.38648 WP_003899290.1.38654 WP_003899290.1.38660 WP_003899290.1.38666 WP_003899290.1.38671 WP_003899290.1.38672 WP_003899290.1.38677 WP_003899290.1.38750 WP_003899290.1.38772 WP_003899290.1.38812 WP_003899290.1.38821 WP_003899290.1.38844 WP_003899290.1.38863 WP_003899290.1.38873 WP_003899290.1.3889 WP_003899290.1.38894 WP_003899290.1.38909 WP_003899290.1.38939 WP_003899290.1.38974 WP_003899290.1.38975 WP_003899290.1.38991 WP_003899290.1.39025 WP_003899290.1.39070 WP_003899290.1.39072 WP_003899290.1.39095 WP_003899290.1.39106 WP_003899290.1.39165 WP_003899290.1.39174 WP_003899290.1.39176 WP_003899290.1.39178 WP_003899290.1.39190 WP_003899290.1.39201 WP_003899290.1.39207 WP_003899290.1.39236 WP_003899290.1.39239 WP_003899290.1.39252 WP_003899290.1.39288 WP_003899290.1.39295 WP_003899290.1.39306 WP_003899290.1.39359 WP_003899290.1.39364 WP_003899290.1.39400 WP_003899290.1.39447 WP_003899290.1.3945 WP_003899290.1.39450 WP_003899290.1.39455 WP_003899290.1.39521 WP_003899290.1.39560 WP_003899290.1.39592 WP_003899290.1.39593 WP_003899290.1.396 WP_003899290.1.3960 WP_003899290.1.39616 WP_003899290.1.39654 WP_003899290.1.39657 WP_003899290.1.39661 WP_003899290.1.39674 WP_003899290.1.39678 WP_003899290.1.3968 WP_003899290.1.39694 WP_003899290.1.3971 WP_003899290.1.39718 WP_003899290.1.39728 WP_003899290.1.39739 WP_003899290.1.39748 WP_003899290.1.39751 WP_003899290.1.39759 WP_003899290.1.39801 WP_003899290.1.39804 WP_003899290.1.39848 WP_003899290.1.39877 WP_003899290.1.39925 WP_003899290.1.3994 WP_003899290.1.39959 WP_003899290.1.3996 WP_003899290.1.39960 WP_003899290.1.3997 WP_003899290.1.39980 WP_003899290.1.40000 WP_003899290.1.40028 WP_003899290.1.4003 WP_003899290.1.40094 WP_003899290.1.40096 WP_003899290.1.40150 WP_003899290.1.40156 WP_003899290.1.40174 WP_003899290.1.40186 WP_003899290.1.40276 WP_003899290.1.40277 WP_003899290.1.40323 WP_003899290.1.40336 WP_003899290.1.40353 WP_003899290.1.4036 WP_003899290.1.40372 WP_003899290.1.40402 WP_003899290.1.40413 WP_003899290.1.40440 WP_003899290.1.40446 WP_003899290.1.40451 WP_003899290.1.40455 WP_003899290.1.40523 WP_003899290.1.40641 WP_003899290.1.40646 WP_003899290.1.40651 WP_003899290.1.40653 WP_003899290.1.4067 WP_003899290.1.40705 WP_003899290.1.40723 WP_003899290.1.40731 WP_003899290.1.40735 WP_003899290.1.40795 WP_003899290.1.40799 WP_003899290.1.40876 WP_003899290.1.40881 WP_003899290.1.40922 WP_003899290.1.4095 WP_003899290.1.40956 WP_003899290.1.40957 WP_003899290.1.40964 WP_003899290.1.4097 WP_003899290.1.410 WP_003899290.1.41000 WP_003899290.1.41055 WP_003899290.1.41108 WP_003899290.1.41123 WP_003899290.1.41177 WP_003899290.1.41202 WP_003899290.1.41219 WP_003899290.1.41231 WP_003899290.1.41249 WP_003899290.1.4127 WP_003899290.1.41355 WP_003899290.1.41376 WP_003899290.1.41430 WP_003899290.1.41447 WP_003899290.1.41469 WP_003899290.1.41504 WP_003899290.1.41553 WP_003899290.1.41564 WP_003899290.1.41632 WP_003899290.1.41635 WP_003899290.1.41636 WP_003899290.1.41660 WP_003899290.1.41685 WP_003899290.1.41695 WP_003899290.1.41704 WP_003899290.1.4171 WP_003899290.1.41719 WP_003899290.1.41733 WP_003899290.1.41744 WP_003899290.1.41774 WP_003899290.1.41791 WP_003899290.1.41803 WP_003899290.1.41820 WP_003899290.1.41828 WP_003899290.1.41829 WP_003899290.1.41860 WP_003899290.1.41912 WP_003899290.1.41921 WP_003899290.1.41933 WP_003899290.1.41944 WP_003899290.1.42043 WP_003899290.1.42078 WP_003899290.1.42094 WP_003899290.1.42112 WP_003899290.1.4212 WP_003899290.1.42122 WP_003899290.1.42134 WP_003899290.1.42183 WP_003899290.1.42188 WP_003899290.1.42202 WP_003899290.1.42208 WP_003899290.1.42247 WP_003899290.1.42255 WP_003899290.1.42273 WP_003899290.1.42278 WP_003899290.1.42304 WP_003899290.1.42309 WP_003899290.1.42370 WP_003899290.1.42385 WP_003899290.1.42400 WP_003899290.1.42409 WP_003899290.1.42414 WP_003899290.1.42430 WP_003899290.1.42465 WP_003899290.1.42467 WP_003899290.1.42473 WP_003899290.1.4248 WP_003899290.1.42494 WP_003899290.1.42519 WP_003899290.1.42524 WP_003899290.1.42534 WP_003899290.1.4255 WP_003899290.1.42562 WP_003899290.1.42568 WP_003899290.1.42570 WP_003899290.1.42618 WP_003899290.1.42660 WP_003899290.1.42695 WP_003899290.1.42704 WP_003899290.1.42705 WP_003899290.1.42722 WP_003899290.1.42777 WP_003899290.1.42782 WP_003899290.1.42835 WP_003899290.1.42839 WP_003899290.1.42842 WP_003899290.1.42905 WP_003899290.1.42916 WP_003899290.1.42930 WP_003899290.1.42971 WP_003899290.1.43005 WP_003899290.1.43009 WP_003899290.1.43053 WP_003899290.1.43082 WP_003899290.1.43087 WP_003899290.1.43098 WP_003899290.1.43208 WP_003899290.1.43236 WP_003899290.1.43246 WP_003899290.1.43255 WP_003899290.1.43266 WP_003899290.1.43269 WP_003899290.1.43273 WP_003899290.1.43296 WP_003899290.1.43306 WP_003899290.1.4335 WP_003899290.1.43368 WP_003899290.1.43395 WP_003899290.1.43457 WP_003899290.1.43462 WP_003899290.1.43475 WP_003899290.1.43478 WP_003899290.1.43484 WP_003899290.1.43557 WP_003899290.1.43578 WP_003899290.1.43588 WP_003899290.1.43643 WP_003899290.1.43664 WP_003899290.1.43684 WP_003899290.1.43686 WP_003899290.1.43706 WP_003899290.1.43716 WP_003899290.1.4377 WP_003899290.1.43781 WP_003899290.1.43794 WP_003899290.1.43815 WP_003899290.1.43846 WP_003899290.1.43861 WP_003899290.1.43863 WP_003899290.1.43866 WP_003899290.1.43872 WP_003899290.1.43885 WP_003899290.1.43897 WP_003899290.1.4390 WP_003899290.1.43902 WP_003899290.1.43921 WP_003899290.1.43936 WP_003899290.1.43937 WP_003899290.1.43960 WP_003899290.1.43965 WP_003899290.1.4399 WP_003899290.1.43993 WP_003899290.1.43996 WP_003899290.1.44 WP_003899290.1.44001 WP_003899290.1.44008 WP_003899290.1.44033 WP_003899290.1.44037 WP_003899290.1.44070 WP_003899290.1.44071 WP_003899290.1.44076 WP_003899290.1.44104 WP_003899290.1.44111 WP_003899290.1.44124 WP_003899290.1.44169 WP_003899290.1.44219 WP_003899290.1.44237 WP_003899290.1.44277 WP_003899290.1.44279 WP_003899290.1.44336 WP_003899290.1.44355 WP_003899290.1.44358 WP_003899290.1.4438 WP_003899290.1.44390 WP_003899290.1.44392 WP_003899290.1.4441 WP_003899290.1.44415 WP_003899290.1.44466 WP_003899290.1.44489 WP_003899290.1.44492 WP_003899290.1.44494 WP_003899290.1.44500 WP_003899290.1.44532 WP_003899290.1.44534 WP_003899290.1.44562 WP_003899290.1.44597 WP_003899290.1.44600 WP_003899290.1.44602 WP_003899290.1.44615 WP_003899290.1.4464 WP_003899290.1.44651 WP_003899290.1.44659 WP_003899290.1.44665 WP_003899290.1.44694 WP_003899290.1.44700 WP_003899290.1.44713 WP_003899290.1.44735 WP_003899290.1.44740 WP_003899290.1.44757 WP_003899290.1.4476 WP_003899290.1.44761 WP_003899290.1.44776 WP_003899290.1.44779 WP_003899290.1.44786 WP_003899290.1.44808 WP_003899290.1.44864 WP_003899290.1.44901 WP_003899290.1.44908 WP_003899290.1.44913 WP_003899290.1.4492 WP_003899290.1.44939 WP_003899290.1.44979 WP_003899290.1.44981 WP_003899290.1.45002 WP_003899290.1.45011 WP_003899290.1.4504 WP_003899290.1.45081 WP_003899290.1.45113 WP_003899290.1.45129 WP_003899290.1.45135 WP_003899290.1.45147 WP_003899290.1.45168 WP_003899290.1.4517 WP_003899290.1.45185 WP_003899290.1.45192 WP_003899290.1.45200 WP_003899290.1.45205 WP_003899290.1.45211 WP_003899290.1.45249 WP_003899290.1.4526 WP_003899290.1.45286 WP_003899290.1.45326 WP_003899290.1.45347 WP_003899290.1.45374 WP_003899290.1.45390 WP_003899290.1.454 WP_003899290.1.45407 WP_003899290.1.45451 WP_003899290.1.45453 WP_003899290.1.45460 WP_003899290.1.45463 WP_003899290.1.45470 WP_003899290.1.45474 WP_003899290.1.45491 WP_003899290.1.45510 WP_003899290.1.45563 WP_003899290.1.45584 WP_003899290.1.45590 WP_003899290.1.45619 WP_003899290.1.45626 WP_003899290.1.45631 WP_003899290.1.45666 WP_003899290.1.45697 WP_003899290.1.4571 WP_003899290.1.45731 WP_003899290.1.45743 WP_003899290.1.45765 WP_003899290.1.45776 WP_003899290.1.45805 WP_003899290.1.45815 WP_003899290.1.45849 WP_003899290.1.45867 WP_003899290.1.4590 WP_003899290.1.45923 WP_003899290.1.45926 WP_003899290.1.45963 WP_003899290.1.45992 WP_003899290.1.46025 WP_003899290.1.46083 WP_003899290.1.46090 WP_003899290.1.46092 WP_003899290.1.46100 WP_003899290.1.46101 WP_003899290.1.46103 WP_003899290.1.46107 WP_003899290.1.46127 WP_003899290.1.46128 WP_003899290.1.46129 WP_003899290.1.46141 WP_003899290.1.46150 WP_003899290.1.46201 WP_003899290.1.46226 WP_003899290.1.4624 WP_003899290.1.46253 WP_003899290.1.46268 WP_003899290.1.46285 WP_003899290.1.46300 WP_003899290.1.46313 WP_003899290.1.46336 WP_003899290.1.46365 WP_003899290.1.46370 WP_003899290.1.46381 WP_003899290.1.46411 WP_003899290.1.4644 WP_003899290.1.46442 WP_003899290.1.46453 WP_003899290.1.46478 WP_003899290.1.46492 WP_003899290.1.46521 WP_003899290.1.4653 WP_003899290.1.46532 WP_003899290.1.46539 WP_003899290.1.46568 WP_003899290.1.46585 WP_003899290.1.46609 WP_003899290.1.46613 WP_003899290.1.46625 WP_003899290.1.46642 WP_003899290.1.46647 WP_003899290.1.46724 WP_003899290.1.46758 WP_003899290.1.46773 WP_003899290.1.46777 WP_003899290.1.46786 WP_003899290.1.46792 WP_003899290.1.46847 WP_003899290.1.46851 WP_003899290.1.4687 WP_003899290.1.46936 WP_003899290.1.46980 WP_003899290.1.47011 WP_003899290.1.47066 WP_003899290.1.47077 WP_003899290.1.47083 WP_003899290.1.47106 WP_003899290.1.47142 WP_003899290.1.47147 WP_003899290.1.47166 WP_003899290.1.47178 WP_003899290.1.47179 WP_003899290.1.47194 WP_003899290.1.47207 WP_003899290.1.47210 WP_003899290.1.47261 WP_003899290.1.47262 WP_003899290.1.47402 WP_003899290.1.47423 WP_003899290.1.47467 WP_003899290.1.47502 WP_003899290.1.4751 WP_003899290.1.47511 WP_003899290.1.47537 WP_003899290.1.47540 WP_003899290.1.47568 WP_003899290.1.47572 WP_003899290.1.47588 WP_003899290.1.47636 WP_003899290.1.4764 WP_003899290.1.47653 WP_003899290.1.47679 WP_003899290.1.47681 WP_003899290.1.47690 WP_003899290.1.4771 WP_003899290.1.47717 WP_003899290.1.47743 WP_003899290.1.47754 WP_003899290.1.47773 WP_003899290.1.47776 WP_003899290.1.47780 WP_003899290.1.47805 WP_003899290.1.47832 WP_003899290.1.47847 WP_003899290.1.47858 WP_003899290.1.47861 WP_003899290.1.47868 WP_003899290.1.47893 WP_003899290.1.47899 WP_003899290.1.479 WP_003899290.1.47912 WP_003899290.1.47913 WP_003899290.1.47926 WP_003899290.1.4794 WP_003899290.1.47943 WP_003899290.1.47944 WP_003899290.1.47959 WP_003899290.1.47974 WP_003899290.1.47993 WP_003899290.1.48004 WP_003899290.1.48039 WP_003899290.1.48050 WP_003899290.1.48084 WP_003899290.1.48097 WP_003899290.1.48101 WP_003899290.1.4813 WP_003899290.1.48130 WP_003899290.1.48135 WP_003899290.1.48143 WP_003899290.1.48152 WP_003899290.1.48155 WP_003899290.1.48170 WP_003899290.1.48173 WP_003899290.1.48177 WP_003899290.1.48185 WP_003899290.1.48204 WP_003899290.1.48219 WP_003899290.1.4823 WP_003899290.1.48240 WP_003899290.1.48256 WP_003899290.1.48264 WP_003899290.1.48287 WP_003899290.1.48330 WP_003899290.1.48333 WP_003899290.1.48348 WP_003899290.1.48354 WP_003899290.1.48372 WP_003899290.1.48383 WP_003899290.1.48388 WP_003899290.1.48419 WP_003899290.1.48423 WP_003899290.1.48443 WP_003899290.1.48462 WP_003899290.1.48543 WP_003899290.1.48550 WP_003899290.1.48618 WP_003899290.1.4863 WP_003899290.1.48648 WP_003899290.1.48658 WP_003899290.1.48666 WP_003899290.1.48687 WP_003899290.1.48779 WP_003899290.1.4878 WP_003899290.1.48798 WP_003899290.1.48802 WP_003899290.1.48826 WP_003899290.1.48831 WP_003899290.1.48843 WP_003899290.1.48857 WP_003899290.1.4890 WP_003899290.1.48946 WP_003899290.1.48979 WP_003899290.1.49017 WP_003899290.1.49048 WP_003899290.1.49059 WP_003899290.1.4906 WP_003899290.1.4907 WP_003899290.1.49103 WP_003899290.1.49110 WP_003899290.1.49112 WP_003899290.1.4919 WP_003899290.1.49251 WP_003899290.1.49254 WP_003899290.1.49263 WP_003899290.1.49291 WP_003899290.1.49296 WP_003899290.1.49335 WP_003899290.1.49337 WP_003899290.1.49419 WP_003899290.1.49426 WP_003899290.1.49437 WP_003899290.1.49439 WP_003899290.1.49474 WP_003899290.1.49506 WP_003899290.1.49523 WP_003899290.1.49526 WP_003899290.1.49532 WP_003899290.1.4959 WP_003899290.1.49678 WP_003899290.1.49687 WP_003899290.1.49699 WP_003899290.1.49709 WP_003899290.1.4971 WP_003899290.1.4972 WP_003899290.1.49736 WP_003899290.1.49746 WP_003899290.1.49764 WP_003899290.1.49773 WP_003899290.1.49796 WP_003899290.1.49814 WP_003899290.1.49815 WP_003899290.1.49816 WP_003899290.1.49839 WP_003899290.1.49857 WP_003899290.1.49878 WP_003899290.1.49880 WP_003899290.1.49944 WP_003899290.1.4999 WP_003899290.1.49990 WP_003899290.1.50068 WP_003899290.1.50077 WP_003899290.1.5008 WP_003899290.1.50081 WP_003899290.1.50122 WP_003899290.1.50126 WP_003899290.1.50149 WP_003899290.1.50162 WP_003899290.1.5018 WP_003899290.1.50194 WP_003899290.1.50218 WP_003899290.1.50235 WP_003899290.1.50249 WP_003899290.1.50265 WP_003899290.1.50271 WP_003899290.1.50324 WP_003899290.1.50347 WP_003899290.1.50372 WP_003899290.1.50398 WP_003899290.1.50407 WP_003899290.1.50444 WP_003899290.1.50466 WP_003899290.1.50472 WP_003899290.1.5048 WP_003899290.1.50498 WP_003899290.1.5050 WP_003899290.1.50540 WP_003899290.1.50554 WP_003899290.1.50557 WP_003899290.1.50601 WP_003899290.1.50610 WP_003899290.1.50632 WP_003899290.1.50633 WP_003899290.1.50655 WP_003899290.1.50659 WP_003899290.1.50683 WP_003899290.1.50689 WP_003899290.1.50692 WP_003899290.1.50714 WP_003899290.1.50729 WP_003899290.1.50756 WP_003899290.1.50784 WP_003899290.1.50794 WP_003899290.1.50841 WP_003899290.1.50877 WP_003899290.1.5096 WP_003899290.1.50981 WP_003899290.1.50987 WP_003899290.1.51003 WP_003899290.1.51009 WP_003899290.1.51037 WP_003899290.1.51074 WP_003899290.1.51082 WP_003899290.1.51101 WP_003899290.1.51116 WP_003899290.1.51149 WP_003899290.1.51157 WP_003899290.1.51213 WP_003899290.1.51232 WP_003899290.1.51239 WP_003899290.1.51247 WP_003899290.1.51266 WP_003899290.1.51279 WP_003899290.1.51291 WP_003899290.1.51294 WP_003899290.1.51301 WP_003899290.1.51329 WP_003899290.1.51391 WP_003899290.1.51422 WP_003899290.1.51445 WP_003899290.1.51455 WP_003899290.1.51466 WP_003899290.1.51468 WP_003899290.1.51478 WP_003899290.1.51497 WP_003899290.1.51520 WP_003899290.1.51593 WP_003899290.1.51628 WP_003899290.1.5164 WP_003899290.1.51647 WP_003899290.1.51660 WP_003899290.1.51696 WP_003899290.1.51721 WP_003899290.1.51788 WP_003899290.1.51795 WP_003899290.1.51801 WP_003899290.1.51817 WP_003899290.1.51819 WP_003899290.1.51854 WP_003899290.1.51923 WP_003899290.1.51942 WP_003899290.1.51948 WP_003899290.1.51963 WP_003899290.1.51969 WP_003899290.1.52000 WP_003899290.1.52001 WP_003899290.1.52003 WP_003899290.1.52006 WP_003899290.1.52036 WP_003899290.1.52046 WP_003899290.1.52059 WP_003899290.1.52069 WP_003899290.1.52082 WP_003899290.1.52102 WP_003899290.1.52166 WP_003899290.1.52168 WP_003899290.1.52173 WP_003899290.1.52178 WP_003899290.1.52206 WP_003899290.1.52216 WP_003899290.1.52238 WP_003899290.1.52241 WP_003899290.1.52280 WP_003899290.1.52314 WP_003899290.1.52385 WP_003899290.1.52390 WP_003899290.1.524 WP_003899290.1.52460 WP_003899290.1.52485 WP_003899290.1.52486 WP_003899290.1.52504 WP_003899290.1.52522 WP_003899290.1.52531 WP_003899290.1.52533 WP_003899290.1.52545 WP_003899290.1.52553 WP_003899290.1.52563 WP_003899290.1.52564 WP_003899290.1.52574 WP_003899290.1.52641 WP_003899290.1.52673 WP_003899290.1.52674 WP_003899290.1.52708 WP_003899290.1.52713 WP_003899290.1.52761 WP_003899290.1.52778 WP_003899290.1.52797 WP_003899290.1.52818 WP_003899290.1.52872 WP_003899290.1.52873 WP_003899290.1.52891 WP_003899290.1.52892 WP_003899290.1.52909 WP_003899290.1.52970 WP_003899290.1.53053 WP_003899290.1.53056 WP_003899290.1.5306 WP_003899290.1.53088 WP_003899290.1.5309 WP_003899290.1.531 WP_003899290.1.53117 WP_003899290.1.53118 WP_003899290.1.53142 WP_003899290.1.53143 WP_003899290.1.53157 WP_003899290.1.53167 WP_003899290.1.53200 WP_003899290.1.53213 WP_003899290.1.53217 WP_003899290.1.53226 WP_003899290.1.53229 WP_003899290.1.53230 WP_003899290.1.53237 WP_003899290.1.53254 WP_003899290.1.53257 WP_003899290.1.5327 WP_003899290.1.53276 WP_003899290.1.53278 WP_003899290.1.533 WP_003899290.1.53306 WP_003899290.1.5334 WP_003899290.1.5335 WP_003899290.1.53353 WP_003899290.1.53381 WP_003899290.1.53413 WP_003899290.1.53458 WP_003899290.1.53460 WP_003899290.1.53480 WP_003899290.1.53517 WP_003899290.1.53522 WP_003899290.1.53525 WP_003899290.1.53526 WP_003899290.1.53553 WP_003899290.1.53606 WP_003899290.1.53628 WP_003899290.1.53643 WP_003899290.1.53667 WP_003899290.1.53679 WP_003899290.1.53715 WP_003899290.1.53730 WP_003899290.1.53742 WP_003899290.1.53743 WP_003899290.1.53754 WP_003899290.1.53775 WP_003899290.1.53787 WP_003899290.1.53803 WP_003899290.1.53818 WP_003899290.1.53853 WP_003899290.1.53865 WP_003899290.1.53888 WP_003899290.1.53900 WP_003899290.1.53912 WP_003899290.1.53914 WP_003899290.1.53952 WP_003899290.1.5398 WP_003899290.1.5408 WP_003899290.1.54089 WP_003899290.1.54093 WP_003899290.1.54099 WP_003899290.1.54112 WP_003899290.1.54125 WP_003899290.1.54141 WP_003899290.1.54162 WP_003899290.1.54179 WP_003899290.1.54206 WP_003899290.1.54218 WP_003899290.1.54225 WP_003899290.1.54227 WP_003899290.1.54232 WP_003899290.1.54241 WP_003899290.1.54245 WP_003899290.1.54247 WP_003899290.1.54260 WP_003899290.1.54275 WP_003899290.1.54280 WP_003899290.1.5429 WP_003899290.1.54294 WP_003899290.1.54314 WP_003899290.1.54351 WP_003899290.1.54370 WP_003899290.1.54428 WP_003899290.1.54449 WP_003899290.1.54494 WP_003899290.1.54514 WP_003899290.1.54519 WP_003899290.1.5452 WP_003899290.1.54531 WP_003899290.1.54537 WP_003899290.1.54553 WP_003899290.1.54555 WP_003899290.1.54575 WP_003899290.1.54633 WP_003899290.1.54686 WP_003899290.1.54687 WP_003899290.1.54705 WP_003899290.1.54730 WP_003899290.1.54732 WP_003899290.1.5475 WP_003899290.1.54797 WP_003899290.1.54807 WP_003899290.1.54836 WP_003899290.1.54838 WP_003899290.1.54860 WP_003899290.1.54888 WP_003899290.1.54897 WP_003899290.1.54905 WP_003899290.1.54909 WP_003899290.1.54937 WP_003899290.1.54939 WP_003899290.1.54944 WP_003899290.1.54945 WP_003899290.1.54953 WP_003899290.1.54964 WP_003899290.1.55015 WP_003899290.1.55022 WP_003899290.1.55023 WP_003899290.1.55051 WP_003899290.1.55072 WP_003899290.1.55088 WP_003899290.1.55106 WP_003899290.1.55126 WP_003899290.1.55128 WP_003899290.1.55140 WP_003899290.1.55150 WP_003899290.1.55210 WP_003899290.1.55227 WP_003899290.1.55248 WP_003899290.1.55257 WP_003899290.1.55258 WP_003899290.1.55267 WP_003899290.1.55279 WP_003899290.1.55307 WP_003899290.1.55326 WP_003899290.1.55328 WP_003899290.1.5533 WP_003899290.1.55345 WP_003899290.1.55396 WP_003899290.1.55398 WP_003899290.1.55441 WP_003899290.1.55459 WP_003899290.1.55501 WP_003899290.1.55578 WP_003899290.1.55626 WP_003899290.1.55641 WP_003899290.1.5569 WP_003899290.1.55723 WP_003899290.1.55735 WP_003899290.1.5574 WP_003899290.1.55772 WP_003899290.1.55802 WP_003899290.1.55819 WP_003899290.1.55821 WP_003899290.1.5583 WP_003899290.1.55849 WP_003899290.1.55856 WP_003899290.1.55860 WP_003899290.1.55882 WP_003899290.1.55883 WP_003899290.1.55894 WP_003899290.1.55902 WP_003899290.1.55908 WP_003899290.1.55909 WP_003899290.1.5591 WP_003899290.1.55961 WP_003899290.1.55977 WP_003899290.1.55983 WP_003899290.1.56028 WP_003899290.1.56057 WP_003899290.1.56060 WP_003899290.1.56107 WP_003899290.1.56132 WP_003899290.1.56163 WP_003899290.1.56167 WP_003899290.1.56178 WP_003899290.1.56287 WP_003899290.1.56292 WP_003899290.1.56327 WP_003899290.1.56341 WP_003899290.1.56359 WP_003899290.1.56365 WP_003899290.1.56394 WP_003899290.1.56443 WP_003899290.1.56473 WP_003899290.1.56478 WP_003899290.1.56500 WP_003899290.1.56517 WP_003899290.1.5656 WP_003899290.1.56577 WP_003899290.1.56593 WP_003899290.1.56625 WP_003899290.1.56637 WP_003899290.1.56670 WP_003899290.1.56697 WP_003899290.1.567 WP_003899290.1.56701 WP_003899290.1.56743 WP_003899290.1.56755 WP_003899290.1.56764 WP_003899290.1.56769 WP_003899290.1.56770 WP_003899290.1.56795 WP_003899290.1.5681 WP_003899290.1.56827 WP_003899290.1.56839 WP_003899290.1.56863 WP_003899290.1.56868 WP_003899290.1.56869 WP_003899290.1.56915 WP_003899290.1.56926 WP_003899290.1.56961 WP_003899290.1.56971 WP_003899290.1.56972 WP_003899290.1.57023 WP_003899290.1.57035 WP_003899290.1.57077 WP_003899290.1.57087 WP_003899290.1.57094 WP_003899290.1.57134 WP_003899290.1.57169 WP_003899290.1.57208 WP_003899290.1.57212 WP_003899290.1.57230 WP_003899290.1.5724 WP_003899290.1.5725 WP_003899290.1.5727 WP_003899290.1.57273 WP_003899290.1.573 WP_003899290.1.57326 WP_003899290.1.57328 WP_003899290.1.57331 WP_003899290.1.57340 WP_003899290.1.57351 WP_003899290.1.57380 WP_003899290.1.57430 WP_003899290.1.5744 WP_003899290.1.57440 WP_003899290.1.5745 WP_003899290.1.57461 WP_003899290.1.57469 WP_003899290.1.57489 WP_003899290.1.575 WP_003899290.1.57509 WP_003899290.1.57519 WP_003899290.1.57525 WP_003899290.1.57551 WP_003899290.1.57596 WP_003899290.1.57604 WP_003899290.1.57619 WP_003899290.1.57627 WP_003899290.1.57642 WP_003899290.1.57658 WP_003899290.1.57667 WP_003899290.1.57675 WP_003899290.1.57689 WP_003899290.1.57708 WP_003899290.1.57794 WP_003899290.1.57821 WP_003899290.1.57825 WP_003899290.1.57843 WP_003899290.1.57906 WP_003899290.1.57924 WP_003899290.1.57926 WP_003899290.1.57957 WP_003899290.1.57960 WP_003899290.1.57964 WP_003899290.1.57991 WP_003899290.1.58086 WP_003899290.1.58103 WP_003899290.1.58108 WP_003899290.1.5811 WP_003899290.1.58121 WP_003899290.1.58145 WP_003899290.1.58164 WP_003899290.1.58174 WP_003899290.1.582 WP_003899290.1.58209 WP_003899290.1.58215 WP_003899290.1.5824 WP_003899290.1.58250 WP_003899290.1.58259 WP_003899290.1.58283 WP_003899290.1.58288 WP_003899290.1.5830 WP_003899290.1.58303 WP_003899290.1.58311 WP_003899290.1.58330 WP_003899290.1.58359 WP_003899290.1.58386 WP_003899290.1.58393 WP_003899290.1.58431 WP_003899290.1.5844 WP_003899290.1.58457 WP_003899290.1.58488 WP_003899290.1.58518 WP_003899290.1.58534 WP_003899290.1.58559 WP_003899290.1.58567 WP_003899290.1.58573 WP_003899290.1.58602 WP_003899290.1.58612 WP_003899290.1.58619 WP_003899290.1.58630 WP_003899290.1.5865 WP_003899290.1.58671 WP_003899290.1.58690 WP_003899290.1.58702 WP_003899290.1.58743 WP_003899290.1.58754 WP_003899290.1.5879 WP_003899290.1.5881 WP_003899290.1.58824 WP_003899290.1.58848 WP_003899290.1.58857 WP_003899290.1.58891 WP_003899290.1.58892 WP_003899290.1.5890 WP_003899290.1.58904 WP_003899290.1.58921 WP_003899290.1.58930 WP_003899290.1.58953 WP_003899290.1.58961 WP_003899290.1.5898 WP_003899290.1.59025 WP_003899290.1.59029 WP_003899290.1.59037 WP_003899290.1.59044 WP_003899290.1.59085 WP_003899290.1.59088 WP_003899290.1.59112 WP_003899290.1.59130 WP_003899290.1.5914 WP_003899290.1.59147 WP_003899290.1.59166 WP_003899290.1.59205 WP_003899290.1.59209 WP_003899290.1.59237 WP_003899290.1.59240 WP_003899290.1.59253 WP_003899290.1.59254 WP_003899290.1.59262 WP_003899290.1.59270 WP_003899290.1.5928 WP_003899290.1.59304 WP_003899290.1.59305 WP_003899290.1.59309 WP_003899290.1.59326 WP_003899290.1.59328 WP_003899290.1.59333 WP_003899290.1.59338 WP_003899290.1.59428 WP_003899290.1.59487 WP_003899290.1.59537 WP_003899290.1.59561 WP_003899290.1.59677 WP_003899290.1.59722 WP_003899290.1.59727 WP_003899290.1.59732 WP_003899290.1.59738 WP_003899290.1.59750 WP_003899290.1.59757 WP_003899290.1.59761 WP_003899290.1.59808 WP_003899290.1.59850 WP_003899290.1.59860 WP_003899290.1.59861 WP_003899290.1.5987 WP_003899290.1.59878 WP_003899290.1.59888 WP_003899290.1.59952 WP_003899290.1.5996 WP_003899290.1.59961 WP_003899290.1.59974 WP_003899290.1.6000 WP_003899290.1.6003 WP_003899290.1.60047 WP_003899290.1.6007 WP_003899290.1.60121 WP_003899290.1.60125 WP_003899290.1.60135 WP_003899290.1.60139 WP_003899290.1.60152 WP_003899290.1.60171 WP_003899290.1.60197 WP_003899290.1.6020 WP_003899290.1.60205 WP_003899290.1.60207 WP_003899290.1.60215 WP_003899290.1.60217 WP_003899290.1.60267 WP_003899290.1.60288 WP_003899290.1.60291 WP_003899290.1.60301 WP_003899290.1.60305 WP_003899290.1.60312 WP_003899290.1.60313 WP_003899290.1.60314 WP_003899290.1.60367 WP_003899290.1.60376 WP_003899290.1.60403 WP_003899290.1.60413 WP_003899290.1.60421 WP_003899290.1.60451 WP_003899290.1.60460 WP_003899290.1.60487 WP_003899290.1.60512 WP_003899290.1.60573 WP_003899290.1.60583 WP_003899290.1.60632 WP_003899290.1.60657 WP_003899290.1.60687 WP_003899290.1.60689 WP_003899290.1.60727 WP_003899290.1.60738 WP_003899290.1.60763 WP_003899290.1.6077 WP_003899290.1.60791 WP_003899290.1.60834 WP_003899290.1.60878 WP_003899290.1.60879 WP_003899290.1.60913 WP_003899290.1.60978 WP_003899290.1.61000 WP_003899290.1.61001 WP_003899290.1.61012 WP_003899290.1.61014 WP_003899290.1.61015 WP_003899290.1.61037 WP_003899290.1.61052 WP_003899290.1.61065 WP_003899290.1.61100 WP_003899290.1.61101 WP_003899290.1.61138 WP_003899290.1.61142 WP_003899290.1.61198 WP_003899290.1.61234 WP_003899290.1.61281 WP_003899290.1.61314 WP_003899290.1.61321 WP_003899290.1.61326 WP_003899290.1.61328 WP_003899290.1.61368 WP_003899290.1.61391 WP_003899290.1.61406 WP_003899290.1.61409 WP_003899290.1.61420 WP_003899290.1.61422 WP_003899290.1.61425 WP_003899290.1.61428 WP_003899290.1.61469 WP_003899290.1.61522 WP_003899290.1.61552 WP_003899290.1.61557 WP_003899290.1.61567 WP_003899290.1.61571 WP_003899290.1.61573 WP_003899290.1.61584 WP_003899290.1.61586 WP_003899290.1.6159 WP_003899290.1.61592 WP_003899290.1.6160 WP_003899290.1.61614 WP_003899290.1.6163 WP_003899290.1.61655 WP_003899290.1.61665 WP_003899290.1.61669 WP_003899290.1.61682 WP_003899290.1.61692 WP_003899290.1.61719 WP_003899290.1.61728 WP_003899290.1.61750 WP_003899290.1.61754 WP_003899290.1.61755 WP_003899290.1.61757 WP_003899290.1.6179 WP_003899290.1.61816 WP_003899290.1.61842 WP_003899290.1.61850 WP_003899290.1.61862 WP_003899290.1.61865 WP_003899290.1.61868 WP_003899290.1.61911 WP_003899290.1.61941 WP_003899290.1.61953 WP_003899290.1.61986 WP_003899290.1.61987 WP_003899290.1.61998 WP_003899290.1.62021 WP_003899290.1.62087 WP_003899290.1.62089 WP_003899290.1.62101 WP_003899290.1.62104 WP_003899290.1.6211 WP_003899290.1.62132 WP_003899290.1.62162 WP_003899290.1.62225 WP_003899290.1.62230 WP_003899290.1.62238 WP_003899290.1.62249 WP_003899290.1.62270 WP_003899290.1.62281 WP_003899290.1.62307 WP_003899290.1.6231 WP_003899290.1.62359 WP_003899290.1.62371 WP_003899290.1.62379 WP_003899290.1.62395 WP_003899290.1.62449 WP_003899290.1.62468 WP_003899290.1.6248 WP_003899290.1.62508 WP_003899290.1.62565 WP_003899290.1.62594 WP_003899290.1.62606 WP_003899290.1.62616 WP_003899290.1.62666 WP_003899290.1.62687 WP_003899290.1.62715 WP_003899290.1.62730 WP_003899290.1.62738 WP_003899290.1.62761 WP_003899290.1.62766 WP_003899290.1.62813 WP_003899290.1.62839 WP_003899290.1.62841 WP_003899290.1.62909 WP_003899290.1.62936 WP_003899290.1.6294 WP_003899290.1.6295 WP_003899290.1.62962 WP_003899290.1.63007 WP_003899290.1.63019 WP_003899290.1.63032 WP_003899290.1.63037 WP_003899290.1.63064 WP_003899290.1.63066 WP_003899290.1.63072 WP_003899290.1.6308 WP_003899290.1.63081 WP_003899290.1.63096 WP_003899290.1.63106 WP_003899290.1.63144 WP_003899290.1.63160 WP_003899290.1.63161 WP_003899290.1.63175 WP_003899290.1.63194 WP_003899290.1.63222 WP_003899290.1.6328 WP_003899290.1.63291 WP_003899290.1.63312 WP_003899290.1.63317 WP_003899290.1.63331 WP_003899290.1.63373 WP_003899290.1.63384 WP_003899290.1.63403 WP_003899290.1.63424 WP_003899290.1.63428 WP_003899290.1.6345 WP_003899290.1.63464 WP_003899290.1.63483 WP_003899290.1.63502 WP_003899290.1.63504 WP_003899290.1.63522 WP_003899290.1.63530 WP_003899290.1.63564 WP_003899290.1.63567 WP_003899290.1.63596 WP_003899290.1.63600 WP_003899290.1.63623 WP_003899290.1.63624 WP_003899290.1.63625 WP_003899290.1.63627 WP_003899290.1.63654 WP_003899290.1.63662 WP_003899290.1.63711 WP_003899290.1.63734 WP_003899290.1.63807 WP_003899290.1.63819 WP_003899290.1.63844 WP_003899290.1.63888 WP_003899290.1.63913 WP_003899290.1.63915 WP_003899290.1.63918 WP_003899290.1.63961 WP_003899290.1.63970 WP_003899290.1.64000 WP_003899290.1.64027 WP_003899290.1.64058 WP_003899290.1.64065 WP_003899290.1.6407 WP_003899290.1.64082 WP_003899290.1.64091 WP_003899290.1.64102 WP_003899290.1.64104 WP_003899290.1.64169 WP_003899290.1.64219 WP_003899290.1.6422 WP_003899290.1.64222 WP_003899290.1.64228 WP_003899290.1.64235 WP_003899290.1.64249 WP_003899290.1.6427 WP_003899290.1.64278 WP_003899290.1.64287 WP_003899290.1.64414 WP_003899290.1.64419 WP_003899290.1.6443 WP_003899290.1.64463 WP_003899290.1.64480 WP_003899290.1.64497 WP_003899290.1.64506 WP_003899290.1.64511 WP_003899290.1.64513 WP_003899290.1.64515 WP_003899290.1.64522 WP_003899290.1.64526 WP_003899290.1.64543 WP_003899290.1.6456 WP_003899290.1.64567 WP_003899290.1.64588 WP_003899290.1.64589 WP_003899290.1.64594 WP_003899290.1.64595 WP_003899290.1.64608 WP_003899290.1.64619 WP_003899290.1.64629 WP_003899290.1.6464 WP_003899290.1.64664 WP_003899290.1.64669 WP_003899290.1.64672 WP_003899290.1.64680 WP_003899290.1.64682 WP_003899290.1.64727 WP_003899290.1.64729 WP_003899290.1.64774 WP_003899290.1.64776 WP_003899290.1.64832 WP_003899290.1.6486 WP_003899290.1.64870 WP_003899290.1.64898 WP_003899290.1.64922 WP_003899290.1.64924 WP_003899290.1.6493 WP_003899290.1.64941 WP_003899290.1.64973 WP_003899290.1.65001 WP_003899290.1.65026 WP_003899290.1.65053 WP_003899290.1.65070 WP_003899290.1.65079 WP_003899290.1.65102 WP_003899290.1.65157 WP_003899290.1.65181 WP_003899290.1.65212 WP_003899290.1.65229 WP_003899290.1.6523 WP_003899290.1.65253 WP_003899290.1.65289 WP_003899290.1.65291 WP_003899290.1.65315 WP_003899290.1.65329 WP_003899290.1.65359 WP_003899290.1.6536 WP_003899290.1.65374 WP_003899290.1.65386 WP_003899290.1.65414 WP_003899290.1.65416 WP_003899290.1.65433 WP_003899290.1.65455 WP_003899290.1.65467 WP_003899290.1.65488 WP_003899290.1.65529 WP_003899290.1.65539 WP_003899290.1.65583 WP_003899290.1.65612 WP_003899290.1.65623 WP_003899290.1.65635 WP_003899290.1.65637 WP_003899290.1.65648 WP_003899290.1.65683 WP_003899290.1.65686 WP_003899290.1.65688 WP_003899290.1.65707 WP_003899290.1.65733 WP_003899290.1.65746 WP_003899290.1.65747 WP_003899290.1.65759 WP_003899290.1.65816 WP_003899290.1.65830 WP_003899290.1.65858 WP_003899290.1.65862 WP_003899290.1.65869 WP_003899290.1.65893 WP_003899290.1.65929 WP_003899290.1.65932 WP_003899290.1.65958 WP_003899290.1.65974 WP_003899290.1.66004 WP_003899290.1.6606 WP_003899290.1.66089 WP_003899290.1.66149 WP_003899290.1.66151 WP_003899290.1.66276 WP_003899290.1.66293 WP_003899290.1.66297 WP_003899290.1.66323 WP_003899290.1.66325 WP_003899290.1.6633 WP_003899290.1.66334 WP_003899290.1.66355 WP_003899290.1.66367 WP_003899290.1.66394 WP_003899290.1.66396 WP_003899290.1.66451 WP_003899290.1.66455 WP_003899290.1.66457 WP_003899290.1.66464 WP_003899290.1.66466 WP_003899290.1.66487 WP_003899290.1.66504 WP_003899290.1.66544 WP_003899290.1.66558 WP_003899290.1.66580 WP_003899290.1.66582 WP_003899290.1.66612 WP_003899290.1.66617 WP_003899290.1.66635 WP_003899290.1.66656 WP_003899290.1.66663 WP_003899290.1.66675 WP_003899290.1.66715 WP_003899290.1.66718 WP_003899290.1.66762 WP_003899290.1.66776 WP_003899290.1.66808 WP_003899290.1.66817 WP_003899290.1.66819 WP_003899290.1.66826 WP_003899290.1.66830 WP_003899290.1.66842 WP_003899290.1.66878 WP_003899290.1.66880 WP_003899290.1.66893 WP_003899290.1.66961 WP_003899290.1.67005 WP_003899290.1.6704 WP_003899290.1.67044 WP_003899290.1.67061 WP_003899290.1.67098 WP_003899290.1.67146 WP_003899290.1.67197 WP_003899290.1.67198 WP_003899290.1.6720 WP_003899290.1.67207 WP_003899290.1.67218 WP_003899290.1.67220 WP_003899290.1.67225 WP_003899290.1.67231 WP_003899290.1.6724 WP_003899290.1.67257 WP_003899290.1.67298 WP_003899290.1.67307 WP_003899290.1.67324 WP_003899290.1.67332 WP_003899290.1.67346 WP_003899290.1.67360 WP_003899290.1.67381 WP_003899290.1.67396 WP_003899290.1.67417 WP_003899290.1.67422 WP_003899290.1.67453 WP_003899290.1.67459 WP_003899290.1.6746 WP_003899290.1.67473 WP_003899290.1.67482 WP_003899290.1.67496 WP_003899290.1.67499 WP_003899290.1.67523 WP_003899290.1.67536 WP_003899290.1.67575 WP_003899290.1.67587 WP_003899290.1.67598 WP_003899290.1.67600 WP_003899290.1.67602 WP_003899290.1.67630 WP_003899290.1.67679 WP_003899290.1.67692 WP_003899290.1.67744 WP_003899290.1.6775 WP_003899290.1.6777 WP_003899290.1.67809 WP_003899290.1.67816 WP_003899290.1.67844 WP_003899290.1.67848 WP_003899290.1.67870 WP_003899290.1.67888 WP_003899290.1.67915 WP_003899290.1.67945 WP_003899290.1.67949 WP_003899290.1.67980 WP_003899290.1.67982 WP_003899290.1.68022 WP_003899290.1.68029 WP_003899290.1.68037 WP_003899290.1.68038 WP_003899290.1.68045 WP_003899290.1.68057 WP_003899290.1.68083 WP_003899290.1.68088 WP_003899290.1.68106 WP_003899290.1.68110 WP_003899290.1.68153 WP_003899290.1.68169 WP_003899290.1.68193 WP_003899290.1.68212 WP_003899290.1.68227 WP_003899290.1.68243 WP_003899290.1.6825 WP_003899290.1.68297 WP_003899290.1.68309 WP_003899290.1.68325 WP_003899290.1.68329 WP_003899290.1.68340 WP_003899290.1.68384 WP_003899290.1.68388 WP_003899290.1.68429 WP_003899290.1.6843 WP_003899290.1.68433 WP_003899290.1.68444 WP_003899290.1.68465 WP_003899290.1.68518 WP_003899290.1.68569 WP_003899290.1.68576 WP_003899290.1.68580 WP_003899290.1.68586 WP_003899290.1.68623 WP_003899290.1.68637 WP_003899290.1.68646 WP_003899290.1.68667 WP_003899290.1.68669 WP_003899290.1.68672 WP_003899290.1.68684 WP_003899290.1.68704 WP_003899290.1.68708 WP_003899290.1.6872 WP_003899290.1.68730 WP_003899290.1.68734 WP_003899290.1.68748 WP_003899290.1.68754 WP_003899290.1.6876 WP_003899290.1.68761 WP_003899290.1.68763 WP_003899290.1.68766 WP_003899290.1.68774 WP_003899290.1.68796 WP_003899290.1.68824 WP_003899290.1.68832 WP_003899290.1.68833 WP_003899290.1.68841 WP_003899290.1.68859 WP_003899290.1.68876 WP_003899290.1.68906 WP_003899290.1.68916 WP_003899290.1.68923 WP_003899290.1.68945 WP_003899290.1.6896 WP_003899290.1.68981 WP_003899290.1.68984 WP_003899290.1.68997 WP_003899290.1.69076 WP_003899290.1.69079 WP_003899290.1.6908 WP_003899290.1.69082 WP_003899290.1.69178 WP_003899290.1.69208 WP_003899290.1.69231 WP_003899290.1.69256 WP_003899290.1.69311 WP_003899290.1.69315 WP_003899290.1.69322 WP_003899290.1.69342 WP_003899290.1.6936 WP_003899290.1.69369 WP_003899290.1.69374 WP_003899290.1.69398 WP_003899290.1.69401 WP_003899290.1.69426 WP_003899290.1.69427 WP_003899290.1.69429 WP_003899290.1.6949 WP_003899290.1.6951 WP_003899290.1.69511 WP_003899290.1.69526 WP_003899290.1.69528 WP_003899290.1.69547 WP_003899290.1.69573 WP_003899290.1.69581 WP_003899290.1.6960 WP_003899290.1.69617 WP_003899290.1.69634 WP_003899290.1.69647 WP_003899290.1.69659 WP_003899290.1.69673 WP_003899290.1.69682 WP_003899290.1.69684 WP_003899290.1.69686 WP_003899290.1.69707 WP_003899290.1.69709 WP_003899290.1.69723 WP_003899290.1.69736 WP_003899290.1.69778 WP_003899290.1.69800 WP_003899290.1.69802 WP_003899290.1.69845 WP_003899290.1.69870 WP_003899290.1.69873 WP_003899290.1.69898 WP_003899290.1.69913 WP_003899290.1.69931 WP_003899290.1.69938 WP_003899290.1.69955 WP_003899290.1.69957 WP_003899290.1.69981 WP_003899290.1.69990 WP_003899290.1.70 WP_003899290.1.70000 WP_003899290.1.70017 WP_003899290.1.70032 WP_003899290.1.70055 WP_003899290.1.70062 WP_003899290.1.70072 WP_003899290.1.70131 WP_003899290.1.70132 WP_003899290.1.7022 WP_003899290.1.70227 WP_003899290.1.70255 WP_003899290.1.70271 WP_003899290.1.70274 WP_003899290.1.7029 WP_003899290.1.70325 WP_003899290.1.70328 WP_003899290.1.70356 WP_003899290.1.70364 WP_003899290.1.70368 WP_003899290.1.70369 WP_003899290.1.70418 WP_003899290.1.70422 WP_003899290.1.70435 WP_003899290.1.70444 WP_003899290.1.70463 WP_003899290.1.70471 WP_003899290.1.70480 WP_003899290.1.70494 WP_003899290.1.70498 WP_003899290.1.70525 WP_003899290.1.70573 WP_003899290.1.70577 WP_003899290.1.70610 WP_003899290.1.70615 WP_003899290.1.70618 WP_003899290.1.70622 WP_003899290.1.70626 WP_003899290.1.70668 WP_003899290.1.70699 WP_003899290.1.70704 WP_003899290.1.70729 WP_003899290.1.70757 WP_003899290.1.70782 WP_003899290.1.70796 WP_003899290.1.70830 WP_003899290.1.70834 WP_003899290.1.7084 WP_003899290.1.70840 WP_003899290.1.70864 WP_003899290.1.70871 WP_003899290.1.70915 WP_003899290.1.70958 WP_003899290.1.70964 WP_003899290.1.70976 WP_003899290.1.71015 WP_003899290.1.71063 WP_003899290.1.71076 WP_003899290.1.71083 WP_003899290.1.7111 WP_003899290.1.71118 WP_003899290.1.7113 WP_003899290.1.71187 WP_003899290.1.71191 WP_003899290.1.71255 WP_003899290.1.71258 WP_003899290.1.71259 WP_003899290.1.71289 WP_003899290.1.71326 WP_003899290.1.71329 WP_003899290.1.71331 WP_003899290.1.71344 WP_003899290.1.71390 WP_003899290.1.71414 WP_003899290.1.71440 WP_003899290.1.71457 WP_003899290.1.71464 WP_003899290.1.71490 WP_003899290.1.71492 WP_003899290.1.71509 WP_003899290.1.71516 WP_003899290.1.71517 WP_003899290.1.71527 WP_003899290.1.71532 WP_003899290.1.71545 WP_003899290.1.71546 WP_003899290.1.71569 WP_003899290.1.71604 WP_003899290.1.71630 WP_003899290.1.71638 WP_003899290.1.71654 WP_003899290.1.71664 WP_003899290.1.71665 WP_003899290.1.71683 WP_003899290.1.71701 WP_003899290.1.71718 WP_003899290.1.71731 WP_003899290.1.71778 WP_003899290.1.71781 WP_003899290.1.71803 WP_003899290.1.71847 WP_003899290.1.7185 WP_003899290.1.71851 WP_003899290.1.71871 WP_003899290.1.71909 WP_003899290.1.71957 WP_003899290.1.71970 WP_003899290.1.72047 WP_003899290.1.72061 WP_003899290.1.72062 WP_003899290.1.72072 WP_003899290.1.72111 WP_003899290.1.72122 WP_003899290.1.72143 WP_003899290.1.72168 WP_003899290.1.72179 WP_003899290.1.72209 WP_003899290.1.72227 WP_003899290.1.7224 WP_003899290.1.72268 WP_003899290.1.72332 WP_003899290.1.72380 WP_003899290.1.72401 WP_003899290.1.72405 WP_003899290.1.72420 WP_003899290.1.72441 WP_003899290.1.72451 WP_003899290.1.72452 WP_003899290.1.72457 WP_003899290.1.72459 WP_003899290.1.72460 WP_003899290.1.72466 WP_003899290.1.72487 WP_003899290.1.72488 WP_003899290.1.72492 WP_003899290.1.72506 WP_003899290.1.72543 WP_003899290.1.7256 WP_003899290.1.72576 WP_003899290.1.72578 WP_003899290.1.72585 WP_003899290.1.72591 WP_003899290.1.72592 WP_003899290.1.72640 WP_003899290.1.72661 WP_003899290.1.72739 WP_003899290.1.72744 WP_003899290.1.72755 WP_003899290.1.72759 WP_003899290.1.72784 WP_003899290.1.72792 WP_003899290.1.72826 WP_003899290.1.72831 WP_003899290.1.72852 WP_003899290.1.72853 WP_003899290.1.72879 WP_003899290.1.72880 WP_003899290.1.72938 WP_003899290.1.72954 WP_003899290.1.72957 WP_003899290.1.72959 WP_003899290.1.72982 WP_003899290.1.72988 WP_003899290.1.72993 WP_003899290.1.73006 WP_003899290.1.73013 WP_003899290.1.73025 WP_003899290.1.73028 WP_003899290.1.73042 WP_003899290.1.73045 WP_003899290.1.73092 WP_003899290.1.73118 WP_003899290.1.7312 WP_003899290.1.73127 WP_003899290.1.73134 WP_003899290.1.73154 WP_003899290.1.73163 WP_003899290.1.73182 WP_003899290.1.73205 WP_003899290.1.7321 WP_003899290.1.73310 WP_003899290.1.73365 WP_003899290.1.73391 WP_003899290.1.73404 WP_003899290.1.73424 WP_003899290.1.73436 WP_003899290.1.73445 WP_003899290.1.73453 WP_003899290.1.73465 WP_003899290.1.73466 WP_003899290.1.73470 WP_003899290.1.73471 WP_003899290.1.73478 WP_003899290.1.73482 WP_003899290.1.73507 WP_003899290.1.73532 WP_003899290.1.73550 WP_003899290.1.73564 WP_003899290.1.73623 WP_003899290.1.73629 WP_003899290.1.73644 WP_003899290.1.7366 WP_003899290.1.73661 WP_003899290.1.7368 WP_003899290.1.73688 WP_003899290.1.73723 WP_003899290.1.73744 WP_003899290.1.73750 WP_003899290.1.73760 WP_003899290.1.7379 WP_003899290.1.73813 WP_003899290.1.73840 WP_003899290.1.73876 WP_003899290.1.7389 WP_003899290.1.74016 WP_003899290.1.74039 WP_003899290.1.74083 WP_003899290.1.74101 WP_003899290.1.74107 WP_003899290.1.74129 WP_003899290.1.74144 WP_003899290.1.7417 WP_003899290.1.74190 WP_003899290.1.74210 WP_003899290.1.7423 WP_003899290.1.74259 WP_003899290.1.74262 WP_003899290.1.74269 WP_003899290.1.74282 WP_003899290.1.74291 WP_003899290.1.74296 WP_003899290.1.74304 WP_003899290.1.7432 WP_003899290.1.74347 WP_003899290.1.7436 WP_003899290.1.74378 WP_003899290.1.74382 WP_003899290.1.74395 WP_003899290.1.74400 WP_003899290.1.74432 WP_003899290.1.74442 WP_003899290.1.74487 WP_003899290.1.74499 WP_003899290.1.74504 WP_003899290.1.74511 WP_003899290.1.74523 WP_003899290.1.74525 WP_003899290.1.74551 WP_003899290.1.74555 WP_003899290.1.74628 WP_003899290.1.74641 WP_003899290.1.74653 WP_003899290.1.74660 WP_003899290.1.74683 WP_003899290.1.7469 WP_003899290.1.74725 WP_003899290.1.74760 WP_003899290.1.74809 WP_003899290.1.74820 WP_003899290.1.74870 WP_003899290.1.74881 WP_003899290.1.74888 WP_003899290.1.74952 WP_003899290.1.7496 WP_003899290.1.74988 WP_003899290.1.75043 WP_003899290.1.75055 WP_003899290.1.75078 WP_003899290.1.75081 WP_003899290.1.75120 WP_003899290.1.75163 WP_003899290.1.75188 WP_003899290.1.75200 WP_003899290.1.75202 WP_003899290.1.75234 WP_003899290.1.75239 WP_003899290.1.75263 WP_003899290.1.75342 WP_003899290.1.7535 WP_003899290.1.75376 WP_003899290.1.75391 WP_003899290.1.75395 WP_003899290.1.75441 WP_003899290.1.75510 WP_003899290.1.75581 WP_003899290.1.75598 WP_003899290.1.75635 WP_003899290.1.75665 WP_003899290.1.75671 WP_003899290.1.75749 WP_003899290.1.75772 WP_003899290.1.75774 WP_003899290.1.75833 WP_003899290.1.7585 WP_003899290.1.75864 WP_003899290.1.75868 WP_003899290.1.75878 WP_003899290.1.75927 WP_003899290.1.75946 WP_003899290.1.75968 WP_003899290.1.75974 WP_003899290.1.76016 WP_003899290.1.76032 WP_003899290.1.76037 WP_003899290.1.7604 WP_003899290.1.76045 WP_003899290.1.76052 WP_003899290.1.76058 WP_003899290.1.76064 WP_003899290.1.76110 WP_003899290.1.76126 WP_003899290.1.76133 WP_003899290.1.76138 WP_003899290.1.76157 WP_003899290.1.76172 WP_003899290.1.76177 WP_003899290.1.76183 WP_003899290.1.76209 WP_003899290.1.76272 WP_003899290.1.76277 WP_003899290.1.76281 WP_003899290.1.76291 WP_003899290.1.76297 WP_003899290.1.76360 WP_003899290.1.76379 WP_003899290.1.76403 WP_003899290.1.76413 WP_003899290.1.76414 WP_003899290.1.76427 WP_003899290.1.76436 WP_003899290.1.76442 WP_003899290.1.76443 WP_003899290.1.76456 WP_003899290.1.76533 WP_003899290.1.76616 WP_003899290.1.76625 WP_003899290.1.76629 WP_003899290.1.76635 WP_003899290.1.76638 WP_003899290.1.76640 WP_003899290.1.76644 WP_003899290.1.76677 WP_003899290.1.76678 WP_003899290.1.76679 WP_003899290.1.76734 WP_003899290.1.76744 WP_003899290.1.76750 WP_003899290.1.76754 WP_003899290.1.76757 WP_003899290.1.76781 WP_003899290.1.76818 WP_003899290.1.76824 WP_003899290.1.76835 WP_003899290.1.76873 WP_003899290.1.76888 WP_003899290.1.76900 WP_003899290.1.7691 WP_003899290.1.76947 WP_003899290.1.76954 WP_003899290.1.76955 WP_003899290.1.76963 WP_003899290.1.770 WP_003899290.1.77000 WP_003899290.1.77008 WP_003899290.1.77021 WP_003899290.1.77056 WP_003899290.1.77065 WP_003899290.1.77075 WP_003899290.1.77107 WP_003899290.1.77115 WP_003899290.1.77118 WP_003899290.1.77125 WP_003899290.1.77141 WP_003899290.1.77142 WP_003899290.1.77250 WP_003899290.1.77260 WP_003899290.1.77266 WP_003899290.1.77285 WP_003899290.1.77312 WP_003899290.1.77348 WP_003899290.1.77351 WP_003899290.1.77352 WP_003899290.1.77361 WP_003899290.1.774 WP_003899290.1.77404 WP_003899290.1.77425 WP_003899290.1.77463 WP_003899290.1.77474 WP_003899290.1.7748 WP_003899290.1.77484 WP_003899290.1.77491 WP_003899290.1.77499 WP_003899290.1.77510 WP_003899290.1.77530 WP_003899290.1.77554 WP_003899290.1.77559 WP_003899290.1.77599 WP_003899290.1.7762 WP_003899290.1.77627 WP_003899290.1.77649 WP_003899290.1.77654 WP_003899290.1.7766 WP_003899290.1.77667 WP_003899290.1.77704 WP_003899290.1.77706 WP_003899290.1.77774 WP_003899290.1.7778 WP_003899290.1.77790 WP_003899290.1.77809 WP_003899290.1.77820 WP_003899290.1.77843 WP_003899290.1.77855 WP_003899290.1.77865 WP_003899290.1.77868 WP_003899290.1.77890 WP_003899290.1.77909 WP_003899290.1.77911 WP_003899290.1.77931 WP_003899290.1.77984 WP_003899290.1.78020 WP_003899290.1.78024 WP_003899290.1.78075 WP_003899290.1.78086 WP_003899290.1.7809 WP_003899290.1.78098 WP_003899290.1.78105 WP_003899290.1.78113 WP_003899290.1.78136 WP_003899290.1.78162 WP_003899290.1.7817 WP_003899290.1.78216 WP_003899290.1.78236 WP_003899290.1.78238 WP_003899290.1.78322 WP_003899290.1.78338 WP_003899290.1.7836 WP_003899290.1.78360 WP_003899290.1.78386 WP_003899290.1.78435 WP_003899290.1.7844 WP_003899290.1.78459 WP_003899290.1.78488 WP_003899290.1.7849 WP_003899290.1.78499 WP_003899290.1.785 WP_003899290.1.78516 WP_003899290.1.78524 WP_003899290.1.78526 WP_003899290.1.78538 WP_003899290.1.78545 WP_003899290.1.78547 WP_003899290.1.78574 WP_003899290.1.78580 WP_003899290.1.7860 WP_003899290.1.78620 WP_003899290.1.78646 WP_003899290.1.78648 WP_003899290.1.78649 WP_003899290.1.78655 WP_003899290.1.78657 WP_003899290.1.78659 WP_003899290.1.7869 WP_003899290.1.78692 WP_003899290.1.78760 WP_003899290.1.78766 WP_003899290.1.78776 WP_003899290.1.78778 WP_003899290.1.78784 WP_003899290.1.78788 WP_003899290.1.78790 WP_003899290.1.78860 WP_003899290.1.7887 WP_003899290.1.78884 WP_003899290.1.78932 WP_003899290.1.78969 WP_003899290.1.78977 WP_003899290.1.78980 WP_003899290.1.79005 WP_003899290.1.79016 WP_003899290.1.79033 WP_003899290.1.79064 WP_003899290.1.79066 WP_003899290.1.79068 WP_003899290.1.79095 WP_003899290.1.79112 WP_003899290.1.79122 WP_003899290.1.79145 WP_003899290.1.79152 WP_003899290.1.79163 WP_003899290.1.79182 WP_003899290.1.79213 WP_003899290.1.79218 WP_003899290.1.79268 WP_003899290.1.79278 WP_003899290.1.79290 WP_003899290.1.79319 WP_003899290.1.79325 WP_003899290.1.79326 WP_003899290.1.7933 WP_003899290.1.79330 WP_003899290.1.79339 WP_003899290.1.79394 WP_003899290.1.79399 WP_003899290.1.79413 WP_003899290.1.79422 WP_003899290.1.79445 WP_003899290.1.79447 WP_003899290.1.79455 WP_003899290.1.79471 WP_003899290.1.79480 WP_003899290.1.79482 WP_003899290.1.79488 WP_003899290.1.79500 WP_003899290.1.79502 WP_003899290.1.79508 WP_003899290.1.79514 WP_003899290.1.79561 WP_003899290.1.79565 WP_003899290.1.79578 WP_003899290.1.79588 WP_003899290.1.79598 WP_003899290.1.79615 WP_003899290.1.79684 WP_003899290.1.79698 WP_003899290.1.797 WP_003899290.1.79744 WP_003899290.1.79784 WP_003899290.1.79806 WP_003899290.1.79819 WP_003899290.1.79826 WP_003899290.1.79828 WP_003899290.1.79851 WP_003899290.1.79853 WP_003899290.1.79863 WP_003899290.1.79881 WP_003899290.1.79885 WP_003899290.1.79898 WP_003899290.1.7990 WP_003899290.1.79900 WP_003899290.1.79913 WP_003899290.1.79918 WP_003899290.1.79947 WP_003899290.1.79948 WP_003899290.1.7995 WP_003899290.1.7997 WP_003899290.1.80004 WP_003899290.1.80022 WP_003899290.1.80030 WP_003899290.1.80054 WP_003899290.1.80084 WP_003899290.1.80099 WP_003899290.1.80129 WP_003899290.1.80177 WP_003899290.1.80234 WP_003899290.1.8026 WP_003899290.1.80275 WP_003899290.1.8029 WP_003899290.1.80299 WP_003899290.1.80304 WP_003899290.1.80326 WP_003899290.1.8037 WP_003899290.1.80370 WP_003899290.1.80387 WP_003899290.1.80451 WP_003899290.1.80458 WP_003899290.1.80461 WP_003899290.1.80490 WP_003899290.1.80503 WP_003899290.1.80507 WP_003899290.1.80552 WP_003899290.1.80576 WP_003899290.1.80588 WP_003899290.1.80599 WP_003899290.1.8060 WP_003899290.1.80624 WP_003899290.1.80636 WP_003899290.1.80673 WP_003899290.1.80711 WP_003899290.1.80714 WP_003899290.1.80743 WP_003899290.1.80784 WP_003899290.1.80815 WP_003899290.1.80853 WP_003899290.1.80918 WP_003899290.1.8093 WP_003899290.1.80967 WP_003899290.1.8097 WP_003899290.1.80988 WP_003899290.1.81007 WP_003899290.1.81013 WP_003899290.1.8105 WP_003899290.1.81063 WP_003899290.1.81066 WP_003899290.1.81075 WP_003899290.1.81091 WP_003899290.1.81119 WP_003899290.1.81125 WP_003899290.1.8114 WP_003899290.1.81189 WP_003899290.1.81192 WP_003899290.1.812 WP_003899290.1.81230 WP_003899290.1.81249 WP_003899290.1.81250 WP_003899290.1.81264 WP_003899290.1.8128 WP_003899290.1.81287 WP_003899290.1.81297 WP_003899290.1.8138 WP_003899290.1.81407 WP_003899290.1.8143 WP_003899290.1.81439 WP_003899290.1.81465 WP_003899290.1.81529 WP_003899290.1.81538 WP_003899290.1.81541 WP_003899290.1.81560 WP_003899290.1.81561 WP_003899290.1.81567 WP_003899290.1.81583 WP_003899290.1.81686 WP_003899290.1.81712 WP_003899290.1.81720 WP_003899290.1.81731 WP_003899290.1.81774 WP_003899290.1.81788 WP_003899290.1.81850 WP_003899290.1.81883 WP_003899290.1.81891 WP_003899290.1.81911 WP_003899290.1.81918 WP_003899290.1.82011 WP_003899290.1.82048 WP_003899290.1.82069 WP_003899290.1.82071 WP_003899290.1.82108 WP_003899290.1.82136 WP_003899290.1.82142 WP_003899290.1.8215 WP_003899290.1.82158 WP_003899290.1.82209 WP_003899290.1.82210 WP_003899290.1.82228 WP_003899290.1.82236 WP_003899290.1.82251 WP_003899290.1.82271 WP_003899290.1.82305 WP_003899290.1.82307 WP_003899290.1.82317 WP_003899290.1.8232 WP_003899290.1.82346 WP_003899290.1.82374 WP_003899290.1.82385 WP_003899290.1.82429 WP_003899290.1.82460 WP_003899290.1.82483 WP_003899290.1.82494 WP_003899290.1.82531 WP_003899290.1.82546 WP_003899290.1.82547 WP_003899290.1.82549 WP_003899290.1.82577 WP_003899290.1.82592 WP_003899290.1.82597 WP_003899290.1.82598 WP_003899290.1.82625 WP_003899290.1.82642 WP_003899290.1.82651 WP_003899290.1.82653 WP_003899290.1.82681 WP_003899290.1.82685 WP_003899290.1.8271 WP_003899290.1.82712 WP_003899290.1.8273 WP_003899290.1.82743 WP_003899290.1.82757 WP_003899290.1.82774 WP_003899290.1.82803 WP_003899290.1.82860 WP_003899290.1.82871 WP_003899290.1.82892 WP_003899290.1.82935 WP_003899290.1.82957 WP_003899290.1.82981 WP_003899290.1.82983 WP_003899290.1.83004 WP_003899290.1.83009 WP_003899290.1.83044 WP_003899290.1.83074 WP_003899290.1.83146 WP_003899290.1.83149 WP_003899290.1.83159 WP_003899290.1.8317 WP_003899290.1.83173 WP_003899290.1.83181 WP_003899290.1.83182 WP_003899290.1.83191 WP_003899290.1.83197 WP_003899290.1.83212 WP_003899290.1.8326 WP_003899290.1.83262 WP_003899290.1.83273 WP_003899290.1.83309 WP_003899290.1.83332 WP_003899290.1.83334 WP_003899290.1.83341 WP_003899290.1.83349 WP_003899290.1.8335 WP_003899290.1.83353 WP_003899290.1.83367 WP_003899290.1.83380 WP_003899290.1.83381 WP_003899290.1.83389 WP_003899290.1.83408 WP_003899290.1.83409 WP_003899290.1.83435 WP_003899290.1.83470 WP_003899290.1.83524 WP_003899290.1.83526 WP_003899290.1.8358 WP_003899290.1.83589 WP_003899290.1.83601 WP_003899290.1.83611 WP_003899290.1.83638 WP_003899290.1.83656 WP_003899290.1.83667 WP_003899290.1.83689 WP_003899290.1.83692 WP_003899290.1.83705 WP_003899290.1.83766 WP_003899290.1.83793 WP_003899290.1.83794 WP_003899290.1.83802 WP_003899290.1.83805 WP_003899290.1.83839 WP_003899290.1.83842 WP_003899290.1.83850 WP_003899290.1.83884 WP_003899290.1.83920 WP_003899290.1.83929 WP_003899290.1.83930 WP_003899290.1.83975 WP_003899290.1.83991 WP_003899290.1.8400 WP_003899290.1.84027 WP_003899290.1.8404 WP_003899290.1.84057 WP_003899290.1.84070 WP_003899290.1.8409 WP_003899290.1.84112 WP_003899290.1.84146 WP_003899290.1.8415 WP_003899290.1.84176 WP_003899290.1.84192 WP_003899290.1.84228 WP_003899290.1.8424 WP_003899290.1.84244 WP_003899290.1.84259 WP_003899290.1.8426 WP_003899290.1.84277 WP_003899290.1.84287 WP_003899290.1.8434 WP_003899290.1.84388 WP_003899290.1.84409 WP_003899290.1.84438 WP_003899290.1.84460 WP_003899290.1.84488 WP_003899290.1.84504 WP_003899290.1.84525 WP_003899290.1.84620 WP_003899290.1.84623 WP_003899290.1.84641 WP_003899290.1.84655 WP_003899290.1.84666 WP_003899290.1.84670 WP_003899290.1.84739 WP_003899290.1.84748 WP_003899290.1.84766 WP_003899290.1.84772 WP_003899290.1.84774 WP_003899290.1.848 WP_003899290.1.84812 WP_003899290.1.84836 WP_003899290.1.84839 WP_003899290.1.84846 WP_003899290.1.84873 WP_003899290.1.84938 WP_003899290.1.84968 WP_003899290.1.84973 WP_003899290.1.84981 WP_003899290.1.84985 WP_003899290.1.8503 WP_003899290.1.85038 WP_003899290.1.85043 WP_003899290.1.8505 WP_003899290.1.85074 WP_003899290.1.8509 WP_003899290.1.8512 WP_003899290.1.85148 WP_003899290.1.8518 WP_003899290.1.8522 WP_003899290.1.85242 WP_003899290.1.85276 WP_003899290.1.85284 WP_003899290.1.85314 WP_003899290.1.85319 WP_003899290.1.85330 WP_003899290.1.85341 WP_003899290.1.8535 WP_003899290.1.85363 WP_003899290.1.85371 WP_003899290.1.85377 WP_003899290.1.85387 WP_003899290.1.85399 WP_003899290.1.85458 WP_003899290.1.8546 WP_003899290.1.85478 WP_003899290.1.85488 WP_003899290.1.85495 WP_003899290.1.85551 WP_003899290.1.85557 WP_003899290.1.85577 WP_003899290.1.85599 WP_003899290.1.85610 WP_003899290.1.8563 WP_003899290.1.85648 WP_003899290.1.85679 WP_003899290.1.85704 WP_003899290.1.85717 WP_003899290.1.85727 WP_003899290.1.85737 WP_003899290.1.85763 WP_003899290.1.85808 WP_003899290.1.85819 WP_003899290.1.85820 WP_003899290.1.85823 WP_003899290.1.85832 WP_003899290.1.8586 WP_003899290.1.85872 WP_003899290.1.85894 WP_003899290.1.85909 WP_003899290.1.85913 WP_003899290.1.85953 WP_003899290.1.85986 WP_003899290.1.86000 WP_003899290.1.86025 WP_003899290.1.86032 WP_003899290.1.86048 WP_003899290.1.86052 WP_003899290.1.86067 WP_003899290.1.86103 WP_003899290.1.86122 WP_003899290.1.86124 WP_003899290.1.86160 WP_003899290.1.86164 WP_003899290.1.86168 WP_003899290.1.86190 WP_003899290.1.86204 WP_003899290.1.86208 WP_003899290.1.86235 WP_003899290.1.86249 WP_003899290.1.86260 WP_003899290.1.86290 WP_003899290.1.863 WP_003899290.1.86327 WP_003899290.1.86334 WP_003899290.1.86337 WP_003899290.1.86368 WP_003899290.1.86377 WP_003899290.1.86425 WP_003899290.1.86459 WP_003899290.1.8649 WP_003899290.1.86499 WP_003899290.1.86520 WP_003899290.1.86561 WP_003899290.1.86568 WP_003899290.1.86575 WP_003899290.1.86584 WP_003899290.1.86605 WP_003899290.1.86626 WP_003899290.1.86648 WP_003899290.1.86684 WP_003899290.1.86696 WP_003899290.1.86705 WP_003899290.1.86718 WP_003899290.1.86725 WP_003899290.1.86757 WP_003899290.1.86766 WP_003899290.1.86801 WP_003899290.1.86814 WP_003899290.1.86820 WP_003899290.1.86825 WP_003899290.1.86834 WP_003899290.1.8685 WP_003899290.1.86851 WP_003899290.1.86855 WP_003899290.1.86867 WP_003899290.1.86877 WP_003899290.1.86883 WP_003899290.1.8689 WP_003899290.1.86892 WP_003899290.1.86933 WP_003899290.1.86941 WP_003899290.1.86950 WP_003899290.1.86962 WP_003899290.1.86963 WP_003899290.1.86979 WP_003899290.1.8700 WP_003899290.1.87002 WP_003899290.1.87031 WP_003899290.1.87116 WP_003899290.1.87117 WP_003899290.1.8714 WP_003899290.1.87178 WP_003899290.1.87191 WP_003899290.1.87201 WP_003899290.1.87209 WP_003899290.1.87240 WP_003899290.1.87266 WP_003899290.1.87273 WP_003899290.1.87275 WP_003899290.1.8733 WP_003899290.1.87345 WP_003899290.1.8737 WP_003899290.1.87401 WP_003899290.1.87409 WP_003899290.1.87444 WP_003899290.1.87446 WP_003899290.1.87459 WP_003899290.1.87472 WP_003899290.1.87489 WP_003899290.1.87494 WP_003899290.1.87496 WP_003899290.1.87582 WP_003899290.1.87588 WP_003899290.1.87617 WP_003899290.1.87619 WP_003899290.1.87620 WP_003899290.1.87634 WP_003899290.1.87643 WP_003899290.1.8765 WP_003899290.1.87650 WP_003899290.1.87654 WP_003899290.1.87658 WP_003899290.1.87665 WP_003899290.1.87676 WP_003899290.1.87677 WP_003899290.1.87684 WP_003899290.1.87692 WP_003899290.1.87707 WP_003899290.1.87732 WP_003899290.1.87784 WP_003899290.1.87796 WP_003899290.1.87809 WP_003899290.1.87817 WP_003899290.1.87827 WP_003899290.1.87831 WP_003899290.1.87835 WP_003899290.1.87837 WP_003899290.1.87866 WP_003899290.1.8789 WP_003899290.1.87911 WP_003899290.1.87924 WP_003899290.1.87951 WP_003899290.1.87956 WP_003899290.1.87991 WP_003899290.1.88 WP_003899290.1.88002 WP_003899290.1.88037 WP_003899290.1.88039 WP_003899290.1.88072 WP_003899290.1.88077 WP_003899290.1.88121 WP_003899290.1.88191 WP_003899290.1.88205 WP_003899290.1.88217 WP_003899290.1.88219 WP_003899290.1.88245 WP_003899290.1.88253 WP_003899290.1.88294 WP_003899290.1.88315 WP_003899290.1.88316 WP_003899290.1.88320 WP_003899290.1.88338 WP_003899290.1.8840 WP_003899290.1.88437 WP_003899290.1.88453 WP_003899290.1.88469 WP_003899290.1.88489 WP_003899290.1.88507 WP_003899290.1.88530 WP_003899290.1.88537 WP_003899290.1.88541 WP_003899290.1.88592 WP_003899290.1.88616 WP_003899290.1.88618 WP_003899290.1.8862 WP_003899290.1.88625 WP_003899290.1.88632 WP_003899290.1.88634 WP_003899290.1.88649 WP_003899290.1.8870 WP_003899290.1.88737 WP_003899290.1.88756 WP_003899290.1.888 WP_003899290.1.88824 WP_003899290.1.88886 WP_003899290.1.88965 WP_003899290.1.88985 WP_003899290.1.8902 WP_003899290.1.89025 WP_003899290.1.89041 WP_003899290.1.89046 WP_003899290.1.89082 WP_003899290.1.89162 WP_003899290.1.89168 WP_003899290.1.8917 WP_003899290.1.89205 WP_003899290.1.89207 WP_003899290.1.89225 WP_003899290.1.8925 WP_003899290.1.89277 WP_003899290.1.89286 WP_003899290.1.89293 WP_003899290.1.89320 WP_003899290.1.8935 WP_003899290.1.89371 WP_003899290.1.89378 WP_003899290.1.89392 WP_003899290.1.89406 WP_003899290.1.89451 WP_003899290.1.89453 WP_003899290.1.89473 WP_003899290.1.89475 WP_003899290.1.89483 WP_003899290.1.895 WP_003899290.1.89513 WP_003899290.1.89517 WP_003899290.1.89522 WP_003899290.1.8954 WP_003899290.1.89543 WP_003899290.1.8957 WP_003899290.1.89572 WP_003899290.1.89589 WP_003899290.1.89607 WP_003899290.1.89613 WP_003899290.1.89625 WP_003899290.1.89648 WP_003899290.1.8967 WP_003899290.1.89670 WP_003899290.1.89676 WP_003899290.1.89729 WP_003899290.1.89739 WP_003899290.1.89762 WP_003899290.1.8977 WP_003899290.1.89808 WP_003899290.1.8982 WP_003899290.1.89829 WP_003899290.1.89831 WP_003899290.1.89844 WP_003899290.1.89849 WP_003899290.1.89901 WP_003899290.1.89903 WP_003899290.1.89909 WP_003899290.1.89926 WP_003899290.1.89963 WP_003899290.1.89971 WP_003899290.1.8998 WP_003899290.1.89987 WP_003899290.1.900 WP_003899290.1.90048 WP_003899290.1.9007 WP_003899290.1.90080 WP_003899290.1.90130 WP_003899290.1.90134 WP_003899290.1.90137 WP_003899290.1.90157 WP_003899290.1.90184 WP_003899290.1.90199 WP_003899290.1.90231 WP_003899290.1.90245 WP_003899290.1.90308 WP_003899290.1.90322 WP_003899290.1.90328 WP_003899290.1.90372 WP_003899290.1.90481 WP_003899290.1.90499 WP_003899290.1.9050 WP_003899290.1.90527 WP_003899290.1.90550 WP_003899290.1.90560 WP_003899290.1.90612 WP_003899290.1.90672 WP_003899290.1.90687 WP_003899290.1.90691 WP_003899290.1.90711 WP_003899290.1.90722 WP_003899290.1.90744 WP_003899290.1.9075 WP_003899290.1.90756 WP_003899290.1.90767 WP_003899290.1.90771 WP_003899290.1.90785 WP_003899290.1.90788 WP_003899290.1.90800 WP_003899290.1.90810 WP_003899290.1.90816 WP_003899290.1.90819 WP_003899290.1.9082 WP_003899290.1.90831 WP_003899290.1.90884 WP_003899290.1.90899 WP_003899290.1.90906 WP_003899290.1.90958 WP_003899290.1.90976 WP_003899290.1.90977 WP_003899290.1.90987 WP_003899290.1.9102 WP_003899290.1.91026 WP_003899290.1.91032 WP_003899290.1.91053 WP_003899290.1.91082 WP_003899290.1.91106 WP_003899290.1.91112 WP_003899290.1.91144 WP_003899290.1.91151 WP_003899290.1.91157 WP_003899290.1.91167 WP_003899290.1.91169 WP_003899290.1.91192 WP_003899290.1.91201 WP_003899290.1.91207 WP_003899290.1.91208 WP_003899290.1.91211 WP_003899290.1.91214 WP_003899290.1.91230 WP_003899290.1.91244 WP_003899290.1.91251 WP_003899290.1.91260 WP_003899290.1.91284 WP_003899290.1.91294 WP_003899290.1.91303 WP_003899290.1.91322 WP_003899290.1.91386 WP_003899290.1.9139 WP_003899290.1.91398 WP_003899290.1.91430 WP_003899290.1.91436 WP_003899290.1.91483 WP_003899290.1.91496 WP_003899290.1.91507 WP_003899290.1.91576 WP_003899290.1.91589 WP_003899290.1.91694 WP_003899290.1.91695 WP_003899290.1.91716 WP_003899290.1.91717 WP_003899290.1.91728 WP_003899290.1.91743 WP_003899290.1.91759 WP_003899290.1.91784 WP_003899290.1.91785 WP_003899290.1.91786 WP_003899290.1.91802 WP_003899290.1.91822 WP_003899290.1.91828 WP_003899290.1.9189 WP_003899290.1.91896 WP_003899290.1.9190 WP_003899290.1.91915 WP_003899290.1.91931 WP_003899290.1.91937 WP_003899290.1.91944 WP_003899290.1.91953 WP_003899290.1.91957 WP_003899290.1.91976 WP_003899290.1.92083 WP_003899290.1.92127 WP_003899290.1.92144 WP_003899290.1.92150 WP_003899290.1.92153 WP_003899290.1.92190 WP_003899290.1.92192 WP_003899290.1.92200 WP_003899290.1.92220 WP_003899290.1.92221 WP_003899290.1.92222 WP_003899290.1.92273 WP_003899290.1.92289 WP_003899290.1.9229 WP_003899290.1.92294 WP_003899290.1.92300 WP_003899290.1.92317 WP_003899290.1.92334 WP_003899290.1.92338 WP_003899290.1.92345 WP_003899290.1.92356 WP_003899290.1.92364 WP_003899290.1.92380 WP_003899290.1.92428 WP_003899290.1.92447 WP_003899290.1.92456 WP_003899290.1.92467 WP_003899290.1.92471 WP_003899290.1.92490 WP_003899290.1.92508 WP_003899290.1.9251 WP_003899290.1.92511 WP_003899290.1.92523 WP_003899290.1.92527 WP_003899290.1.92536 WP_003899290.1.92592 WP_003899290.1.92603 WP_003899290.1.92606 WP_003899290.1.92610 WP_003899290.1.92613 WP_003899290.1.9263 WP_003899290.1.9265 WP_003899290.1.92650 WP_003899290.1.92660 WP_003899290.1.92677 WP_003899290.1.92685 WP_003899290.1.92689 WP_003899290.1.92690 WP_003899290.1.92714 WP_003899290.1.92736 WP_003899290.1.9274 WP_003899290.1.92752 WP_003899290.1.92760 WP_003899290.1.92777 WP_003899290.1.92803 WP_003899290.1.92833 WP_003899290.1.92856 WP_003899290.1.92881 WP_003899290.1.92892 WP_003899290.1.92907 WP_003899290.1.92908 WP_003899290.1.9291 WP_003899290.1.92917 WP_003899290.1.92996 WP_003899290.1.93006 WP_003899290.1.93009 WP_003899290.1.93015 WP_003899290.1.93043 WP_003899290.1.9307 WP_003899290.1.93083 WP_003899290.1.93097 WP_003899290.1.93137 WP_003899290.1.93192 WP_003899290.1.93199 WP_003899290.1.93203 WP_003899290.1.93212 WP_003899290.1.93234 WP_003899290.1.93245 WP_003899290.1.93257 WP_003899290.1.93297 WP_003899290.1.93320 WP_003899290.1.93328 WP_003899290.1.93337 WP_003899290.1.93343 WP_003899290.1.93349 WP_003899290.1.93363 WP_003899290.1.93377 WP_003899290.1.9338 WP_003899290.1.93407 WP_003899290.1.93417 WP_003899290.1.93419 WP_003899290.1.93426 WP_003899290.1.9344 WP_003899290.1.93443 WP_003899290.1.93447 WP_003899290.1.93470 WP_003899290.1.93483 WP_003899290.1.93487 WP_003899290.1.93495 WP_003899290.1.93499 WP_003899290.1.93516 WP_003899290.1.93536 WP_003899290.1.93544 WP_003899290.1.93555 WP_003899290.1.93560 WP_003899290.1.93564 WP_003899290.1.9357 WP_003899290.1.93573 WP_003899290.1.93576 WP_003899290.1.93588 WP_003899290.1.9363 WP_003899290.1.93645 WP_003899290.1.93649 WP_003899290.1.93659 WP_003899290.1.93677 WP_003899290.1.9368 WP_003899290.1.93689 WP_003899290.1.93693 WP_003899290.1.93698 WP_003899290.1.93706 WP_003899290.1.9371 WP_003899290.1.93792 WP_003899290.1.93823 WP_003899290.1.93871 WP_003899290.1.9388 WP_003899290.1.93894 WP_003899290.1.93903 WP_003899290.1.93907 WP_003899290.1.93913 WP_003899290.1.93946 WP_003899290.1.93950 WP_003899290.1.93953 WP_003899290.1.93954 WP_003899290.1.93988 WP_003899290.1.9407 WP_003899290.1.94143 WP_003899290.1.94154 WP_003899290.1.94204 WP_003899290.1.94205 WP_003899290.1.94226 WP_003899290.1.94231 WP_003899290.1.94256 WP_003899290.1.94261 WP_003899290.1.94281 WP_003899290.1.94292 WP_003899290.1.94297 WP_003899290.1.9431 WP_003899290.1.94326 WP_003899290.1.94339 WP_003899290.1.94392 WP_003899290.1.94416 WP_003899290.1.94421 WP_003899290.1.94456 WP_003899290.1.94480 WP_003899290.1.94495 WP_003899290.1.94511 WP_003899290.1.94512 WP_003899290.1.94528 WP_003899290.1.94564 WP_003899290.1.946 WP_003899290.1.94623 WP_003899290.1.94629 WP_003899290.1.9465 WP_003899290.1.94673 WP_003899290.1.94714 WP_003899290.1.94730 WP_003899290.1.94736 WP_003899290.1.94776 WP_003899290.1.9478 WP_003899290.1.94834 WP_003899290.1.94852 WP_003899290.1.94872 WP_003899290.1.9488 WP_003899290.1.94902 WP_003899290.1.94916 WP_003899290.1.94979 WP_003899290.1.94994 WP_003899290.1.94996 WP_003899290.1.94998 WP_003899290.1.95007 WP_003899290.1.95010 WP_003899290.1.95015 WP_003899290.1.95034 WP_003899290.1.95068 WP_003899290.1.95081 WP_003899290.1.95082 WP_003899290.1.9509 WP_003899290.1.95096 WP_003899290.1.95112 WP_003899290.1.95138 WP_003899290.1.9514 WP_003899290.1.95179 WP_003899290.1.95188 WP_003899290.1.95190 WP_003899290.1.95234 WP_003899290.1.95241 WP_003899290.1.95245 WP_003899290.1.95257 WP_003899290.1.95279 WP_003899290.1.9531 WP_003899290.1.95335 WP_003899290.1.95344 WP_003899290.1.9535 WP_003899290.1.95370 WP_003899290.1.95392 WP_003899290.1.95416 WP_003899290.1.95417 WP_003899290.1.95454 WP_003899290.1.95455 WP_003899290.1.95491 WP_003899290.1.95497 WP_003899290.1.95508 WP_003899290.1.95509 WP_003899290.1.95529 WP_003899290.1.95556 WP_003899290.1.95557 WP_003899290.1.95565 WP_003899290.1.95578 WP_003899290.1.95580 WP_003899290.1.95585 WP_003899290.1.95643 WP_003899290.1.95679 WP_003899290.1.95685 WP_003899290.1.957 WP_003899290.1.95724 WP_003899290.1.95727 WP_003899290.1.95730 WP_003899290.1.95735 WP_003899290.1.95758 WP_003899290.1.95772 WP_003899290.1.95797 WP_003899290.1.95839 WP_003899290.1.9585 WP_003899290.1.9590 WP_003899290.1.95902 WP_003899290.1.95924 WP_003899290.1.95926 WP_003899290.1.95953 WP_003899290.1.95958 WP_003899290.1.95964 WP_003899290.1.95973 WP_003899290.1.96006 WP_003899290.1.9602 WP_003899290.1.96036 WP_003899290.1.96062 WP_003899290.1.96065 WP_003899290.1.96098 WP_003899290.1.96146 WP_003899290.1.96171 WP_003899290.1.96182 WP_003899290.1.96230 WP_003899290.1.96242 WP_003899290.1.96245 WP_003899290.1.96254 WP_003899290.1.96259 WP_003899290.1.96286 WP_003899290.1.96313 WP_003899290.1.96318 WP_003899290.1.96345 WP_003899290.1.96360 WP_003899290.1.96373 WP_003899290.1.96456 WP_003899290.1.96486 WP_003899290.1.96569 WP_003899290.1.96573 WP_003899290.1.96576 WP_003899290.1.96611 WP_003899290.1.96621 WP_003899290.1.9667 WP_003899290.1.96681 WP_003899290.1.96726 WP_003899290.1.96733 WP_003899290.1.96742 WP_003899290.1.96754 WP_003899290.1.9678 WP_003899290.1.9685 WP_003899290.1.97008 WP_003899290.1.97009 WP_003899290.1.97056 WP_003899290.1.97084 WP_003899290.1.97087 WP_003899290.1.97094 WP_003899290.1.97096 WP_003899290.1.97099 WP_003899290.1.97108 WP_003899290.1.97113 WP_003899290.1.97122 WP_003899290.1.97129 WP_003899290.1.97136 WP_003899290.1.9716 WP_003899290.1.97176 WP_003899290.1.97222 WP_003899290.1.97237 WP_003899290.1.97242 WP_003899290.1.97270 WP_003899290.1.97283 WP_003899290.1.97296 WP_003899290.1.97321 WP_003899290.1.97325 WP_003899290.1.97366 WP_003899290.1.97376 WP_003899290.1.97380 WP_003899290.1.97462 WP_003899290.1.97517 WP_003899290.1.97519 WP_003899290.1.97535 WP_003899290.1.97540 WP_003899290.1.97545 WP_003899290.1.97546 WP_003899290.1.97550 WP_003899290.1.97577 WP_003899290.1.97584 WP_003899290.1.9759 WP_003899290.1.97591 WP_003899290.1.97609 WP_003899290.1.97618 WP_003899290.1.9763 WP_003899290.1.97669 WP_003899290.1.97673 WP_003899290.1.97700 WP_003899290.1.97701 WP_003899290.1.9773 WP_003899290.1.97730 WP_003899290.1.97740 WP_003899290.1.97751 WP_003899290.1.97754 WP_003899290.1.9782 WP_003899290.1.9784 WP_003899290.1.97888 WP_003899290.1.9790 WP_003899290.1.9795 WP_003899290.1.97951 WP_003899290.1.97958 WP_003899290.1.97966 WP_003899290.1.97977 WP_003899290.1.97979 WP_003899290.1.97995 WP_003899290.1.98018 WP_003899290.1.98034 WP_003899290.1.98052 WP_003899290.1.98071 WP_003899290.1.98072 WP_003899290.1.98113 WP_003899290.1.98114 WP_003899290.1.98128 WP_003899290.1.98188 WP_003899290.1.98189 WP_003899290.1.98213 WP_003899290.1.98225 WP_003899290.1.98291 WP_003899290.1.98335 WP_003899290.1.98350 WP_003899290.1.98395 WP_003899290.1.98412 WP_003899290.1.98441 WP_003899290.1.98443 WP_003899290.1.98462 WP_003899290.1.9848 WP_003899290.1.98482 WP_003899290.1.98486 WP_003899290.1.98488 WP_003899290.1.98503 WP_003899290.1.98516 WP_003899290.1.98536 WP_003899290.1.98541 WP_003899290.1.98566 WP_003899290.1.98576 WP_003899290.1.98590 WP_003899290.1.98594 WP_003899290.1.98599 WP_003899290.1.98629 WP_003899290.1.98645 WP_003899290.1.98646 WP_003899290.1.98649 WP_003899290.1.98656 WP_003899290.1.9867 WP_003899290.1.98674 WP_003899290.1.98697 WP_003899290.1.98701 WP_003899290.1.98739 WP_003899290.1.98749 WP_003899290.1.98765 WP_003899290.1.98770 WP_003899290.1.98777 WP_003899290.1.98778 WP_003899290.1.98802 WP_003899290.1.98838 WP_003899290.1.98906 WP_003899290.1.98935 WP_003899290.1.98948 WP_003899290.1.98953 WP_003899290.1.98984 WP_003899290.1.99000 WP_003899290.1.99023 WP_003899290.1.99030 WP_003899290.1.99055 WP_003899290.1.99062 WP_003899290.1.99086 WP_003899290.1.99115 WP_003899290.1.99161 WP_003899290.1.99176 WP_003899290.1.99211 WP_003899290.1.99216 WP_003899290.1.99222 WP_003899290.1.99251 WP_003899290.1.99294 WP_003899290.1.99312 WP_003899290.1.99315 WP_003899290.1.99316 WP_003899290.1.99322 WP_003899290.1.99328 WP_003899290.1.99365 WP_003899290.1.99368 WP_003899290.1.99396 WP_003899290.1.99402 WP_003899290.1.99419 WP_003899290.1.99438 WP_003899290.1.99460 WP_003899290.1.99468 WP_003899290.1.99473 WP_003899290.1.99513 WP_003899290.1.99529 WP_003899290.1.99548 WP_003899290.1.99572 WP_003899290.1.99575 WP_003899290.1.99578 WP_003899290.1.99605 WP_003899290.1.99609 WP_003899290.1.99617 WP_003899290.1.99635 WP_003899290.1.99650 WP_003899290.1.99672 WP_003899290.1.99701 WP_003899290.1.99711 WP_003899290.1.99716 WP_003899290.1.99740 WP_003899290.1.99745 WP_003899290.1.99749 WP_003899290.1.9976 WP_003899290.1.99798 WP_003899290.1.99817 WP_003899290.1.99847 WP_003899290.1.99852 WP_003899290.1.99886 WP_003899290.1.99897 WP_003899290.1.99899 WP_003899290.1.99915 WP_003899290.1.99991 gi|253798563|ref|YP_003031564.1| gi|506926884|ref|YP_008007334.1| 336982.TBFG_12385 419947.MRA_2383 478434.TBMG_01616 83331.MT2428 83332.Rv2359 gi|392387000|ref|YP_005308629.1| gi|385999139|ref|YP_005917438.1| gi|392432033|ref|YP_006473077.1| gi|494692854|ref|YP_007958397.1| gi|375295826|ref|YP_005100093.1| gi|471338345|ref|YP_007611058.1| ISFI223 Rv2359 gi|383308151|ref|YP_005360962.1| gi|15609496|ref|NP_216875.1| gi|506926884|ref|YP_008007334.1| gi|385991687|ref|YP_005909985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]