SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197740960|ref|YP_002162274.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197740960|ref|YP_002162274.1|
Domain Number 1 Region: 195-335
Classification Level Classification E-value
Superfamily CBS-domain pair 5.68e-34
Family CBS-domain pair 0.002
Further Details:      
 
Domain Number 2 Region: 340-430
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000267
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197740960|ref|YP_002162274.1|
Sequence length 435
Comment transmembrane protein [Mycobacterium tuberculosis str. Haarlem]
Sequence
MTGYYQLLGSIVLIGLGGLFAAIDAAISTVSPARVDELVRDQRPGAGSLRKVMADRPRYV
NLVVLLRTSCEITATALLVVFIRYHFSMVWGLYLAAGIMVLASFVVVGVGPRTLGRQNAY
SISLATALPLRLISWLLMPISRLLVLLGNALTPGRGFRNGPFASEIELREVVDLAQQRGV
VAADERRMIESVFELGDTPAREVMVPRTEMIWIESDKTAGQAMTLAVRSGHSRIPVIGEN
VDDIVGVVYLKDLVEQTFCSTNGGRETTVARVMRPAVFVPDSKPLDALLREMQRDRNHMA
LLVDEYGAIAGLVSIEDVLEEIVGEIADEYDQAETAPVEDLGDKRFRVSARLPIEDVGEL
YGVEFDDDLDVDTVGGLLALELGRVPLPGAEVISHGLRLHAEGGTDHRGRVRIGTVLLSP
AEPDGADDEEADHPG
Download sequence
Identical sequences A0A045HB50 A0A083W5L9 A0A0H3LBG0 A0A0H3MCF7 A0A109SPG7 A0A109SYC7 A0A197IXW8 A0A1S1BEB5 A5U559 F8M1F5 I6XE54 M8DEN0 P67131 P9WFP0 P9WFP1 R4MIP8
gi|392387007|ref|YP_005308636.1| gi|224990739|ref|YP_002645426.1| gi|471338352|ref|YP_007611065.1| gi|494696744|ref|YP_007962247.1| gi|339632392|ref|YP_004724034.1| gi|148662198|ref|YP_001283721.1| gi|375295819|ref|YP_005100086.1| gi|392432026|ref|YP_006473070.1| NP_216882.1.84033 WP_003412229.1.100000 WP_003412229.1.100021 WP_003412229.1.100069 WP_003412229.1.100087 WP_003412229.1.10015 WP_003412229.1.10022 WP_003412229.1.100260 WP_003412229.1.100270 WP_003412229.1.100279 WP_003412229.1.100286 WP_003412229.1.100309 WP_003412229.1.100318 WP_003412229.1.100337 WP_003412229.1.100338 WP_003412229.1.10037 WP_003412229.1.100383 WP_003412229.1.100395 WP_003412229.1.100396 WP_003412229.1.1004 WP_003412229.1.100401 WP_003412229.1.100459 WP_003412229.1.100552 WP_003412229.1.100581 WP_003412229.1.100600 WP_003412229.1.100625 WP_003412229.1.10064 WP_003412229.1.100666 WP_003412229.1.100671 WP_003412229.1.100677 WP_003412229.1.100682 WP_003412229.1.100757 WP_003412229.1.100772 WP_003412229.1.100812 WP_003412229.1.100845 WP_003412229.1.10088 WP_003412229.1.10090 WP_003412229.1.100910 WP_003412229.1.100918 WP_003412229.1.100935 WP_003412229.1.100992 WP_003412229.1.101 WP_003412229.1.101025 WP_003412229.1.101028 WP_003412229.1.10104 WP_003412229.1.101048 WP_003412229.1.101054 WP_003412229.1.101075 WP_003412229.1.101143 WP_003412229.1.101146 WP_003412229.1.10116 WP_003412229.1.10117 WP_003412229.1.10125 WP_003412229.1.101290 WP_003412229.1.101323 WP_003412229.1.101324 WP_003412229.1.101367 WP_003412229.1.101398 WP_003412229.1.101403 WP_003412229.1.101421 WP_003412229.1.10145 WP_003412229.1.101452 WP_003412229.1.101456 WP_003412229.1.101481 WP_003412229.1.101493 WP_003412229.1.101496 WP_003412229.1.101525 WP_003412229.1.101533 WP_003412229.1.101535 WP_003412229.1.101558 WP_003412229.1.10156 WP_003412229.1.101576 WP_003412229.1.101604 WP_003412229.1.101622 WP_003412229.1.101644 WP_003412229.1.101659 WP_003412229.1.101671 WP_003412229.1.10170 WP_003412229.1.101713 WP_003412229.1.101722 WP_003412229.1.101733 WP_003412229.1.101753 WP_003412229.1.101754 WP_003412229.1.101773 WP_003412229.1.101795 WP_003412229.1.101798 WP_003412229.1.101826 WP_003412229.1.101836 WP_003412229.1.101858 WP_003412229.1.101859 WP_003412229.1.101862 WP_003412229.1.101888 WP_003412229.1.101894 WP_003412229.1.1019 WP_003412229.1.101923 WP_003412229.1.101925 WP_003412229.1.10193 WP_003412229.1.101996 WP_003412229.1.102008 WP_003412229.1.102055 WP_003412229.1.102099 WP_003412229.1.1021 WP_003412229.1.10211 WP_003412229.1.102143 WP_003412229.1.10216 WP_003412229.1.10224 WP_003412229.1.10253 WP_003412229.1.10272 WP_003412229.1.10277 WP_003412229.1.1033 WP_003412229.1.10362 WP_003412229.1.10366 WP_003412229.1.10376 WP_003412229.1.10410 WP_003412229.1.10414 WP_003412229.1.10421 WP_003412229.1.1044 WP_003412229.1.10440 WP_003412229.1.10445 WP_003412229.1.10471 WP_003412229.1.10472 WP_003412229.1.10489 WP_003412229.1.10518 WP_003412229.1.10523 WP_003412229.1.10594 WP_003412229.1.10603 WP_003412229.1.10606 WP_003412229.1.10615 WP_003412229.1.10623 WP_003412229.1.10635 WP_003412229.1.10648 WP_003412229.1.10709 WP_003412229.1.10735 WP_003412229.1.10740 WP_003412229.1.1078 WP_003412229.1.10791 WP_003412229.1.10799 WP_003412229.1.10848 WP_003412229.1.10863 WP_003412229.1.10912 WP_003412229.1.10916 WP_003412229.1.10923 WP_003412229.1.10927 WP_003412229.1.10958 WP_003412229.1.10962 WP_003412229.1.10981 WP_003412229.1.10993 WP_003412229.1.11040 WP_003412229.1.11061 WP_003412229.1.11070 WP_003412229.1.11141 WP_003412229.1.11171 WP_003412229.1.11176 WP_003412229.1.11236 WP_003412229.1.11329 WP_003412229.1.1133 WP_003412229.1.11342 WP_003412229.1.11376 WP_003412229.1.11402 WP_003412229.1.11481 WP_003412229.1.11487 WP_003412229.1.11489 WP_003412229.1.11491 WP_003412229.1.11514 WP_003412229.1.11587 WP_003412229.1.11589 WP_003412229.1.11596 WP_003412229.1.11604 WP_003412229.1.11610 WP_003412229.1.11697 WP_003412229.1.11707 WP_003412229.1.11752 WP_003412229.1.11758 WP_003412229.1.11775 WP_003412229.1.11804 WP_003412229.1.11822 WP_003412229.1.11826 WP_003412229.1.11856 WP_003412229.1.11906 WP_003412229.1.11939 WP_003412229.1.11960 WP_003412229.1.11961 WP_003412229.1.11972 WP_003412229.1.11984 WP_003412229.1.120 WP_003412229.1.12001 WP_003412229.1.12049 WP_003412229.1.12052 WP_003412229.1.12130 WP_003412229.1.12133 WP_003412229.1.12161 WP_003412229.1.12165 WP_003412229.1.12184 WP_003412229.1.12187 WP_003412229.1.12216 WP_003412229.1.12265 WP_003412229.1.12293 WP_003412229.1.123 WP_003412229.1.12314 WP_003412229.1.12327 WP_003412229.1.12338 WP_003412229.1.12371 WP_003412229.1.12372 WP_003412229.1.12389 WP_003412229.1.12406 WP_003412229.1.1241 WP_003412229.1.12421 WP_003412229.1.12424 WP_003412229.1.12446 WP_003412229.1.12464 WP_003412229.1.12479 WP_003412229.1.12519 WP_003412229.1.12523 WP_003412229.1.12526 WP_003412229.1.12550 WP_003412229.1.12551 WP_003412229.1.12563 WP_003412229.1.12611 WP_003412229.1.12669 WP_003412229.1.1267 WP_003412229.1.12672 WP_003412229.1.12710 WP_003412229.1.12768 WP_003412229.1.12794 WP_003412229.1.12801 WP_003412229.1.12821 WP_003412229.1.12841 WP_003412229.1.12854 WP_003412229.1.12871 WP_003412229.1.12901 WP_003412229.1.12941 WP_003412229.1.12972 WP_003412229.1.13028 WP_003412229.1.13043 WP_003412229.1.13086 WP_003412229.1.13087 WP_003412229.1.13163 WP_003412229.1.13183 WP_003412229.1.13249 WP_003412229.1.13282 WP_003412229.1.13296 WP_003412229.1.13298 WP_003412229.1.13302 WP_003412229.1.13312 WP_003412229.1.13313 WP_003412229.1.13321 WP_003412229.1.13345 WP_003412229.1.13358 WP_003412229.1.13370 WP_003412229.1.13375 WP_003412229.1.1338 WP_003412229.1.13420 WP_003412229.1.13433 WP_003412229.1.13435 WP_003412229.1.13438 WP_003412229.1.13466 WP_003412229.1.13489 WP_003412229.1.13526 WP_003412229.1.13551 WP_003412229.1.13561 WP_003412229.1.13579 WP_003412229.1.13647 WP_003412229.1.13687 WP_003412229.1.13719 WP_003412229.1.13763 WP_003412229.1.1377 WP_003412229.1.13774 WP_003412229.1.13786 WP_003412229.1.13793 WP_003412229.1.13794 WP_003412229.1.13817 WP_003412229.1.13880 WP_003412229.1.13899 WP_003412229.1.13909 WP_003412229.1.13953 WP_003412229.1.13962 WP_003412229.1.1398 WP_003412229.1.14027 WP_003412229.1.14115 WP_003412229.1.1415 WP_003412229.1.14152 WP_003412229.1.14175 WP_003412229.1.14194 WP_003412229.1.14195 WP_003412229.1.14238 WP_003412229.1.14273 WP_003412229.1.14306 WP_003412229.1.14307 WP_003412229.1.14310 WP_003412229.1.14341 WP_003412229.1.14382 WP_003412229.1.14428 WP_003412229.1.14441 WP_003412229.1.14469 WP_003412229.1.14477 WP_003412229.1.14504 WP_003412229.1.1452 WP_003412229.1.14527 WP_003412229.1.14544 WP_003412229.1.14551 WP_003412229.1.14561 WP_003412229.1.14573 WP_003412229.1.1462 WP_003412229.1.14658 WP_003412229.1.14668 WP_003412229.1.14675 WP_003412229.1.14694 WP_003412229.1.14695 WP_003412229.1.14709 WP_003412229.1.14766 WP_003412229.1.14783 WP_003412229.1.14865 WP_003412229.1.14872 WP_003412229.1.14905 WP_003412229.1.14926 WP_003412229.1.14955 WP_003412229.1.15003 WP_003412229.1.15009 WP_003412229.1.15040 WP_003412229.1.15065 WP_003412229.1.15089 WP_003412229.1.1509 WP_003412229.1.15126 WP_003412229.1.15131 WP_003412229.1.15172 WP_003412229.1.15174 WP_003412229.1.15187 WP_003412229.1.15196 WP_003412229.1.15217 WP_003412229.1.1523 WP_003412229.1.15253 WP_003412229.1.15267 WP_003412229.1.1527 WP_003412229.1.15292 WP_003412229.1.15302 WP_003412229.1.15322 WP_003412229.1.15345 WP_003412229.1.15372 WP_003412229.1.15386 WP_003412229.1.15442 WP_003412229.1.15447 WP_003412229.1.15449 WP_003412229.1.15477 WP_003412229.1.15511 WP_003412229.1.15558 WP_003412229.1.15559 WP_003412229.1.15566 WP_003412229.1.15599 WP_003412229.1.1560 WP_003412229.1.1563 WP_003412229.1.15633 WP_003412229.1.15643 WP_003412229.1.15755 WP_003412229.1.15763 WP_003412229.1.15774 WP_003412229.1.1578 WP_003412229.1.15780 WP_003412229.1.15827 WP_003412229.1.15848 WP_003412229.1.15870 WP_003412229.1.15877 WP_003412229.1.15893 WP_003412229.1.15896 WP_003412229.1.15926 WP_003412229.1.15933 WP_003412229.1.15973 WP_003412229.1.16009 WP_003412229.1.16043 WP_003412229.1.16055 WP_003412229.1.16066 WP_003412229.1.16077 WP_003412229.1.16108 WP_003412229.1.16110 WP_003412229.1.16130 WP_003412229.1.16136 WP_003412229.1.16139 WP_003412229.1.16141 WP_003412229.1.16143 WP_003412229.1.1630 WP_003412229.1.16318 WP_003412229.1.1632 WP_003412229.1.16327 WP_003412229.1.16334 WP_003412229.1.16374 WP_003412229.1.16384 WP_003412229.1.16386 WP_003412229.1.1642 WP_003412229.1.16421 WP_003412229.1.16424 WP_003412229.1.16426 WP_003412229.1.16431 WP_003412229.1.16438 WP_003412229.1.1644 WP_003412229.1.16442 WP_003412229.1.16448 WP_003412229.1.16451 WP_003412229.1.16476 WP_003412229.1.16494 WP_003412229.1.1652 WP_003412229.1.16609 WP_003412229.1.16620 WP_003412229.1.16622 WP_003412229.1.1669 WP_003412229.1.16707 WP_003412229.1.16724 WP_003412229.1.16731 WP_003412229.1.1683 WP_003412229.1.16837 WP_003412229.1.16937 WP_003412229.1.16940 WP_003412229.1.16959 WP_003412229.1.16968 WP_003412229.1.1697 WP_003412229.1.16973 WP_003412229.1.16977 WP_003412229.1.17006 WP_003412229.1.17010 WP_003412229.1.17039 WP_003412229.1.17041 WP_003412229.1.17057 WP_003412229.1.17062 WP_003412229.1.1707 WP_003412229.1.17130 WP_003412229.1.17138 WP_003412229.1.17167 WP_003412229.1.17224 WP_003412229.1.17251 WP_003412229.1.17304 WP_003412229.1.17314 WP_003412229.1.17345 WP_003412229.1.17381 WP_003412229.1.17391 WP_003412229.1.17412 WP_003412229.1.1743 WP_003412229.1.17440 WP_003412229.1.17466 WP_003412229.1.17477 WP_003412229.1.17483 WP_003412229.1.17505 WP_003412229.1.17527 WP_003412229.1.17535 WP_003412229.1.17553 WP_003412229.1.17635 WP_003412229.1.17679 WP_003412229.1.17687 WP_003412229.1.17713 WP_003412229.1.17722 WP_003412229.1.17746 WP_003412229.1.17788 WP_003412229.1.17803 WP_003412229.1.17816 WP_003412229.1.17821 WP_003412229.1.17868 WP_003412229.1.17923 WP_003412229.1.1795 WP_003412229.1.17955 WP_003412229.1.17973 WP_003412229.1.18009 WP_003412229.1.18013 WP_003412229.1.18033 WP_003412229.1.18057 WP_003412229.1.18065 WP_003412229.1.18070 WP_003412229.1.18120 WP_003412229.1.18126 WP_003412229.1.1817 WP_003412229.1.18170 WP_003412229.1.18240 WP_003412229.1.18257 WP_003412229.1.18297 WP_003412229.1.18306 WP_003412229.1.18364 WP_003412229.1.18399 WP_003412229.1.18411 WP_003412229.1.18444 WP_003412229.1.18448 WP_003412229.1.18467 WP_003412229.1.18582 WP_003412229.1.18587 WP_003412229.1.186 WP_003412229.1.18639 WP_003412229.1.18646 WP_003412229.1.1868 WP_003412229.1.18694 WP_003412229.1.18710 WP_003412229.1.18751 WP_003412229.1.18793 WP_003412229.1.18827 WP_003412229.1.18838 WP_003412229.1.18945 WP_003412229.1.1898 WP_003412229.1.19005 WP_003412229.1.19056 WP_003412229.1.19063 WP_003412229.1.19066 WP_003412229.1.19071 WP_003412229.1.19085 WP_003412229.1.19094 WP_003412229.1.19144 WP_003412229.1.19159 WP_003412229.1.19193 WP_003412229.1.19231 WP_003412229.1.19264 WP_003412229.1.19295 WP_003412229.1.19326 WP_003412229.1.1933 WP_003412229.1.19364 WP_003412229.1.19382 WP_003412229.1.19426 WP_003412229.1.19429 WP_003412229.1.19464 WP_003412229.1.19512 WP_003412229.1.19562 WP_003412229.1.19564 WP_003412229.1.19568 WP_003412229.1.19572 WP_003412229.1.19595 WP_003412229.1.19600 WP_003412229.1.19630 WP_003412229.1.1967 WP_003412229.1.19694 WP_003412229.1.19742 WP_003412229.1.19820 WP_003412229.1.19868 WP_003412229.1.19874 WP_003412229.1.19890 WP_003412229.1.19900 WP_003412229.1.19946 WP_003412229.1.19949 WP_003412229.1.19960 WP_003412229.1.20007 WP_003412229.1.20016 WP_003412229.1.20028 WP_003412229.1.2003 WP_003412229.1.20037 WP_003412229.1.20039 WP_003412229.1.20082 WP_003412229.1.20116 WP_003412229.1.20140 WP_003412229.1.20141 WP_003412229.1.20239 WP_003412229.1.20243 WP_003412229.1.20259 WP_003412229.1.20262 WP_003412229.1.20268 WP_003412229.1.20272 WP_003412229.1.20273 WP_003412229.1.20280 WP_003412229.1.20294 WP_003412229.1.20300 WP_003412229.1.20322 WP_003412229.1.2037 WP_003412229.1.20372 WP_003412229.1.20381 WP_003412229.1.204 WP_003412229.1.20427 WP_003412229.1.20432 WP_003412229.1.20457 WP_003412229.1.20460 WP_003412229.1.20608 WP_003412229.1.20624 WP_003412229.1.20628 WP_003412229.1.2066 WP_003412229.1.20722 WP_003412229.1.20742 WP_003412229.1.2086 WP_003412229.1.20868 WP_003412229.1.20897 WP_003412229.1.20898 WP_003412229.1.2090 WP_003412229.1.20911 WP_003412229.1.20916 WP_003412229.1.20921 WP_003412229.1.20926 WP_003412229.1.20927 WP_003412229.1.20970 WP_003412229.1.2104 WP_003412229.1.21070 WP_003412229.1.21135 WP_003412229.1.21173 WP_003412229.1.21187 WP_003412229.1.2120 WP_003412229.1.21218 WP_003412229.1.2123 WP_003412229.1.21234 WP_003412229.1.2126 WP_003412229.1.21292 WP_003412229.1.21307 WP_003412229.1.21311 WP_003412229.1.21321 WP_003412229.1.21365 WP_003412229.1.2137 WP_003412229.1.21392 WP_003412229.1.21397 WP_003412229.1.21415 WP_003412229.1.21418 WP_003412229.1.21430 WP_003412229.1.21434 WP_003412229.1.21444 WP_003412229.1.21509 WP_003412229.1.21560 WP_003412229.1.21586 WP_003412229.1.21591 WP_003412229.1.21594 WP_003412229.1.21615 WP_003412229.1.21655 WP_003412229.1.21658 WP_003412229.1.2168 WP_003412229.1.2174 WP_003412229.1.21741 WP_003412229.1.21742 WP_003412229.1.21786 WP_003412229.1.21795 WP_003412229.1.218 WP_003412229.1.21829 WP_003412229.1.21840 WP_003412229.1.21843 WP_003412229.1.21872 WP_003412229.1.21873 WP_003412229.1.2188 WP_003412229.1.21882 WP_003412229.1.21906 WP_003412229.1.21912 WP_003412229.1.21941 WP_003412229.1.21960 WP_003412229.1.21971 WP_003412229.1.22025 WP_003412229.1.22036 WP_003412229.1.22092 WP_003412229.1.22127 WP_003412229.1.22140 WP_003412229.1.22233 WP_003412229.1.22255 WP_003412229.1.22305 WP_003412229.1.22348 WP_003412229.1.22356 WP_003412229.1.2238 WP_003412229.1.22437 WP_003412229.1.22445 WP_003412229.1.22490 WP_003412229.1.22511 WP_003412229.1.22524 WP_003412229.1.2253 WP_003412229.1.22585 WP_003412229.1.22589 WP_003412229.1.22606 WP_003412229.1.22608 WP_003412229.1.22618 WP_003412229.1.2262 WP_003412229.1.22629 WP_003412229.1.22647 WP_003412229.1.22664 WP_003412229.1.22674 WP_003412229.1.22680 WP_003412229.1.22725 WP_003412229.1.22728 WP_003412229.1.22733 WP_003412229.1.22737 WP_003412229.1.2275 WP_003412229.1.22797 WP_003412229.1.22800 WP_003412229.1.22829 WP_003412229.1.22840 WP_003412229.1.22844 WP_003412229.1.22963 WP_003412229.1.22997 WP_003412229.1.22999 WP_003412229.1.23015 WP_003412229.1.231 WP_003412229.1.23101 WP_003412229.1.23140 WP_003412229.1.23153 WP_003412229.1.23171 WP_003412229.1.23199 WP_003412229.1.2320 WP_003412229.1.23216 WP_003412229.1.23233 WP_003412229.1.23261 WP_003412229.1.23272 WP_003412229.1.23289 WP_003412229.1.2329 WP_003412229.1.23308 WP_003412229.1.23316 WP_003412229.1.23321 WP_003412229.1.23325 WP_003412229.1.2339 WP_003412229.1.23406 WP_003412229.1.23438 WP_003412229.1.23445 WP_003412229.1.23447 WP_003412229.1.23452 WP_003412229.1.23461 WP_003412229.1.23497 WP_003412229.1.23506 WP_003412229.1.23530 WP_003412229.1.23539 WP_003412229.1.23546 WP_003412229.1.23573 WP_003412229.1.23588 WP_003412229.1.23628 WP_003412229.1.23683 WP_003412229.1.23699 WP_003412229.1.23803 WP_003412229.1.23832 WP_003412229.1.2384 WP_003412229.1.23863 WP_003412229.1.2387 WP_003412229.1.23894 WP_003412229.1.23993 WP_003412229.1.24007 WP_003412229.1.24008 WP_003412229.1.24046 WP_003412229.1.24057 WP_003412229.1.24062 WP_003412229.1.24119 WP_003412229.1.24128 WP_003412229.1.24140 WP_003412229.1.24202 WP_003412229.1.24244 WP_003412229.1.24261 WP_003412229.1.24284 WP_003412229.1.24396 WP_003412229.1.24414 WP_003412229.1.24423 WP_003412229.1.2443 WP_003412229.1.24446 WP_003412229.1.24500 WP_003412229.1.24507 WP_003412229.1.24509 WP_003412229.1.24553 WP_003412229.1.24629 WP_003412229.1.24638 WP_003412229.1.24648 WP_003412229.1.2466 WP_003412229.1.24767 WP_003412229.1.24824 WP_003412229.1.24831 WP_003412229.1.24840 WP_003412229.1.24848 WP_003412229.1.24857 WP_003412229.1.2487 WP_003412229.1.24893 WP_003412229.1.24907 WP_003412229.1.24958 WP_003412229.1.24985 WP_003412229.1.2499 WP_003412229.1.25004 WP_003412229.1.2505 WP_003412229.1.2507 WP_003412229.1.25096 WP_003412229.1.25103 WP_003412229.1.25129 WP_003412229.1.25171 WP_003412229.1.25247 WP_003412229.1.25252 WP_003412229.1.25278 WP_003412229.1.25283 WP_003412229.1.25313 WP_003412229.1.25338 WP_003412229.1.25342 WP_003412229.1.25343 WP_003412229.1.25406 WP_003412229.1.25435 WP_003412229.1.25437 WP_003412229.1.25445 WP_003412229.1.25473 WP_003412229.1.25504 WP_003412229.1.25513 WP_003412229.1.25542 WP_003412229.1.25579 WP_003412229.1.25594 WP_003412229.1.25606 WP_003412229.1.25645 WP_003412229.1.25674 WP_003412229.1.25693 WP_003412229.1.25699 WP_003412229.1.25727 WP_003412229.1.25736 WP_003412229.1.25756 WP_003412229.1.25759 WP_003412229.1.2580 WP_003412229.1.25813 WP_003412229.1.25853 WP_003412229.1.25854 WP_003412229.1.25874 WP_003412229.1.25885 WP_003412229.1.25892 WP_003412229.1.25914 WP_003412229.1.25916 WP_003412229.1.25954 WP_003412229.1.25965 WP_003412229.1.25972 WP_003412229.1.26017 WP_003412229.1.26032 WP_003412229.1.26072 WP_003412229.1.26089 WP_003412229.1.26097 WP_003412229.1.26098 WP_003412229.1.26108 WP_003412229.1.26126 WP_003412229.1.2614 WP_003412229.1.26168 WP_003412229.1.26182 WP_003412229.1.26190 WP_003412229.1.2620 WP_003412229.1.26234 WP_003412229.1.26243 WP_003412229.1.26265 WP_003412229.1.26267 WP_003412229.1.26310 WP_003412229.1.26349 WP_003412229.1.26366 WP_003412229.1.26374 WP_003412229.1.26407 WP_003412229.1.26412 WP_003412229.1.26454 WP_003412229.1.26464 WP_003412229.1.2653 WP_003412229.1.26560 WP_003412229.1.2659 WP_003412229.1.26603 WP_003412229.1.26629 WP_003412229.1.26651 WP_003412229.1.26707 WP_003412229.1.26710 WP_003412229.1.26719 WP_003412229.1.26738 WP_003412229.1.26745 WP_003412229.1.26756 WP_003412229.1.2676 WP_003412229.1.2677 WP_003412229.1.26780 WP_003412229.1.26798 WP_003412229.1.26854 WP_003412229.1.26868 WP_003412229.1.26876 WP_003412229.1.26914 WP_003412229.1.26959 WP_003412229.1.26969 WP_003412229.1.26984 WP_003412229.1.27004 WP_003412229.1.27017 WP_003412229.1.27045 WP_003412229.1.27074 WP_003412229.1.27075 WP_003412229.1.27128 WP_003412229.1.27130 WP_003412229.1.27139 WP_003412229.1.27152 WP_003412229.1.27162 WP_003412229.1.27164 WP_003412229.1.27193 WP_003412229.1.27235 WP_003412229.1.27254 WP_003412229.1.27278 WP_003412229.1.27352 WP_003412229.1.27369 WP_003412229.1.27391 WP_003412229.1.27398 WP_003412229.1.27402 WP_003412229.1.27410 WP_003412229.1.27411 WP_003412229.1.27449 WP_003412229.1.27463 WP_003412229.1.2749 WP_003412229.1.27492 WP_003412229.1.27528 WP_003412229.1.27541 WP_003412229.1.27582 WP_003412229.1.27596 WP_003412229.1.27607 WP_003412229.1.2766 WP_003412229.1.27724 WP_003412229.1.27730 WP_003412229.1.27736 WP_003412229.1.27743 WP_003412229.1.27771 WP_003412229.1.27779 WP_003412229.1.27803 WP_003412229.1.27819 WP_003412229.1.27835 WP_003412229.1.27915 WP_003412229.1.27935 WP_003412229.1.27962 WP_003412229.1.28053 WP_003412229.1.28106 WP_003412229.1.28142 WP_003412229.1.2816 WP_003412229.1.28161 WP_003412229.1.28192 WP_003412229.1.28202 WP_003412229.1.28241 WP_003412229.1.28242 WP_003412229.1.28251 WP_003412229.1.28255 WP_003412229.1.28269 WP_003412229.1.28276 WP_003412229.1.28293 WP_003412229.1.28331 WP_003412229.1.28391 WP_003412229.1.2842 WP_003412229.1.28448 WP_003412229.1.2847 WP_003412229.1.28471 WP_003412229.1.28473 WP_003412229.1.28561 WP_003412229.1.28610 WP_003412229.1.28634 WP_003412229.1.28642 WP_003412229.1.28671 WP_003412229.1.28682 WP_003412229.1.28703 WP_003412229.1.28739 WP_003412229.1.28758 WP_003412229.1.28781 WP_003412229.1.28850 WP_003412229.1.28914 WP_003412229.1.28935 WP_003412229.1.28936 WP_003412229.1.28939 WP_003412229.1.28943 WP_003412229.1.28952 WP_003412229.1.28975 WP_003412229.1.2899 WP_003412229.1.28993 WP_003412229.1.29000 WP_003412229.1.2901 WP_003412229.1.29028 WP_003412229.1.29078 WP_003412229.1.29102 WP_003412229.1.29217 WP_003412229.1.29223 WP_003412229.1.29234 WP_003412229.1.29275 WP_003412229.1.29339 WP_003412229.1.29348 WP_003412229.1.29367 WP_003412229.1.2938 WP_003412229.1.29399 WP_003412229.1.29426 WP_003412229.1.29449 WP_003412229.1.29450 WP_003412229.1.29452 WP_003412229.1.2949 WP_003412229.1.29510 WP_003412229.1.29515 WP_003412229.1.2953 WP_003412229.1.29559 WP_003412229.1.29592 WP_003412229.1.29599 WP_003412229.1.29611 WP_003412229.1.29632 WP_003412229.1.29649 WP_003412229.1.2965 WP_003412229.1.29659 WP_003412229.1.2969 WP_003412229.1.29696 WP_003412229.1.29698 WP_003412229.1.29718 WP_003412229.1.29742 WP_003412229.1.29769 WP_003412229.1.29825 WP_003412229.1.29847 WP_003412229.1.29883 WP_003412229.1.29890 WP_003412229.1.299 WP_003412229.1.29960 WP_003412229.1.30014 WP_003412229.1.3004 WP_003412229.1.30040 WP_003412229.1.30074 WP_003412229.1.30097 WP_003412229.1.30101 WP_003412229.1.30106 WP_003412229.1.30114 WP_003412229.1.30126 WP_003412229.1.30131 WP_003412229.1.30138 WP_003412229.1.30139 WP_003412229.1.30145 WP_003412229.1.30211 WP_003412229.1.30224 WP_003412229.1.3027 WP_003412229.1.30279 WP_003412229.1.30282 WP_003412229.1.30283 WP_003412229.1.30288 WP_003412229.1.30291 WP_003412229.1.30363 WP_003412229.1.30374 WP_003412229.1.30404 WP_003412229.1.3043 WP_003412229.1.30433 WP_003412229.1.30462 WP_003412229.1.30464 WP_003412229.1.30468 WP_003412229.1.30500 WP_003412229.1.30574 WP_003412229.1.30628 WP_003412229.1.30641 WP_003412229.1.30642 WP_003412229.1.30661 WP_003412229.1.30669 WP_003412229.1.30683 WP_003412229.1.30699 WP_003412229.1.30730 WP_003412229.1.30732 WP_003412229.1.30736 WP_003412229.1.30745 WP_003412229.1.30760 WP_003412229.1.30791 WP_003412229.1.308 WP_003412229.1.30824 WP_003412229.1.30848 WP_003412229.1.30877 WP_003412229.1.30888 WP_003412229.1.30901 WP_003412229.1.30903 WP_003412229.1.30912 WP_003412229.1.30913 WP_003412229.1.30914 WP_003412229.1.30919 WP_003412229.1.3100 WP_003412229.1.3101 WP_003412229.1.31034 WP_003412229.1.31047 WP_003412229.1.31070 WP_003412229.1.31102 WP_003412229.1.31184 WP_003412229.1.31226 WP_003412229.1.31233 WP_003412229.1.31270 WP_003412229.1.31287 WP_003412229.1.31290 WP_003412229.1.31304 WP_003412229.1.31346 WP_003412229.1.31348 WP_003412229.1.31354 WP_003412229.1.31428 WP_003412229.1.31458 WP_003412229.1.3149 WP_003412229.1.31498 WP_003412229.1.31507 WP_003412229.1.31537 WP_003412229.1.31548 WP_003412229.1.31569 WP_003412229.1.31573 WP_003412229.1.316 WP_003412229.1.31629 WP_003412229.1.31744 WP_003412229.1.31776 WP_003412229.1.31783 WP_003412229.1.318 WP_003412229.1.3184 WP_003412229.1.31840 WP_003412229.1.31880 WP_003412229.1.31911 WP_003412229.1.31955 WP_003412229.1.31991 WP_003412229.1.32004 WP_003412229.1.32039 WP_003412229.1.3204 WP_003412229.1.32045 WP_003412229.1.32071 WP_003412229.1.32132 WP_003412229.1.32157 WP_003412229.1.32164 WP_003412229.1.32179 WP_003412229.1.32317 WP_003412229.1.32383 WP_003412229.1.32400 WP_003412229.1.32403 WP_003412229.1.32416 WP_003412229.1.32421 WP_003412229.1.32461 WP_003412229.1.32482 WP_003412229.1.32503 WP_003412229.1.32562 WP_003412229.1.32569 WP_003412229.1.32592 WP_003412229.1.32647 WP_003412229.1.32653 WP_003412229.1.32654 WP_003412229.1.3268 WP_003412229.1.32695 WP_003412229.1.32706 WP_003412229.1.32716 WP_003412229.1.32752 WP_003412229.1.32780 WP_003412229.1.32781 WP_003412229.1.32793 WP_003412229.1.32799 WP_003412229.1.32822 WP_003412229.1.32833 WP_003412229.1.32862 WP_003412229.1.32880 WP_003412229.1.32897 WP_003412229.1.32909 WP_003412229.1.32974 WP_003412229.1.33007 WP_003412229.1.3302 WP_003412229.1.33028 WP_003412229.1.33035 WP_003412229.1.33044 WP_003412229.1.33054 WP_003412229.1.33082 WP_003412229.1.33141 WP_003412229.1.33148 WP_003412229.1.33155 WP_003412229.1.33168 WP_003412229.1.3321 WP_003412229.1.33215 WP_003412229.1.3325 WP_003412229.1.33278 WP_003412229.1.33288 WP_003412229.1.33305 WP_003412229.1.3331 WP_003412229.1.3333 WP_003412229.1.33393 WP_003412229.1.33403 WP_003412229.1.33452 WP_003412229.1.33467 WP_003412229.1.3349 WP_003412229.1.33519 WP_003412229.1.33542 WP_003412229.1.33601 WP_003412229.1.33633 WP_003412229.1.33646 WP_003412229.1.33673 WP_003412229.1.3369 WP_003412229.1.33705 WP_003412229.1.33762 WP_003412229.1.33783 WP_003412229.1.33789 WP_003412229.1.3383 WP_003412229.1.33832 WP_003412229.1.33839 WP_003412229.1.33848 WP_003412229.1.3387 WP_003412229.1.33886 WP_003412229.1.33906 WP_003412229.1.33912 WP_003412229.1.33954 WP_003412229.1.3399 WP_003412229.1.34042 WP_003412229.1.3405 WP_003412229.1.34055 WP_003412229.1.34056 WP_003412229.1.34065 WP_003412229.1.3408 WP_003412229.1.34090 WP_003412229.1.34109 WP_003412229.1.34111 WP_003412229.1.34131 WP_003412229.1.34152 WP_003412229.1.34153 WP_003412229.1.34163 WP_003412229.1.34181 WP_003412229.1.34197 WP_003412229.1.34198 WP_003412229.1.34219 WP_003412229.1.34255 WP_003412229.1.34260 WP_003412229.1.34275 WP_003412229.1.343 WP_003412229.1.34358 WP_003412229.1.344 WP_003412229.1.34428 WP_003412229.1.3443 WP_003412229.1.34435 WP_003412229.1.34446 WP_003412229.1.34505 WP_003412229.1.34516 WP_003412229.1.34529 WP_003412229.1.34551 WP_003412229.1.34563 WP_003412229.1.34576 WP_003412229.1.34588 WP_003412229.1.34599 WP_003412229.1.34639 WP_003412229.1.34673 WP_003412229.1.34740 WP_003412229.1.34755 WP_003412229.1.34783 WP_003412229.1.34908 WP_003412229.1.3492 WP_003412229.1.34933 WP_003412229.1.34946 WP_003412229.1.34954 WP_003412229.1.34961 WP_003412229.1.34963 WP_003412229.1.34968 WP_003412229.1.35023 WP_003412229.1.35069 WP_003412229.1.35072 WP_003412229.1.35078 WP_003412229.1.35100 WP_003412229.1.35146 WP_003412229.1.35156 WP_003412229.1.35160 WP_003412229.1.35162 WP_003412229.1.35173 WP_003412229.1.3520 WP_003412229.1.35213 WP_003412229.1.35246 WP_003412229.1.35278 WP_003412229.1.35301 WP_003412229.1.35311 WP_003412229.1.35312 WP_003412229.1.35319 WP_003412229.1.35347 WP_003412229.1.35363 WP_003412229.1.35385 WP_003412229.1.35396 WP_003412229.1.35397 WP_003412229.1.35426 WP_003412229.1.35439 WP_003412229.1.35455 WP_003412229.1.35484 WP_003412229.1.35492 WP_003412229.1.3553 WP_003412229.1.35555 WP_003412229.1.35561 WP_003412229.1.35602 WP_003412229.1.35610 WP_003412229.1.35657 WP_003412229.1.35680 WP_003412229.1.35689 WP_003412229.1.35767 WP_003412229.1.35770 WP_003412229.1.35780 WP_003412229.1.35805 WP_003412229.1.35811 WP_003412229.1.35821 WP_003412229.1.3584 WP_003412229.1.35864 WP_003412229.1.35874 WP_003412229.1.35876 WP_003412229.1.35897 WP_003412229.1.35923 WP_003412229.1.3593 WP_003412229.1.36005 WP_003412229.1.36023 WP_003412229.1.36051 WP_003412229.1.36053 WP_003412229.1.36089 WP_003412229.1.36097 WP_003412229.1.36116 WP_003412229.1.36145 WP_003412229.1.36156 WP_003412229.1.36228 WP_003412229.1.36246 WP_003412229.1.36252 WP_003412229.1.36260 WP_003412229.1.36270 WP_003412229.1.36271 WP_003412229.1.36303 WP_003412229.1.36309 WP_003412229.1.36315 WP_003412229.1.36321 WP_003412229.1.36326 WP_003412229.1.3634 WP_003412229.1.36357 WP_003412229.1.3636 WP_003412229.1.36436 WP_003412229.1.36465 WP_003412229.1.36469 WP_003412229.1.36473 WP_003412229.1.36485 WP_003412229.1.36508 WP_003412229.1.36561 WP_003412229.1.36573 WP_003412229.1.36585 WP_003412229.1.36597 WP_003412229.1.36614 WP_003412229.1.36657 WP_003412229.1.36674 WP_003412229.1.36720 WP_003412229.1.36785 WP_003412229.1.36810 WP_003412229.1.36844 WP_003412229.1.36851 WP_003412229.1.36862 WP_003412229.1.36901 WP_003412229.1.36921 WP_003412229.1.36935 WP_003412229.1.36941 WP_003412229.1.3695 WP_003412229.1.36951 WP_003412229.1.37004 WP_003412229.1.37012 WP_003412229.1.37071 WP_003412229.1.37088 WP_003412229.1.37131 WP_003412229.1.37157 WP_003412229.1.37188 WP_003412229.1.37213 WP_003412229.1.3724 WP_003412229.1.37277 WP_003412229.1.37305 WP_003412229.1.37330 WP_003412229.1.37440 WP_003412229.1.37468 WP_003412229.1.37601 WP_003412229.1.37612 WP_003412229.1.37632 WP_003412229.1.37643 WP_003412229.1.37655 WP_003412229.1.37674 WP_003412229.1.37700 WP_003412229.1.37701 WP_003412229.1.37709 WP_003412229.1.37711 WP_003412229.1.37747 WP_003412229.1.37765 WP_003412229.1.37772 WP_003412229.1.37804 WP_003412229.1.37859 WP_003412229.1.37877 WP_003412229.1.37912 WP_003412229.1.37913 WP_003412229.1.37950 WP_003412229.1.37983 WP_003412229.1.38002 WP_003412229.1.3802 WP_003412229.1.38039 WP_003412229.1.38040 WP_003412229.1.38067 WP_003412229.1.38135 WP_003412229.1.38138 WP_003412229.1.38144 WP_003412229.1.38159 WP_003412229.1.38210 WP_003412229.1.38233 WP_003412229.1.38240 WP_003412229.1.38299 WP_003412229.1.38347 WP_003412229.1.38354 WP_003412229.1.38380 WP_003412229.1.38384 WP_003412229.1.38389 WP_003412229.1.38402 WP_003412229.1.38466 WP_003412229.1.38477 WP_003412229.1.38483 WP_003412229.1.3849 WP_003412229.1.38535 WP_003412229.1.38539 WP_003412229.1.38611 WP_003412229.1.38638 WP_003412229.1.38639 WP_003412229.1.38646 WP_003412229.1.38648 WP_003412229.1.38654 WP_003412229.1.38659 WP_003412229.1.38666 WP_003412229.1.38671 WP_003412229.1.38677 WP_003412229.1.38750 WP_003412229.1.38812 WP_003412229.1.38844 WP_003412229.1.38863 WP_003412229.1.38865 WP_003412229.1.38873 WP_003412229.1.38894 WP_003412229.1.38909 WP_003412229.1.38939 WP_003412229.1.38974 WP_003412229.1.38975 WP_003412229.1.39025 WP_003412229.1.39070 WP_003412229.1.39072 WP_003412229.1.39095 WP_003412229.1.39106 WP_003412229.1.39165 WP_003412229.1.39174 WP_003412229.1.39176 WP_003412229.1.39178 WP_003412229.1.39201 WP_003412229.1.39207 WP_003412229.1.39211 WP_003412229.1.39239 WP_003412229.1.39252 WP_003412229.1.39288 WP_003412229.1.39359 WP_003412229.1.39364 WP_003412229.1.39447 WP_003412229.1.3945 WP_003412229.1.39455 WP_003412229.1.3949 WP_003412229.1.39560 WP_003412229.1.39592 WP_003412229.1.39593 WP_003412229.1.396 WP_003412229.1.3960 WP_003412229.1.39654 WP_003412229.1.39657 WP_003412229.1.39661 WP_003412229.1.39674 WP_003412229.1.39678 WP_003412229.1.3968 WP_003412229.1.39694 WP_003412229.1.3971 WP_003412229.1.39718 WP_003412229.1.39728 WP_003412229.1.39739 WP_003412229.1.39748 WP_003412229.1.39751 WP_003412229.1.39801 WP_003412229.1.39804 WP_003412229.1.39877 WP_003412229.1.39925 WP_003412229.1.3996 WP_003412229.1.39980 WP_003412229.1.40000 WP_003412229.1.40028 WP_003412229.1.40029 WP_003412229.1.4003 WP_003412229.1.40094 WP_003412229.1.40096 WP_003412229.1.40156 WP_003412229.1.40174 WP_003412229.1.40276 WP_003412229.1.40353 WP_003412229.1.40372 WP_003412229.1.40440 WP_003412229.1.40446 WP_003412229.1.40451 WP_003412229.1.40455 WP_003412229.1.40523 WP_003412229.1.40543 WP_003412229.1.40641 WP_003412229.1.40651 WP_003412229.1.40653 WP_003412229.1.4067 WP_003412229.1.40705 WP_003412229.1.40731 WP_003412229.1.40735 WP_003412229.1.40795 WP_003412229.1.40799 WP_003412229.1.40852 WP_003412229.1.40881 WP_003412229.1.40922 WP_003412229.1.40948 WP_003412229.1.4095 WP_003412229.1.40956 WP_003412229.1.40957 WP_003412229.1.40964 WP_003412229.1.4097 WP_003412229.1.410 WP_003412229.1.41000 WP_003412229.1.41055 WP_003412229.1.41108 WP_003412229.1.41123 WP_003412229.1.41177 WP_003412229.1.41219 WP_003412229.1.41249 WP_003412229.1.4127 WP_003412229.1.41296 WP_003412229.1.41355 WP_003412229.1.41376 WP_003412229.1.41430 WP_003412229.1.41553 WP_003412229.1.41583 WP_003412229.1.41616 WP_003412229.1.41636 WP_003412229.1.41648 WP_003412229.1.41660 WP_003412229.1.41685 WP_003412229.1.41695 WP_003412229.1.41704 WP_003412229.1.4171 WP_003412229.1.41719 WP_003412229.1.41733 WP_003412229.1.41774 WP_003412229.1.41803 WP_003412229.1.41820 WP_003412229.1.41828 WP_003412229.1.41860 WP_003412229.1.41912 WP_003412229.1.41933 WP_003412229.1.41944 WP_003412229.1.42075 WP_003412229.1.42078 WP_003412229.1.42094 WP_003412229.1.42112 WP_003412229.1.4212 WP_003412229.1.42183 WP_003412229.1.42188 WP_003412229.1.42201 WP_003412229.1.42202 WP_003412229.1.42208 WP_003412229.1.42247 WP_003412229.1.42255 WP_003412229.1.42273 WP_003412229.1.42278 WP_003412229.1.42304 WP_003412229.1.42309 WP_003412229.1.42370 WP_003412229.1.42385 WP_003412229.1.42400 WP_003412229.1.42414 WP_003412229.1.42417 WP_003412229.1.42430 WP_003412229.1.42461 WP_003412229.1.42465 WP_003412229.1.42473 WP_003412229.1.42474 WP_003412229.1.4248 WP_003412229.1.42519 WP_003412229.1.42534 WP_003412229.1.4255 WP_003412229.1.42562 WP_003412229.1.42568 WP_003412229.1.42570 WP_003412229.1.42618 WP_003412229.1.42660 WP_003412229.1.42695 WP_003412229.1.42777 WP_003412229.1.42782 WP_003412229.1.42835 WP_003412229.1.42839 WP_003412229.1.42916 WP_003412229.1.42930 WP_003412229.1.42971 WP_003412229.1.43082 WP_003412229.1.43087 WP_003412229.1.43098 WP_003412229.1.43208 WP_003412229.1.43236 WP_003412229.1.43246 WP_003412229.1.43255 WP_003412229.1.43266 WP_003412229.1.43269 WP_003412229.1.43306 WP_003412229.1.4335 WP_003412229.1.43368 WP_003412229.1.43395 WP_003412229.1.43457 WP_003412229.1.43462 WP_003412229.1.43478 WP_003412229.1.43484 WP_003412229.1.43557 WP_003412229.1.43578 WP_003412229.1.43588 WP_003412229.1.43643 WP_003412229.1.43664 WP_003412229.1.43684 WP_003412229.1.43686 WP_003412229.1.43706 WP_003412229.1.43716 WP_003412229.1.43781 WP_003412229.1.43794 WP_003412229.1.43846 WP_003412229.1.43861 WP_003412229.1.43863 WP_003412229.1.43866 WP_003412229.1.43885 WP_003412229.1.43902 WP_003412229.1.43936 WP_003412229.1.43937 WP_003412229.1.43965 WP_003412229.1.4399 WP_003412229.1.43993 WP_003412229.1.43996 WP_003412229.1.44008 WP_003412229.1.44016 WP_003412229.1.44037 WP_003412229.1.44041 WP_003412229.1.44070 WP_003412229.1.44071 WP_003412229.1.44104 WP_003412229.1.44111 WP_003412229.1.44124 WP_003412229.1.44219 WP_003412229.1.44237 WP_003412229.1.44279 WP_003412229.1.44336 WP_003412229.1.44358 WP_003412229.1.4438 WP_003412229.1.44390 WP_003412229.1.44392 WP_003412229.1.4441 WP_003412229.1.44415 WP_003412229.1.44464 WP_003412229.1.44466 WP_003412229.1.44489 WP_003412229.1.44492 WP_003412229.1.44494 WP_003412229.1.44500 WP_003412229.1.44519 WP_003412229.1.44526 WP_003412229.1.44534 WP_003412229.1.44589 WP_003412229.1.44597 WP_003412229.1.44600 WP_003412229.1.44615 WP_003412229.1.44665 WP_003412229.1.44700 WP_003412229.1.44713 WP_003412229.1.44735 WP_003412229.1.44740 WP_003412229.1.44757 WP_003412229.1.44761 WP_003412229.1.44767 WP_003412229.1.44779 WP_003412229.1.44786 WP_003412229.1.44808 WP_003412229.1.44864 WP_003412229.1.44901 WP_003412229.1.44908 WP_003412229.1.44939 WP_003412229.1.45011 WP_003412229.1.4504 WP_003412229.1.45066 WP_003412229.1.45113 WP_003412229.1.45135 WP_003412229.1.45147 WP_003412229.1.45168 WP_003412229.1.4517 WP_003412229.1.45181 WP_003412229.1.45185 WP_003412229.1.45192 WP_003412229.1.45200 WP_003412229.1.45205 WP_003412229.1.45249 WP_003412229.1.4526 WP_003412229.1.45286 WP_003412229.1.45347 WP_003412229.1.45390 WP_003412229.1.454 WP_003412229.1.45453 WP_003412229.1.45460 WP_003412229.1.45463 WP_003412229.1.45470 WP_003412229.1.45491 WP_003412229.1.45563 WP_003412229.1.45590 WP_003412229.1.45666 WP_003412229.1.45697 WP_003412229.1.45731 WP_003412229.1.45743 WP_003412229.1.45765 WP_003412229.1.45776 WP_003412229.1.45783 WP_003412229.1.45815 WP_003412229.1.45849 WP_003412229.1.45867 WP_003412229.1.45884 WP_003412229.1.4590 WP_003412229.1.45923 WP_003412229.1.45926 WP_003412229.1.45989 WP_003412229.1.45992 WP_003412229.1.46025 WP_003412229.1.46090 WP_003412229.1.46100 WP_003412229.1.46101 WP_003412229.1.46103 WP_003412229.1.46107 WP_003412229.1.46127 WP_003412229.1.46128 WP_003412229.1.46141 WP_003412229.1.46150 WP_003412229.1.46201 WP_003412229.1.46226 WP_003412229.1.46253 WP_003412229.1.46268 WP_003412229.1.46285 WP_003412229.1.46300 WP_003412229.1.46313 WP_003412229.1.46365 WP_003412229.1.46370 WP_003412229.1.46381 WP_003412229.1.46402 WP_003412229.1.4644 WP_003412229.1.46453 WP_003412229.1.46463 WP_003412229.1.46492 WP_003412229.1.46521 WP_003412229.1.4653 WP_003412229.1.46532 WP_003412229.1.46539 WP_003412229.1.46585 WP_003412229.1.46609 WP_003412229.1.46613 WP_003412229.1.46674 WP_003412229.1.46724 WP_003412229.1.46758 WP_003412229.1.46773 WP_003412229.1.46777 WP_003412229.1.46786 WP_003412229.1.46847 WP_003412229.1.46851 WP_003412229.1.4687 WP_003412229.1.46897 WP_003412229.1.46936 WP_003412229.1.47011 WP_003412229.1.47012 WP_003412229.1.47077 WP_003412229.1.47083 WP_003412229.1.47106 WP_003412229.1.47142 WP_003412229.1.47166 WP_003412229.1.47178 WP_003412229.1.47179 WP_003412229.1.47207 WP_003412229.1.47210 WP_003412229.1.47261 WP_003412229.1.47262 WP_003412229.1.47402 WP_003412229.1.47423 WP_003412229.1.47467 WP_003412229.1.47502 WP_003412229.1.4751 WP_003412229.1.47511 WP_003412229.1.47537 WP_003412229.1.47568 WP_003412229.1.47588 WP_003412229.1.4764 WP_003412229.1.47653 WP_003412229.1.47681 WP_003412229.1.47690 WP_003412229.1.4771 WP_003412229.1.47717 WP_003412229.1.47743 WP_003412229.1.47754 WP_003412229.1.47773 WP_003412229.1.47776 WP_003412229.1.47780 WP_003412229.1.47847 WP_003412229.1.47858 WP_003412229.1.47861 WP_003412229.1.47868 WP_003412229.1.47893 WP_003412229.1.479 WP_003412229.1.47913 WP_003412229.1.4794 WP_003412229.1.47943 WP_003412229.1.47944 WP_003412229.1.47959 WP_003412229.1.48004 WP_003412229.1.48039 WP_003412229.1.48050 WP_003412229.1.48084 WP_003412229.1.48097 WP_003412229.1.48101 WP_003412229.1.48109 WP_003412229.1.4813 WP_003412229.1.48135 WP_003412229.1.48152 WP_003412229.1.48173 WP_003412229.1.48177 WP_003412229.1.48204 WP_003412229.1.48219 WP_003412229.1.4823 WP_003412229.1.48240 WP_003412229.1.48330 WP_003412229.1.48348 WP_003412229.1.48354 WP_003412229.1.48372 WP_003412229.1.48383 WP_003412229.1.48388 WP_003412229.1.48419 WP_003412229.1.48423 WP_003412229.1.48450 WP_003412229.1.48462 WP_003412229.1.48543 WP_003412229.1.48550 WP_003412229.1.48605 WP_003412229.1.48618 WP_003412229.1.4863 WP_003412229.1.48648 WP_003412229.1.48779 WP_003412229.1.48798 WP_003412229.1.48802 WP_003412229.1.48826 WP_003412229.1.48831 WP_003412229.1.48843 WP_003412229.1.48857 WP_003412229.1.48979 WP_003412229.1.49017 WP_003412229.1.49048 WP_003412229.1.49059 WP_003412229.1.4906 WP_003412229.1.4907 WP_003412229.1.49103 WP_003412229.1.49110 WP_003412229.1.49111 WP_003412229.1.49112 WP_003412229.1.49254 WP_003412229.1.49263 WP_003412229.1.49296 WP_003412229.1.49337 WP_003412229.1.49419 WP_003412229.1.49426 WP_003412229.1.49439 WP_003412229.1.49474 WP_003412229.1.49516 WP_003412229.1.49523 WP_003412229.1.49526 WP_003412229.1.49532 WP_003412229.1.49588 WP_003412229.1.49678 WP_003412229.1.49709 WP_003412229.1.4971 WP_003412229.1.4972 WP_003412229.1.49736 WP_003412229.1.49746 WP_003412229.1.49764 WP_003412229.1.49773 WP_003412229.1.49814 WP_003412229.1.49815 WP_003412229.1.49816 WP_003412229.1.49839 WP_003412229.1.49857 WP_003412229.1.49878 WP_003412229.1.49880 WP_003412229.1.49944 WP_003412229.1.49990 WP_003412229.1.50077 WP_003412229.1.50081 WP_003412229.1.50122 WP_003412229.1.50149 WP_003412229.1.5018 WP_003412229.1.50235 WP_003412229.1.50249 WP_003412229.1.50271 WP_003412229.1.50324 WP_003412229.1.50372 WP_003412229.1.50398 WP_003412229.1.50407 WP_003412229.1.50444 WP_003412229.1.50466 WP_003412229.1.50472 WP_003412229.1.50498 WP_003412229.1.5050 WP_003412229.1.50540 WP_003412229.1.50554 WP_003412229.1.50557 WP_003412229.1.50601 WP_003412229.1.50610 WP_003412229.1.50633 WP_003412229.1.50642 WP_003412229.1.50683 WP_003412229.1.50689 WP_003412229.1.50692 WP_003412229.1.50714 WP_003412229.1.50729 WP_003412229.1.50794 WP_003412229.1.50841 WP_003412229.1.50877 WP_003412229.1.5096 WP_003412229.1.50981 WP_003412229.1.50987 WP_003412229.1.51003 WP_003412229.1.51082 WP_003412229.1.51101 WP_003412229.1.51116 WP_003412229.1.51149 WP_003412229.1.51156 WP_003412229.1.51157 WP_003412229.1.51213 WP_003412229.1.51232 WP_003412229.1.51239 WP_003412229.1.51247 WP_003412229.1.51266 WP_003412229.1.51279 WP_003412229.1.51291 WP_003412229.1.51294 WP_003412229.1.51301 WP_003412229.1.51391 WP_003412229.1.51422 WP_003412229.1.51468 WP_003412229.1.51478 WP_003412229.1.51497 WP_003412229.1.51520 WP_003412229.1.51593 WP_003412229.1.51628 WP_003412229.1.5164 WP_003412229.1.51647 WP_003412229.1.51660 WP_003412229.1.51721 WP_003412229.1.51788 WP_003412229.1.51801 WP_003412229.1.51817 WP_003412229.1.51819 WP_003412229.1.51854 WP_003412229.1.51923 WP_003412229.1.51942 WP_003412229.1.51948 WP_003412229.1.51963 WP_003412229.1.51969 WP_003412229.1.52000 WP_003412229.1.52001 WP_003412229.1.52036 WP_003412229.1.52038 WP_003412229.1.52059 WP_003412229.1.52069 WP_003412229.1.52106 WP_003412229.1.52166 WP_003412229.1.52168 WP_003412229.1.52173 WP_003412229.1.52216 WP_003412229.1.52238 WP_003412229.1.52241 WP_003412229.1.52280 WP_003412229.1.52314 WP_003412229.1.52385 WP_003412229.1.52460 WP_003412229.1.52485 WP_003412229.1.52486 WP_003412229.1.52495 WP_003412229.1.52504 WP_003412229.1.52522 WP_003412229.1.52531 WP_003412229.1.52563 WP_003412229.1.52564 WP_003412229.1.52673 WP_003412229.1.52674 WP_003412229.1.52708 WP_003412229.1.52713 WP_003412229.1.52761 WP_003412229.1.52778 WP_003412229.1.52791 WP_003412229.1.52797 WP_003412229.1.52818 WP_003412229.1.52873 WP_003412229.1.52909 WP_003412229.1.52998 WP_003412229.1.53056 WP_003412229.1.5306 WP_003412229.1.53088 WP_003412229.1.53117 WP_003412229.1.53118 WP_003412229.1.53142 WP_003412229.1.53143 WP_003412229.1.53167 WP_003412229.1.53200 WP_003412229.1.53204 WP_003412229.1.53226 WP_003412229.1.53230 WP_003412229.1.53237 WP_003412229.1.5327 WP_003412229.1.53276 WP_003412229.1.53278 WP_003412229.1.533 WP_003412229.1.53302 WP_003412229.1.5334 WP_003412229.1.5335 WP_003412229.1.53413 WP_003412229.1.53458 WP_003412229.1.53460 WP_003412229.1.53522 WP_003412229.1.53525 WP_003412229.1.53526 WP_003412229.1.53553 WP_003412229.1.53609 WP_003412229.1.53628 WP_003412229.1.53643 WP_003412229.1.53667 WP_003412229.1.53679 WP_003412229.1.53715 WP_003412229.1.53742 WP_003412229.1.53743 WP_003412229.1.53775 WP_003412229.1.53787 WP_003412229.1.53818 WP_003412229.1.53822 WP_003412229.1.53853 WP_003412229.1.53865 WP_003412229.1.53900 WP_003412229.1.53912 WP_003412229.1.53914 WP_003412229.1.53952 WP_003412229.1.5398 WP_003412229.1.5408 WP_003412229.1.54089 WP_003412229.1.54093 WP_003412229.1.54099 WP_003412229.1.54112 WP_003412229.1.54125 WP_003412229.1.54141 WP_003412229.1.54206 WP_003412229.1.54218 WP_003412229.1.54225 WP_003412229.1.54227 WP_003412229.1.54232 WP_003412229.1.54241 WP_003412229.1.54245 WP_003412229.1.54247 WP_003412229.1.54260 WP_003412229.1.54280 WP_003412229.1.5429 WP_003412229.1.54294 WP_003412229.1.54314 WP_003412229.1.54347 WP_003412229.1.54351 WP_003412229.1.54370 WP_003412229.1.54428 WP_003412229.1.54449 WP_003412229.1.54494 WP_003412229.1.54502 WP_003412229.1.54514 WP_003412229.1.54519 WP_003412229.1.5452 WP_003412229.1.54555 WP_003412229.1.54575 WP_003412229.1.54633 WP_003412229.1.54686 WP_003412229.1.54687 WP_003412229.1.54730 WP_003412229.1.5475 WP_003412229.1.54797 WP_003412229.1.54807 WP_003412229.1.54838 WP_003412229.1.54905 WP_003412229.1.54937 WP_003412229.1.54939 WP_003412229.1.54944 WP_003412229.1.54945 WP_003412229.1.55015 WP_003412229.1.55022 WP_003412229.1.55051 WP_003412229.1.55072 WP_003412229.1.55088 WP_003412229.1.55106 WP_003412229.1.55126 WP_003412229.1.55128 WP_003412229.1.55150 WP_003412229.1.55248 WP_003412229.1.55258 WP_003412229.1.55267 WP_003412229.1.55279 WP_003412229.1.55326 WP_003412229.1.5533 WP_003412229.1.55345 WP_003412229.1.55396 WP_003412229.1.55398 WP_003412229.1.55441 WP_003412229.1.55459 WP_003412229.1.55501 WP_003412229.1.55504 WP_003412229.1.55641 WP_003412229.1.5569 WP_003412229.1.55735 WP_003412229.1.55772 WP_003412229.1.55802 WP_003412229.1.55807 WP_003412229.1.55821 WP_003412229.1.5583 WP_003412229.1.55856 WP_003412229.1.55860 WP_003412229.1.55883 WP_003412229.1.55902 WP_003412229.1.55908 WP_003412229.1.5591 WP_003412229.1.55961 WP_003412229.1.55977 WP_003412229.1.55983 WP_003412229.1.56028 WP_003412229.1.56057 WP_003412229.1.56060 WP_003412229.1.56107 WP_003412229.1.56132 WP_003412229.1.56163 WP_003412229.1.56167 WP_003412229.1.56287 WP_003412229.1.56327 WP_003412229.1.56341 WP_003412229.1.56359 WP_003412229.1.56394 WP_003412229.1.56443 WP_003412229.1.56473 WP_003412229.1.56500 WP_003412229.1.56517 WP_003412229.1.56534 WP_003412229.1.5656 WP_003412229.1.56593 WP_003412229.1.56625 WP_003412229.1.56637 WP_003412229.1.56670 WP_003412229.1.56697 WP_003412229.1.56709 WP_003412229.1.56729 WP_003412229.1.56755 WP_003412229.1.56764 WP_003412229.1.56769 WP_003412229.1.56770 WP_003412229.1.56795 WP_003412229.1.5681 WP_003412229.1.56827 WP_003412229.1.56839 WP_003412229.1.56868 WP_003412229.1.56915 WP_003412229.1.56961 WP_003412229.1.56971 WP_003412229.1.56972 WP_003412229.1.57035 WP_003412229.1.57077 WP_003412229.1.57087 WP_003412229.1.57094 WP_003412229.1.57151 WP_003412229.1.57169 WP_003412229.1.57208 WP_003412229.1.57212 WP_003412229.1.57230 WP_003412229.1.5725 WP_003412229.1.5727 WP_003412229.1.57273 WP_003412229.1.573 WP_003412229.1.57314 WP_003412229.1.57351 WP_003412229.1.57352 WP_003412229.1.57380 WP_003412229.1.57430 WP_003412229.1.5744 WP_003412229.1.5745 WP_003412229.1.57461 WP_003412229.1.57469 WP_003412229.1.57489 WP_003412229.1.57509 WP_003412229.1.57525 WP_003412229.1.5758 WP_003412229.1.57596 WP_003412229.1.57604 WP_003412229.1.57616 WP_003412229.1.57617 WP_003412229.1.57619 WP_003412229.1.57627 WP_003412229.1.57642 WP_003412229.1.57658 WP_003412229.1.57667 WP_003412229.1.57675 WP_003412229.1.57689 WP_003412229.1.57708 WP_003412229.1.57794 WP_003412229.1.57821 WP_003412229.1.57825 WP_003412229.1.57843 WP_003412229.1.57906 WP_003412229.1.57924 WP_003412229.1.57926 WP_003412229.1.57930 WP_003412229.1.57957 WP_003412229.1.57960 WP_003412229.1.57964 WP_003412229.1.58000 WP_003412229.1.58086 WP_003412229.1.58101 WP_003412229.1.58108 WP_003412229.1.5811 WP_003412229.1.58121 WP_003412229.1.58164 WP_003412229.1.582 WP_003412229.1.58202 WP_003412229.1.58209 WP_003412229.1.58215 WP_003412229.1.5824 WP_003412229.1.58250 WP_003412229.1.58259 WP_003412229.1.58283 WP_003412229.1.58288 WP_003412229.1.5830 WP_003412229.1.58303 WP_003412229.1.58311 WP_003412229.1.58359 WP_003412229.1.58431 WP_003412229.1.58457 WP_003412229.1.58488 WP_003412229.1.58518 WP_003412229.1.58534 WP_003412229.1.58567 WP_003412229.1.58573 WP_003412229.1.58602 WP_003412229.1.58612 WP_003412229.1.5865 WP_003412229.1.58671 WP_003412229.1.58690 WP_003412229.1.58702 WP_003412229.1.58743 WP_003412229.1.58754 WP_003412229.1.5881 WP_003412229.1.58824 WP_003412229.1.58848 WP_003412229.1.58857 WP_003412229.1.58891 WP_003412229.1.58892 WP_003412229.1.5890 WP_003412229.1.58921 WP_003412229.1.58930 WP_003412229.1.58939 WP_003412229.1.58941 WP_003412229.1.58953 WP_003412229.1.58961 WP_003412229.1.5898 WP_003412229.1.59025 WP_003412229.1.59029 WP_003412229.1.59037 WP_003412229.1.59044 WP_003412229.1.59088 WP_003412229.1.59130 WP_003412229.1.5914 WP_003412229.1.59147 WP_003412229.1.59209 WP_003412229.1.59240 WP_003412229.1.59253 WP_003412229.1.59254 WP_003412229.1.59262 WP_003412229.1.5928 WP_003412229.1.59304 WP_003412229.1.59316 WP_003412229.1.59326 WP_003412229.1.59328 WP_003412229.1.59338 WP_003412229.1.59388 WP_003412229.1.59428 WP_003412229.1.59537 WP_003412229.1.59727 WP_003412229.1.59738 WP_003412229.1.59757 WP_003412229.1.59761 WP_003412229.1.59808 WP_003412229.1.59850 WP_003412229.1.59856 WP_003412229.1.59861 WP_003412229.1.5987 WP_003412229.1.59878 WP_003412229.1.59888 WP_003412229.1.5996 WP_003412229.1.59961 WP_003412229.1.60007 WP_003412229.1.60016 WP_003412229.1.6003 WP_003412229.1.60047 WP_003412229.1.6007 WP_003412229.1.60121 WP_003412229.1.60125 WP_003412229.1.60135 WP_003412229.1.60139 WP_003412229.1.60152 WP_003412229.1.60197 WP_003412229.1.60205 WP_003412229.1.60215 WP_003412229.1.60217 WP_003412229.1.60267 WP_003412229.1.60288 WP_003412229.1.60291 WP_003412229.1.60301 WP_003412229.1.60305 WP_003412229.1.60312 WP_003412229.1.60313 WP_003412229.1.60314 WP_003412229.1.60367 WP_003412229.1.60376 WP_003412229.1.60403 WP_003412229.1.60413 WP_003412229.1.60421 WP_003412229.1.60451 WP_003412229.1.60460 WP_003412229.1.60479 WP_003412229.1.60487 WP_003412229.1.60512 WP_003412229.1.60573 WP_003412229.1.60583 WP_003412229.1.60632 WP_003412229.1.60657 WP_003412229.1.60687 WP_003412229.1.60689 WP_003412229.1.60727 WP_003412229.1.60738 WP_003412229.1.60763 WP_003412229.1.60791 WP_003412229.1.60834 WP_003412229.1.60870 WP_003412229.1.60878 WP_003412229.1.60879 WP_003412229.1.60913 WP_003412229.1.60978 WP_003412229.1.61000 WP_003412229.1.61001 WP_003412229.1.61012 WP_003412229.1.61052 WP_003412229.1.61065 WP_003412229.1.61100 WP_003412229.1.61101 WP_003412229.1.61142 WP_003412229.1.61198 WP_003412229.1.612 WP_003412229.1.61234 WP_003412229.1.61256 WP_003412229.1.61281 WP_003412229.1.61368 WP_003412229.1.61409 WP_003412229.1.61420 WP_003412229.1.61422 WP_003412229.1.61428 WP_003412229.1.61469 WP_003412229.1.61494 WP_003412229.1.61522 WP_003412229.1.61552 WP_003412229.1.61567 WP_003412229.1.61573 WP_003412229.1.61584 WP_003412229.1.61586 WP_003412229.1.6159 WP_003412229.1.6160 WP_003412229.1.61614 WP_003412229.1.6163 WP_003412229.1.61655 WP_003412229.1.61669 WP_003412229.1.61682 WP_003412229.1.61692 WP_003412229.1.61728 WP_003412229.1.61750 WP_003412229.1.61754 WP_003412229.1.61755 WP_003412229.1.61757 WP_003412229.1.61778 WP_003412229.1.61793 WP_003412229.1.61816 WP_003412229.1.61842 WP_003412229.1.61850 WP_003412229.1.61868 WP_003412229.1.61911 WP_003412229.1.61925 WP_003412229.1.61941 WP_003412229.1.61953 WP_003412229.1.61979 WP_003412229.1.61986 WP_003412229.1.61998 WP_003412229.1.62021 WP_003412229.1.62087 WP_003412229.1.62089 WP_003412229.1.62104 WP_003412229.1.6211 WP_003412229.1.62162 WP_003412229.1.62225 WP_003412229.1.62230 WP_003412229.1.62249 WP_003412229.1.62270 WP_003412229.1.62281 WP_003412229.1.62307 WP_003412229.1.6231 WP_003412229.1.62359 WP_003412229.1.62360 WP_003412229.1.62371 WP_003412229.1.62379 WP_003412229.1.62395 WP_003412229.1.62408 WP_003412229.1.62449 WP_003412229.1.62468 WP_003412229.1.62508 WP_003412229.1.62565 WP_003412229.1.62606 WP_003412229.1.62616 WP_003412229.1.62666 WP_003412229.1.62687 WP_003412229.1.62715 WP_003412229.1.62738 WP_003412229.1.62761 WP_003412229.1.62786 WP_003412229.1.62839 WP_003412229.1.62841 WP_003412229.1.62909 WP_003412229.1.6294 WP_003412229.1.6295 WP_003412229.1.62962 WP_003412229.1.63007 WP_003412229.1.63019 WP_003412229.1.63032 WP_003412229.1.63064 WP_003412229.1.63066 WP_003412229.1.63072 WP_003412229.1.6308 WP_003412229.1.63081 WP_003412229.1.63096 WP_003412229.1.63106 WP_003412229.1.6314 WP_003412229.1.63154 WP_003412229.1.63161 WP_003412229.1.63166 WP_003412229.1.63175 WP_003412229.1.6322 WP_003412229.1.63222 WP_003412229.1.63247 WP_003412229.1.6328 WP_003412229.1.63291 WP_003412229.1.63312 WP_003412229.1.63317 WP_003412229.1.63331 WP_003412229.1.63373 WP_003412229.1.63403 WP_003412229.1.63424 WP_003412229.1.63464 WP_003412229.1.63502 WP_003412229.1.63504 WP_003412229.1.63530 WP_003412229.1.63538 WP_003412229.1.63564 WP_003412229.1.63567 WP_003412229.1.63596 WP_003412229.1.63627 WP_003412229.1.63654 WP_003412229.1.63662 WP_003412229.1.63711 WP_003412229.1.63819 WP_003412229.1.63844 WP_003412229.1.63913 WP_003412229.1.63915 WP_003412229.1.63918 WP_003412229.1.63961 WP_003412229.1.64000 WP_003412229.1.64027 WP_003412229.1.64082 WP_003412229.1.64091 WP_003412229.1.64102 WP_003412229.1.64104 WP_003412229.1.64119 WP_003412229.1.64169 WP_003412229.1.64219 WP_003412229.1.6422 WP_003412229.1.64222 WP_003412229.1.64223 WP_003412229.1.64228 WP_003412229.1.64235 WP_003412229.1.6427 WP_003412229.1.64278 WP_003412229.1.64287 WP_003412229.1.64414 WP_003412229.1.64419 WP_003412229.1.6443 WP_003412229.1.64463 WP_003412229.1.64506 WP_003412229.1.64511 WP_003412229.1.64513 WP_003412229.1.64514 WP_003412229.1.64515 WP_003412229.1.64522 WP_003412229.1.64526 WP_003412229.1.64543 WP_003412229.1.6456 WP_003412229.1.64567 WP_003412229.1.64588 WP_003412229.1.64589 WP_003412229.1.64594 WP_003412229.1.64595 WP_003412229.1.64608 WP_003412229.1.64629 WP_003412229.1.6464 WP_003412229.1.64664 WP_003412229.1.64669 WP_003412229.1.64672 WP_003412229.1.64680 WP_003412229.1.64682 WP_003412229.1.64727 WP_003412229.1.64729 WP_003412229.1.64774 WP_003412229.1.64802 WP_003412229.1.6486 WP_003412229.1.64870 WP_003412229.1.64898 WP_003412229.1.64922 WP_003412229.1.64924 WP_003412229.1.6493 WP_003412229.1.64937 WP_003412229.1.64941 WP_003412229.1.64966 WP_003412229.1.64973 WP_003412229.1.65001 WP_003412229.1.65026 WP_003412229.1.65102 WP_003412229.1.65157 WP_003412229.1.65181 WP_003412229.1.65212 WP_003412229.1.65229 WP_003412229.1.6523 WP_003412229.1.65329 WP_003412229.1.65359 WP_003412229.1.6536 WP_003412229.1.65374 WP_003412229.1.65386 WP_003412229.1.65414 WP_003412229.1.65433 WP_003412229.1.65455 WP_003412229.1.65467 WP_003412229.1.65488 WP_003412229.1.65583 WP_003412229.1.65623 WP_003412229.1.65635 WP_003412229.1.65648 WP_003412229.1.65683 WP_003412229.1.65686 WP_003412229.1.65688 WP_003412229.1.65707 WP_003412229.1.65747 WP_003412229.1.65816 WP_003412229.1.65830 WP_003412229.1.65862 WP_003412229.1.65893 WP_003412229.1.65929 WP_003412229.1.65932 WP_003412229.1.65974 WP_003412229.1.66004 WP_003412229.1.66013 WP_003412229.1.66089 WP_003412229.1.66149 WP_003412229.1.66229 WP_003412229.1.66276 WP_003412229.1.66293 WP_003412229.1.66297 WP_003412229.1.66323 WP_003412229.1.66325 WP_003412229.1.6633 WP_003412229.1.66334 WP_003412229.1.66355 WP_003412229.1.66394 WP_003412229.1.66455 WP_003412229.1.66460 WP_003412229.1.66464 WP_003412229.1.66466 WP_003412229.1.66487 WP_003412229.1.66544 WP_003412229.1.66558 WP_003412229.1.66580 WP_003412229.1.66582 WP_003412229.1.66612 WP_003412229.1.66615 WP_003412229.1.66656 WP_003412229.1.66663 WP_003412229.1.66675 WP_003412229.1.66715 WP_003412229.1.66718 WP_003412229.1.66817 WP_003412229.1.66826 WP_003412229.1.66842 WP_003412229.1.66868 WP_003412229.1.66878 WP_003412229.1.66880 WP_003412229.1.66961 WP_003412229.1.67005 WP_003412229.1.6704 WP_003412229.1.67044 WP_003412229.1.67061 WP_003412229.1.67089 WP_003412229.1.67098 WP_003412229.1.67146 WP_003412229.1.67170 WP_003412229.1.67198 WP_003412229.1.6720 WP_003412229.1.67207 WP_003412229.1.67220 WP_003412229.1.67225 WP_003412229.1.67231 WP_003412229.1.6724 WP_003412229.1.67257 WP_003412229.1.67298 WP_003412229.1.67307 WP_003412229.1.67332 WP_003412229.1.67346 WP_003412229.1.67354 WP_003412229.1.67360 WP_003412229.1.67381 WP_003412229.1.67396 WP_003412229.1.67417 WP_003412229.1.67422 WP_003412229.1.67453 WP_003412229.1.67459 WP_003412229.1.6746 WP_003412229.1.67473 WP_003412229.1.67481 WP_003412229.1.67482 WP_003412229.1.67496 WP_003412229.1.67516 WP_003412229.1.67523 WP_003412229.1.67536 WP_003412229.1.67575 WP_003412229.1.67587 WP_003412229.1.67598 WP_003412229.1.67600 WP_003412229.1.67602 WP_003412229.1.67630 WP_003412229.1.67692 WP_003412229.1.67744 WP_003412229.1.6775 WP_003412229.1.67750 WP_003412229.1.6777 WP_003412229.1.67809 WP_003412229.1.67848 WP_003412229.1.67870 WP_003412229.1.67888 WP_003412229.1.67915 WP_003412229.1.67980 WP_003412229.1.67982 WP_003412229.1.68022 WP_003412229.1.68029 WP_003412229.1.68057 WP_003412229.1.68083 WP_003412229.1.68088 WP_003412229.1.68110 WP_003412229.1.68153 WP_003412229.1.68164 WP_003412229.1.68169 WP_003412229.1.68193 WP_003412229.1.68212 WP_003412229.1.68227 WP_003412229.1.6825 WP_003412229.1.68297 WP_003412229.1.68325 WP_003412229.1.68340 WP_003412229.1.68384 WP_003412229.1.68429 WP_003412229.1.6843 WP_003412229.1.68433 WP_003412229.1.68444 WP_003412229.1.68465 WP_003412229.1.68484 WP_003412229.1.68518 WP_003412229.1.68569 WP_003412229.1.68576 WP_003412229.1.68580 WP_003412229.1.68623 WP_003412229.1.68624 WP_003412229.1.68637 WP_003412229.1.68646 WP_003412229.1.68667 WP_003412229.1.68669 WP_003412229.1.68672 WP_003412229.1.68704 WP_003412229.1.68708 WP_003412229.1.6872 WP_003412229.1.68730 WP_003412229.1.68734 WP_003412229.1.68748 WP_003412229.1.68754 WP_003412229.1.6876 WP_003412229.1.68761 WP_003412229.1.68763 WP_003412229.1.68766 WP_003412229.1.68774 WP_003412229.1.68796 WP_003412229.1.68824 WP_003412229.1.68832 WP_003412229.1.68833 WP_003412229.1.68841 WP_003412229.1.68859 WP_003412229.1.68876 WP_003412229.1.68906 WP_003412229.1.68916 WP_003412229.1.68923 WP_003412229.1.68945 WP_003412229.1.6896 WP_003412229.1.68981 WP_003412229.1.68984 WP_003412229.1.69008 WP_003412229.1.69076 WP_003412229.1.69079 WP_003412229.1.69082 WP_003412229.1.69178 WP_003412229.1.69181 WP_003412229.1.69231 WP_003412229.1.69256 WP_003412229.1.69311 WP_003412229.1.69315 WP_003412229.1.69322 WP_003412229.1.69342 WP_003412229.1.6935 WP_003412229.1.6936 WP_003412229.1.69369 WP_003412229.1.69374 WP_003412229.1.69426 WP_003412229.1.69427 WP_003412229.1.69429 WP_003412229.1.6951 WP_003412229.1.69511 WP_003412229.1.69526 WP_003412229.1.69547 WP_003412229.1.69573 WP_003412229.1.6960 WP_003412229.1.69617 WP_003412229.1.69634 WP_003412229.1.69659 WP_003412229.1.69673 WP_003412229.1.69684 WP_003412229.1.69686 WP_003412229.1.69707 WP_003412229.1.69709 WP_003412229.1.69723 WP_003412229.1.69800 WP_003412229.1.69802 WP_003412229.1.69870 WP_003412229.1.69873 WP_003412229.1.69898 WP_003412229.1.69913 WP_003412229.1.69925 WP_003412229.1.69931 WP_003412229.1.69938 WP_003412229.1.69955 WP_003412229.1.69957 WP_003412229.1.69981 WP_003412229.1.69990 WP_003412229.1.70 WP_003412229.1.70032 WP_003412229.1.70062 WP_003412229.1.70072 WP_003412229.1.70131 WP_003412229.1.70132 WP_003412229.1.7022 WP_003412229.1.70227 WP_003412229.1.70274 WP_003412229.1.7029 WP_003412229.1.70325 WP_003412229.1.70328 WP_003412229.1.70356 WP_003412229.1.70369 WP_003412229.1.70418 WP_003412229.1.70422 WP_003412229.1.70435 WP_003412229.1.70463 WP_003412229.1.70480 WP_003412229.1.70498 WP_003412229.1.70505 WP_003412229.1.70525 WP_003412229.1.70573 WP_003412229.1.70577 WP_003412229.1.70610 WP_003412229.1.70615 WP_003412229.1.70618 WP_003412229.1.70622 WP_003412229.1.70626 WP_003412229.1.70704 WP_003412229.1.70729 WP_003412229.1.70782 WP_003412229.1.70796 WP_003412229.1.70840 WP_003412229.1.70871 WP_003412229.1.70915 WP_003412229.1.70955 WP_003412229.1.70958 WP_003412229.1.70964 WP_003412229.1.70976 WP_003412229.1.71026 WP_003412229.1.71063 WP_003412229.1.71076 WP_003412229.1.7111 WP_003412229.1.71118 WP_003412229.1.71128 WP_003412229.1.71187 WP_003412229.1.71255 WP_003412229.1.71258 WP_003412229.1.71259 WP_003412229.1.71289 WP_003412229.1.71326 WP_003412229.1.71329 WP_003412229.1.71331 WP_003412229.1.71344 WP_003412229.1.71390 WP_003412229.1.71440 WP_003412229.1.71457 WP_003412229.1.7146 WP_003412229.1.71490 WP_003412229.1.71492 WP_003412229.1.71509 WP_003412229.1.71517 WP_003412229.1.71527 WP_003412229.1.71532 WP_003412229.1.71545 WP_003412229.1.71546 WP_003412229.1.71569 WP_003412229.1.71604 WP_003412229.1.71621 WP_003412229.1.71630 WP_003412229.1.71638 WP_003412229.1.71654 WP_003412229.1.71664 WP_003412229.1.71683 WP_003412229.1.71718 WP_003412229.1.71781 WP_003412229.1.71803 WP_003412229.1.71820 WP_003412229.1.71847 WP_003412229.1.71871 WP_003412229.1.71909 WP_003412229.1.71957 WP_003412229.1.71970 WP_003412229.1.72047 WP_003412229.1.72061 WP_003412229.1.72062 WP_003412229.1.72111 WP_003412229.1.72122 WP_003412229.1.72128 WP_003412229.1.72143 WP_003412229.1.7216 WP_003412229.1.72209 WP_003412229.1.72218 WP_003412229.1.72219 WP_003412229.1.72227 WP_003412229.1.7224 WP_003412229.1.72332 WP_003412229.1.72380 WP_003412229.1.72405 WP_003412229.1.72420 WP_003412229.1.72451 WP_003412229.1.72452 WP_003412229.1.72457 WP_003412229.1.72459 WP_003412229.1.72466 WP_003412229.1.72487 WP_003412229.1.72488 WP_003412229.1.72506 WP_003412229.1.72543 WP_003412229.1.7256 WP_003412229.1.72585 WP_003412229.1.72591 WP_003412229.1.72592 WP_003412229.1.72640 WP_003412229.1.7266 WP_003412229.1.72661 WP_003412229.1.72684 WP_003412229.1.72739 WP_003412229.1.72744 WP_003412229.1.72755 WP_003412229.1.72759 WP_003412229.1.72792 WP_003412229.1.72826 WP_003412229.1.72831 WP_003412229.1.72852 WP_003412229.1.72879 WP_003412229.1.72880 WP_003412229.1.72954 WP_003412229.1.72957 WP_003412229.1.72959 WP_003412229.1.72973 WP_003412229.1.7298 WP_003412229.1.72982 WP_003412229.1.72988 WP_003412229.1.72993 WP_003412229.1.73028 WP_003412229.1.73042 WP_003412229.1.73045 WP_003412229.1.73092 WP_003412229.1.73118 WP_003412229.1.7312 WP_003412229.1.73127 WP_003412229.1.73134 WP_003412229.1.73150 WP_003412229.1.73154 WP_003412229.1.73163 WP_003412229.1.73205 WP_003412229.1.73310 WP_003412229.1.73365 WP_003412229.1.73391 WP_003412229.1.73404 WP_003412229.1.73424 WP_003412229.1.73445 WP_003412229.1.73453 WP_003412229.1.73465 WP_003412229.1.73466 WP_003412229.1.73471 WP_003412229.1.73478 WP_003412229.1.73482 WP_003412229.1.73507 WP_003412229.1.73532 WP_003412229.1.73550 WP_003412229.1.73564 WP_003412229.1.73623 WP_003412229.1.73644 WP_003412229.1.7366 WP_003412229.1.73688 WP_003412229.1.73744 WP_003412229.1.73750 WP_003412229.1.73760 WP_003412229.1.73774 WP_003412229.1.7379 WP_003412229.1.73813 WP_003412229.1.73840 WP_003412229.1.73876 WP_003412229.1.7389 WP_003412229.1.73986 WP_003412229.1.74016 WP_003412229.1.74039 WP_003412229.1.74083 WP_003412229.1.74101 WP_003412229.1.74120 WP_003412229.1.74144 WP_003412229.1.7417 WP_003412229.1.74190 WP_003412229.1.7423 WP_003412229.1.74259 WP_003412229.1.74262 WP_003412229.1.74269 WP_003412229.1.74291 WP_003412229.1.74296 WP_003412229.1.7436 WP_003412229.1.74378 WP_003412229.1.74382 WP_003412229.1.74395 WP_003412229.1.74400 WP_003412229.1.74401 WP_003412229.1.74432 WP_003412229.1.74477 WP_003412229.1.74487 WP_003412229.1.74504 WP_003412229.1.74551 WP_003412229.1.74555 WP_003412229.1.74628 WP_003412229.1.74641 WP_003412229.1.74653 WP_003412229.1.74660 WP_003412229.1.74786 WP_003412229.1.74820 WP_003412229.1.74870 WP_003412229.1.74881 WP_003412229.1.74888 WP_003412229.1.74952 WP_003412229.1.75043 WP_003412229.1.75045 WP_003412229.1.75055 WP_003412229.1.75078 WP_003412229.1.75081 WP_003412229.1.75120 WP_003412229.1.75163 WP_003412229.1.75188 WP_003412229.1.75200 WP_003412229.1.75202 WP_003412229.1.75239 WP_003412229.1.75250 WP_003412229.1.75263 WP_003412229.1.75281 WP_003412229.1.7535 WP_003412229.1.75376 WP_003412229.1.75391 WP_003412229.1.75441 WP_003412229.1.75581 WP_003412229.1.75635 WP_003412229.1.75645 WP_003412229.1.75665 WP_003412229.1.75741 WP_003412229.1.75772 WP_003412229.1.75774 WP_003412229.1.75811 WP_003412229.1.75833 WP_003412229.1.7585 WP_003412229.1.75864 WP_003412229.1.75868 WP_003412229.1.75968 WP_003412229.1.76007 WP_003412229.1.76016 WP_003412229.1.76032 WP_003412229.1.76037 WP_003412229.1.7604 WP_003412229.1.76110 WP_003412229.1.76133 WP_003412229.1.76138 WP_003412229.1.76172 WP_003412229.1.76177 WP_003412229.1.76183 WP_003412229.1.76209 WP_003412229.1.76239 WP_003412229.1.76272 WP_003412229.1.76277 WP_003412229.1.76280 WP_003412229.1.76281 WP_003412229.1.76291 WP_003412229.1.76297 WP_003412229.1.76360 WP_003412229.1.76379 WP_003412229.1.76403 WP_003412229.1.76413 WP_003412229.1.76414 WP_003412229.1.76427 WP_003412229.1.76436 WP_003412229.1.76442 WP_003412229.1.76443 WP_003412229.1.76456 WP_003412229.1.76521 WP_003412229.1.76533 WP_003412229.1.76625 WP_003412229.1.76629 WP_003412229.1.76635 WP_003412229.1.76638 WP_003412229.1.76639 WP_003412229.1.76678 WP_003412229.1.76679 WP_003412229.1.76750 WP_003412229.1.76754 WP_003412229.1.76781 WP_003412229.1.76818 WP_003412229.1.76824 WP_003412229.1.76835 WP_003412229.1.76873 WP_003412229.1.76881 WP_003412229.1.76900 WP_003412229.1.7691 WP_003412229.1.76947 WP_003412229.1.76954 WP_003412229.1.76955 WP_003412229.1.76976 WP_003412229.1.77000 WP_003412229.1.77021 WP_003412229.1.77056 WP_003412229.1.77065 WP_003412229.1.77075 WP_003412229.1.77093 WP_003412229.1.77107 WP_003412229.1.77115 WP_003412229.1.77118 WP_003412229.1.77141 WP_003412229.1.77142 WP_003412229.1.77166 WP_003412229.1.77250 WP_003412229.1.77252 WP_003412229.1.77260 WP_003412229.1.77266 WP_003412229.1.77280 WP_003412229.1.77285 WP_003412229.1.77312 WP_003412229.1.77348 WP_003412229.1.77351 WP_003412229.1.77352 WP_003412229.1.77361 WP_003412229.1.774 WP_003412229.1.7740 WP_003412229.1.77425 WP_003412229.1.77463 WP_003412229.1.77474 WP_003412229.1.7748 WP_003412229.1.77484 WP_003412229.1.77491 WP_003412229.1.77530 WP_003412229.1.77559 WP_003412229.1.77599 WP_003412229.1.77605 WP_003412229.1.7762 WP_003412229.1.77627 WP_003412229.1.77649 WP_003412229.1.77654 WP_003412229.1.77667 WP_003412229.1.77704 WP_003412229.1.77774 WP_003412229.1.7778 WP_003412229.1.77790 WP_003412229.1.77809 WP_003412229.1.77843 WP_003412229.1.77865 WP_003412229.1.77879 WP_003412229.1.77890 WP_003412229.1.77909 WP_003412229.1.77931 WP_003412229.1.77984 WP_003412229.1.78024 WP_003412229.1.78084 WP_003412229.1.78086 WP_003412229.1.7809 WP_003412229.1.78098 WP_003412229.1.78105 WP_003412229.1.78136 WP_003412229.1.78162 WP_003412229.1.7817 WP_003412229.1.78236 WP_003412229.1.78238 WP_003412229.1.78322 WP_003412229.1.78338 WP_003412229.1.7836 WP_003412229.1.78360 WP_003412229.1.78429 WP_003412229.1.78459 WP_003412229.1.78488 WP_003412229.1.7849 WP_003412229.1.78516 WP_003412229.1.78524 WP_003412229.1.78538 WP_003412229.1.78544 WP_003412229.1.78545 WP_003412229.1.78574 WP_003412229.1.78580 WP_003412229.1.7860 WP_003412229.1.78620 WP_003412229.1.78646 WP_003412229.1.78648 WP_003412229.1.78655 WP_003412229.1.78657 WP_003412229.1.78659 WP_003412229.1.7869 WP_003412229.1.78692 WP_003412229.1.78760 WP_003412229.1.78766 WP_003412229.1.78776 WP_003412229.1.78778 WP_003412229.1.78784 WP_003412229.1.78788 WP_003412229.1.78790 WP_003412229.1.78793 WP_003412229.1.78848 WP_003412229.1.78860 WP_003412229.1.7887 WP_003412229.1.78884 WP_003412229.1.78969 WP_003412229.1.78977 WP_003412229.1.79005 WP_003412229.1.79033 WP_003412229.1.79064 WP_003412229.1.79068 WP_003412229.1.79077 WP_003412229.1.79095 WP_003412229.1.79112 WP_003412229.1.79145 WP_003412229.1.79152 WP_003412229.1.79163 WP_003412229.1.79182 WP_003412229.1.79198 WP_003412229.1.79218 WP_003412229.1.79268 WP_003412229.1.79273 WP_003412229.1.79290 WP_003412229.1.79319 WP_003412229.1.79326 WP_003412229.1.7933 WP_003412229.1.79394 WP_003412229.1.79413 WP_003412229.1.79422 WP_003412229.1.79447 WP_003412229.1.79455 WP_003412229.1.79471 WP_003412229.1.79480 WP_003412229.1.79482 WP_003412229.1.79488 WP_003412229.1.79500 WP_003412229.1.79508 WP_003412229.1.79514 WP_003412229.1.79565 WP_003412229.1.79588 WP_003412229.1.79698 WP_003412229.1.797 WP_003412229.1.79744 WP_003412229.1.79784 WP_003412229.1.79802 WP_003412229.1.79806 WP_003412229.1.79819 WP_003412229.1.79828 WP_003412229.1.79851 WP_003412229.1.79853 WP_003412229.1.79881 WP_003412229.1.79898 WP_003412229.1.7990 WP_003412229.1.79913 WP_003412229.1.79918 WP_003412229.1.79947 WP_003412229.1.79948 WP_003412229.1.7995 WP_003412229.1.7997 WP_003412229.1.80004 WP_003412229.1.80015 WP_003412229.1.80022 WP_003412229.1.80054 WP_003412229.1.80084 WP_003412229.1.80234 WP_003412229.1.8026 WP_003412229.1.80275 WP_003412229.1.80299 WP_003412229.1.80300 WP_003412229.1.80326 WP_003412229.1.80351 WP_003412229.1.80370 WP_003412229.1.80387 WP_003412229.1.80399 WP_003412229.1.80451 WP_003412229.1.80458 WP_003412229.1.80461 WP_003412229.1.80490 WP_003412229.1.80503 WP_003412229.1.80552 WP_003412229.1.80576 WP_003412229.1.80588 WP_003412229.1.80599 WP_003412229.1.8060 WP_003412229.1.80624 WP_003412229.1.80636 WP_003412229.1.80673 WP_003412229.1.80711 WP_003412229.1.80714 WP_003412229.1.80815 WP_003412229.1.80853 WP_003412229.1.80918 WP_003412229.1.80967 WP_003412229.1.8097 WP_003412229.1.80988 WP_003412229.1.81013 WP_003412229.1.81059 WP_003412229.1.81066 WP_003412229.1.81075 WP_003412229.1.81091 WP_003412229.1.81136 WP_003412229.1.8114 WP_003412229.1.81189 WP_003412229.1.81192 WP_003412229.1.812 WP_003412229.1.81230 WP_003412229.1.81249 WP_003412229.1.81250 WP_003412229.1.81264 WP_003412229.1.8128 WP_003412229.1.81287 WP_003412229.1.81407 WP_003412229.1.8143 WP_003412229.1.81439 WP_003412229.1.81505 WP_003412229.1.81529 WP_003412229.1.81538 WP_003412229.1.81541 WP_003412229.1.81561 WP_003412229.1.81567 WP_003412229.1.81686 WP_003412229.1.81720 WP_003412229.1.81731 WP_003412229.1.81774 WP_003412229.1.81788 WP_003412229.1.81820 WP_003412229.1.81850 WP_003412229.1.81883 WP_003412229.1.81891 WP_003412229.1.82011 WP_003412229.1.82048 WP_003412229.1.82108 WP_003412229.1.82142 WP_003412229.1.8215 WP_003412229.1.8217 WP_003412229.1.82209 WP_003412229.1.82210 WP_003412229.1.82228 WP_003412229.1.82251 WP_003412229.1.82309 WP_003412229.1.82346 WP_003412229.1.82385 WP_003412229.1.82462 WP_003412229.1.82483 WP_003412229.1.82494 WP_003412229.1.82531 WP_003412229.1.82546 WP_003412229.1.82547 WP_003412229.1.82549 WP_003412229.1.82592 WP_003412229.1.82598 WP_003412229.1.82642 WP_003412229.1.82681 WP_003412229.1.8273 WP_003412229.1.82774 WP_003412229.1.82803 WP_003412229.1.82836 WP_003412229.1.82860 WP_003412229.1.82871 WP_003412229.1.82935 WP_003412229.1.82957 WP_003412229.1.82973 WP_003412229.1.82981 WP_003412229.1.82983 WP_003412229.1.83004 WP_003412229.1.83009 WP_003412229.1.83065 WP_003412229.1.83110 WP_003412229.1.83146 WP_003412229.1.83149 WP_003412229.1.83159 WP_003412229.1.83173 WP_003412229.1.83181 WP_003412229.1.83197 WP_003412229.1.83212 WP_003412229.1.83262 WP_003412229.1.83268 WP_003412229.1.83273 WP_003412229.1.83332 WP_003412229.1.83334 WP_003412229.1.83341 WP_003412229.1.83367 WP_003412229.1.83380 WP_003412229.1.83409 WP_003412229.1.83435 WP_003412229.1.83470 WP_003412229.1.83524 WP_003412229.1.83526 WP_003412229.1.8358 WP_003412229.1.83601 WP_003412229.1.83611 WP_003412229.1.83648 WP_003412229.1.83656 WP_003412229.1.83689 WP_003412229.1.83692 WP_003412229.1.83704 WP_003412229.1.83705 WP_003412229.1.83766 WP_003412229.1.83793 WP_003412229.1.83794 WP_003412229.1.83805 WP_003412229.1.83842 WP_003412229.1.83850 WP_003412229.1.83861 WP_003412229.1.83884 WP_003412229.1.83930 WP_003412229.1.83975 WP_003412229.1.84027 WP_003412229.1.8404 WP_003412229.1.84070 WP_003412229.1.8409 WP_003412229.1.8415 WP_003412229.1.84176 WP_003412229.1.84186 WP_003412229.1.84192 WP_003412229.1.84228 WP_003412229.1.84259 WP_003412229.1.8426 WP_003412229.1.84277 WP_003412229.1.84287 WP_003412229.1.8434 WP_003412229.1.84388 WP_003412229.1.84408 WP_003412229.1.84409 WP_003412229.1.84488 WP_003412229.1.84525 WP_003412229.1.84620 WP_003412229.1.84623 WP_003412229.1.84641 WP_003412229.1.84666 WP_003412229.1.84670 WP_003412229.1.84739 WP_003412229.1.84766 WP_003412229.1.84774 WP_003412229.1.84812 WP_003412229.1.84839 WP_003412229.1.84846 WP_003412229.1.84873 WP_003412229.1.84911 WP_003412229.1.84938 WP_003412229.1.84968 WP_003412229.1.84973 WP_003412229.1.84985 WP_003412229.1.85038 WP_003412229.1.85041 WP_003412229.1.8505 WP_003412229.1.85074 WP_003412229.1.8509 WP_003412229.1.8512 WP_003412229.1.85148 WP_003412229.1.8518 WP_003412229.1.8522 WP_003412229.1.85242 WP_003412229.1.85276 WP_003412229.1.85281 WP_003412229.1.85314 WP_003412229.1.85330 WP_003412229.1.85346 WP_003412229.1.8535 WP_003412229.1.85363 WP_003412229.1.85371 WP_003412229.1.85377 WP_003412229.1.85387 WP_003412229.1.85399 WP_003412229.1.85458 WP_003412229.1.85464 WP_003412229.1.85480 WP_003412229.1.85495 WP_003412229.1.85557 WP_003412229.1.85597 WP_003412229.1.85599 WP_003412229.1.85610 WP_003412229.1.8563 WP_003412229.1.85679 WP_003412229.1.85737 WP_003412229.1.85763 WP_003412229.1.85819 WP_003412229.1.85820 WP_003412229.1.85823 WP_003412229.1.85832 WP_003412229.1.85872 WP_003412229.1.85894 WP_003412229.1.85909 WP_003412229.1.86000 WP_003412229.1.86024 WP_003412229.1.86067 WP_003412229.1.86103 WP_003412229.1.86124 WP_003412229.1.86160 WP_003412229.1.86164 WP_003412229.1.86168 WP_003412229.1.86190 WP_003412229.1.86204 WP_003412229.1.86208 WP_003412229.1.86235 WP_003412229.1.86260 WP_003412229.1.86290 WP_003412229.1.863 WP_003412229.1.86327 WP_003412229.1.86334 WP_003412229.1.86337 WP_003412229.1.86377 WP_003412229.1.86425 WP_003412229.1.86459 WP_003412229.1.8649 WP_003412229.1.86520 WP_003412229.1.86568 WP_003412229.1.86575 WP_003412229.1.86584 WP_003412229.1.86605 WP_003412229.1.86626 WP_003412229.1.86648 WP_003412229.1.8666 WP_003412229.1.86684 WP_003412229.1.86696 WP_003412229.1.86705 WP_003412229.1.86725 WP_003412229.1.86757 WP_003412229.1.86766 WP_003412229.1.86801 WP_003412229.1.86814 WP_003412229.1.86825 WP_003412229.1.86834 WP_003412229.1.86855 WP_003412229.1.86877 WP_003412229.1.86883 WP_003412229.1.8689 WP_003412229.1.86933 WP_003412229.1.86950 WP_003412229.1.86962 WP_003412229.1.86979 WP_003412229.1.87001 WP_003412229.1.87031 WP_003412229.1.87117 WP_003412229.1.87162 WP_003412229.1.87178 WP_003412229.1.87191 WP_003412229.1.87201 WP_003412229.1.87209 WP_003412229.1.87240 WP_003412229.1.87266 WP_003412229.1.87273 WP_003412229.1.8733 WP_003412229.1.87345 WP_003412229.1.87369 WP_003412229.1.8737 WP_003412229.1.87404 WP_003412229.1.87406 WP_003412229.1.87444 WP_003412229.1.87446 WP_003412229.1.87472 WP_003412229.1.87489 WP_003412229.1.87496 WP_003412229.1.87582 WP_003412229.1.87588 WP_003412229.1.87617 WP_003412229.1.87619 WP_003412229.1.87620 WP_003412229.1.87643 WP_003412229.1.8765 WP_003412229.1.87654 WP_003412229.1.87665 WP_003412229.1.87676 WP_003412229.1.87677 WP_003412229.1.87684 WP_003412229.1.87692 WP_003412229.1.87707 WP_003412229.1.87784 WP_003412229.1.87796 WP_003412229.1.87817 WP_003412229.1.87835 WP_003412229.1.87837 WP_003412229.1.87911 WP_003412229.1.87924 WP_003412229.1.87951 WP_003412229.1.87955 WP_003412229.1.87956 WP_003412229.1.87991 WP_003412229.1.88 WP_003412229.1.88037 WP_003412229.1.88072 WP_003412229.1.88077 WP_003412229.1.88121 WP_003412229.1.88180 WP_003412229.1.88191 WP_003412229.1.88217 WP_003412229.1.88245 WP_003412229.1.88253 WP_003412229.1.88294 WP_003412229.1.88316 WP_003412229.1.88320 WP_003412229.1.88338 WP_003412229.1.88437 WP_003412229.1.88453 WP_003412229.1.88469 WP_003412229.1.88507 WP_003412229.1.88521 WP_003412229.1.88530 WP_003412229.1.88541 WP_003412229.1.88618 WP_003412229.1.8862 WP_003412229.1.88632 WP_003412229.1.88634 WP_003412229.1.88649 WP_003412229.1.88756 WP_003412229.1.88824 WP_003412229.1.88985 WP_003412229.1.8902 WP_003412229.1.89025 WP_003412229.1.89041 WP_003412229.1.89046 WP_003412229.1.89082 WP_003412229.1.89168 WP_003412229.1.89193 WP_003412229.1.89205 WP_003412229.1.89207 WP_003412229.1.8925 WP_003412229.1.89277 WP_003412229.1.89286 WP_003412229.1.89320 WP_003412229.1.8935 WP_003412229.1.89371 WP_003412229.1.89378 WP_003412229.1.89392 WP_003412229.1.89406 WP_003412229.1.8943 WP_003412229.1.89451 WP_003412229.1.89453 WP_003412229.1.89473 WP_003412229.1.89475 WP_003412229.1.89483 WP_003412229.1.895 WP_003412229.1.89513 WP_003412229.1.89517 WP_003412229.1.89522 WP_003412229.1.8954 WP_003412229.1.89543 WP_003412229.1.89567 WP_003412229.1.8957 WP_003412229.1.89572 WP_003412229.1.89589 WP_003412229.1.89607 WP_003412229.1.89625 WP_003412229.1.89648 WP_003412229.1.8967 WP_003412229.1.89670 WP_003412229.1.89676 WP_003412229.1.89729 WP_003412229.1.89739 WP_003412229.1.8977 WP_003412229.1.89802 WP_003412229.1.89808 WP_003412229.1.8982 WP_003412229.1.89844 WP_003412229.1.89849 WP_003412229.1.89901 WP_003412229.1.89903 WP_003412229.1.89909 WP_003412229.1.89926 WP_003412229.1.89971 WP_003412229.1.89987 WP_003412229.1.900 WP_003412229.1.9007 WP_003412229.1.90080 WP_003412229.1.90134 WP_003412229.1.90137 WP_003412229.1.90199 WP_003412229.1.90245 WP_003412229.1.90308 WP_003412229.1.90322 WP_003412229.1.90328 WP_003412229.1.90439 WP_003412229.1.90481 WP_003412229.1.90527 WP_003412229.1.90550 WP_003412229.1.90560 WP_003412229.1.90612 WP_003412229.1.90640 WP_003412229.1.90672 WP_003412229.1.90687 WP_003412229.1.90691 WP_003412229.1.90711 WP_003412229.1.90744 WP_003412229.1.9075 WP_003412229.1.90785 WP_003412229.1.90788 WP_003412229.1.90800 WP_003412229.1.90810 WP_003412229.1.90819 WP_003412229.1.9082 WP_003412229.1.90831 WP_003412229.1.90884 WP_003412229.1.90906 WP_003412229.1.90958 WP_003412229.1.90976 WP_003412229.1.90987 WP_003412229.1.9102 WP_003412229.1.91026 WP_003412229.1.91032 WP_003412229.1.91043 WP_003412229.1.91082 WP_003412229.1.91106 WP_003412229.1.91112 WP_003412229.1.91144 WP_003412229.1.91151 WP_003412229.1.91157 WP_003412229.1.91167 WP_003412229.1.91169 WP_003412229.1.91192 WP_003412229.1.91201 WP_003412229.1.91207 WP_003412229.1.91208 WP_003412229.1.91211 WP_003412229.1.91214 WP_003412229.1.91230 WP_003412229.1.91244 WP_003412229.1.91260 WP_003412229.1.91265 WP_003412229.1.9128 WP_003412229.1.91284 WP_003412229.1.91294 WP_003412229.1.91303 WP_003412229.1.91352 WP_003412229.1.91386 WP_003412229.1.9139 WP_003412229.1.91398 WP_003412229.1.91411 WP_003412229.1.91430 WP_003412229.1.91436 WP_003412229.1.91483 WP_003412229.1.91496 WP_003412229.1.91507 WP_003412229.1.91508 WP_003412229.1.91576 WP_003412229.1.91589 WP_003412229.1.91695 WP_003412229.1.91713 WP_003412229.1.91717 WP_003412229.1.91728 WP_003412229.1.91743 WP_003412229.1.91759 WP_003412229.1.91785 WP_003412229.1.91786 WP_003412229.1.91802 WP_003412229.1.91822 WP_003412229.1.91828 WP_003412229.1.9189 WP_003412229.1.9190 WP_003412229.1.91915 WP_003412229.1.91931 WP_003412229.1.91944 WP_003412229.1.91953 WP_003412229.1.91957 WP_003412229.1.91976 WP_003412229.1.91978 WP_003412229.1.92021 WP_003412229.1.92190 WP_003412229.1.92192 WP_003412229.1.92200 WP_003412229.1.92220 WP_003412229.1.92222 WP_003412229.1.92273 WP_003412229.1.92289 WP_003412229.1.9229 WP_003412229.1.92294 WP_003412229.1.92300 WP_003412229.1.92317 WP_003412229.1.92334 WP_003412229.1.92338 WP_003412229.1.92345 WP_003412229.1.92356 WP_003412229.1.92380 WP_003412229.1.92416 WP_003412229.1.92428 WP_003412229.1.92456 WP_003412229.1.92508 WP_003412229.1.9251 WP_003412229.1.92511 WP_003412229.1.92527 WP_003412229.1.92536 WP_003412229.1.92592 WP_003412229.1.92597 WP_003412229.1.92603 WP_003412229.1.92606 WP_003412229.1.9263 WP_003412229.1.92650 WP_003412229.1.92660 WP_003412229.1.92690 WP_003412229.1.92706 WP_003412229.1.92714 WP_003412229.1.92760 WP_003412229.1.92777 WP_003412229.1.92833 WP_003412229.1.92881 WP_003412229.1.92892 WP_003412229.1.92908 WP_003412229.1.9291 WP_003412229.1.92917 WP_003412229.1.93006 WP_003412229.1.93008 WP_003412229.1.9307 WP_003412229.1.93083 WP_003412229.1.93097 WP_003412229.1.93192 WP_003412229.1.93199 WP_003412229.1.93203 WP_003412229.1.93212 WP_003412229.1.93234 WP_003412229.1.93245 WP_003412229.1.93265 WP_003412229.1.93297 WP_003412229.1.93320 WP_003412229.1.93328 WP_003412229.1.93363 WP_003412229.1.93417 WP_003412229.1.93426 WP_003412229.1.9344 WP_003412229.1.93447 WP_003412229.1.93470 WP_003412229.1.93483 WP_003412229.1.93487 WP_003412229.1.93495 WP_003412229.1.93516 WP_003412229.1.93536 WP_003412229.1.93555 WP_003412229.1.93560 WP_003412229.1.9357 WP_003412229.1.93573 WP_003412229.1.93576 WP_003412229.1.93588 WP_003412229.1.93645 WP_003412229.1.93649 WP_003412229.1.93677 WP_003412229.1.9368 WP_003412229.1.93698 WP_003412229.1.93706 WP_003412229.1.9371 WP_003412229.1.93792 WP_003412229.1.93871 WP_003412229.1.9388 WP_003412229.1.93913 WP_003412229.1.93946 WP_003412229.1.93950 WP_003412229.1.93953 WP_003412229.1.93954 WP_003412229.1.93988 WP_003412229.1.9407 WP_003412229.1.94143 WP_003412229.1.94154 WP_003412229.1.94184 WP_003412229.1.94204 WP_003412229.1.94256 WP_003412229.1.94261 WP_003412229.1.94281 WP_003412229.1.94297 WP_003412229.1.9431 WP_003412229.1.94339 WP_003412229.1.94392 WP_003412229.1.94416 WP_003412229.1.94456 WP_003412229.1.94470 WP_003412229.1.94480 WP_003412229.1.94495 WP_003412229.1.94512 WP_003412229.1.94525 WP_003412229.1.94528 WP_003412229.1.94564 WP_003412229.1.946 WP_003412229.1.94602 WP_003412229.1.94623 WP_003412229.1.94629 WP_003412229.1.94714 WP_003412229.1.94730 WP_003412229.1.94736 WP_003412229.1.9478 WP_003412229.1.94834 WP_003412229.1.94852 WP_003412229.1.94872 WP_003412229.1.9488 WP_003412229.1.94902 WP_003412229.1.94916 WP_003412229.1.94996 WP_003412229.1.94998 WP_003412229.1.95007 WP_003412229.1.95010 WP_003412229.1.95068 WP_003412229.1.95081 WP_003412229.1.95082 WP_003412229.1.9509 WP_003412229.1.95096 WP_003412229.1.95112 WP_003412229.1.95138 WP_003412229.1.95188 WP_003412229.1.95234 WP_003412229.1.95241 WP_003412229.1.95245 WP_003412229.1.95257 WP_003412229.1.95279 WP_003412229.1.9531 WP_003412229.1.95335 WP_003412229.1.95344 WP_003412229.1.9535 WP_003412229.1.95370 WP_003412229.1.95392 WP_003412229.1.95416 WP_003412229.1.95417 WP_003412229.1.95491 WP_003412229.1.95497 WP_003412229.1.95508 WP_003412229.1.95509 WP_003412229.1.95529 WP_003412229.1.95556 WP_003412229.1.95557 WP_003412229.1.95565 WP_003412229.1.95578 WP_003412229.1.95580 WP_003412229.1.95585 WP_003412229.1.95643 WP_003412229.1.95679 WP_003412229.1.95685 WP_003412229.1.957 WP_003412229.1.95724 WP_003412229.1.95730 WP_003412229.1.95735 WP_003412229.1.95772 WP_003412229.1.95797 WP_003412229.1.95839 WP_003412229.1.9585 WP_003412229.1.95902 WP_003412229.1.95908 WP_003412229.1.95924 WP_003412229.1.95926 WP_003412229.1.95953 WP_003412229.1.95958 WP_003412229.1.95964 WP_003412229.1.96006 WP_003412229.1.9602 WP_003412229.1.96036 WP_003412229.1.96065 WP_003412229.1.96098 WP_003412229.1.96146 WP_003412229.1.96166 WP_003412229.1.96171 WP_003412229.1.96182 WP_003412229.1.96230 WP_003412229.1.96235 WP_003412229.1.96242 WP_003412229.1.96245 WP_003412229.1.96254 WP_003412229.1.96259 WP_003412229.1.96286 WP_003412229.1.96313 WP_003412229.1.96345 WP_003412229.1.96360 WP_003412229.1.96373 WP_003412229.1.96456 WP_003412229.1.96560 WP_003412229.1.96575 WP_003412229.1.96576 WP_003412229.1.96621 WP_003412229.1.9667 WP_003412229.1.96681 WP_003412229.1.96726 WP_003412229.1.96733 WP_003412229.1.96742 WP_003412229.1.96754 WP_003412229.1.9678 WP_003412229.1.96832 WP_003412229.1.97008 WP_003412229.1.97009 WP_003412229.1.97084 WP_003412229.1.97087 WP_003412229.1.97094 WP_003412229.1.97099 WP_003412229.1.97113 WP_003412229.1.97122 WP_003412229.1.97127 WP_003412229.1.97136 WP_003412229.1.97223 WP_003412229.1.97237 WP_003412229.1.97242 WP_003412229.1.97270 WP_003412229.1.97283 WP_003412229.1.97296 WP_003412229.1.97321 WP_003412229.1.97325 WP_003412229.1.97330 WP_003412229.1.97376 WP_003412229.1.97380 WP_003412229.1.9739 WP_003412229.1.97462 WP_003412229.1.97517 WP_003412229.1.97519 WP_003412229.1.97535 WP_003412229.1.97545 WP_003412229.1.97546 WP_003412229.1.97568 WP_003412229.1.97591 WP_003412229.1.97596 WP_003412229.1.97609 WP_003412229.1.97618 WP_003412229.1.9763 WP_003412229.1.97669 WP_003412229.1.97673 WP_003412229.1.97700 WP_003412229.1.97701 WP_003412229.1.97730 WP_003412229.1.97740 WP_003412229.1.97751 WP_003412229.1.97754 WP_003412229.1.9782 WP_003412229.1.9784 WP_003412229.1.97888 WP_003412229.1.9790 WP_003412229.1.9795 WP_003412229.1.97951 WP_003412229.1.97958 WP_003412229.1.97977 WP_003412229.1.98052 WP_003412229.1.98071 WP_003412229.1.98072 WP_003412229.1.98113 WP_003412229.1.98114 WP_003412229.1.98181 WP_003412229.1.98188 WP_003412229.1.98189 WP_003412229.1.98213 WP_003412229.1.98291 WP_003412229.1.98335 WP_003412229.1.98412 WP_003412229.1.98441 WP_003412229.1.98443 WP_003412229.1.98462 WP_003412229.1.9848 WP_003412229.1.98482 WP_003412229.1.98486 WP_003412229.1.98488 WP_003412229.1.98503 WP_003412229.1.98524 WP_003412229.1.98536 WP_003412229.1.98541 WP_003412229.1.98566 WP_003412229.1.98594 WP_003412229.1.98599 WP_003412229.1.98645 WP_003412229.1.98646 WP_003412229.1.98656 WP_003412229.1.98674 WP_003412229.1.98697 WP_003412229.1.98701 WP_003412229.1.98749 WP_003412229.1.98765 WP_003412229.1.98770 WP_003412229.1.98777 WP_003412229.1.98778 WP_003412229.1.98802 WP_003412229.1.98838 WP_003412229.1.98850 WP_003412229.1.98906 WP_003412229.1.98935 WP_003412229.1.98948 WP_003412229.1.98984 WP_003412229.1.99000 WP_003412229.1.99023 WP_003412229.1.99030 WP_003412229.1.99037 WP_003412229.1.99055 WP_003412229.1.99062 WP_003412229.1.99086 WP_003412229.1.99115 WP_003412229.1.99117 WP_003412229.1.99176 WP_003412229.1.99205 WP_003412229.1.99216 WP_003412229.1.99222 WP_003412229.1.99269 WP_003412229.1.99294 WP_003412229.1.99312 WP_003412229.1.99315 WP_003412229.1.99322 WP_003412229.1.99328 WP_003412229.1.99365 WP_003412229.1.99379 WP_003412229.1.99396 WP_003412229.1.99402 WP_003412229.1.99404 WP_003412229.1.99419 WP_003412229.1.99438 WP_003412229.1.99460 WP_003412229.1.99468 WP_003412229.1.99473 WP_003412229.1.99513 WP_003412229.1.99529 WP_003412229.1.99548 WP_003412229.1.99572 WP_003412229.1.99575 WP_003412229.1.99609 WP_003412229.1.99617 WP_003412229.1.99635 WP_003412229.1.99650 WP_003412229.1.99672 WP_003412229.1.99711 WP_003412229.1.99716 WP_003412229.1.99740 WP_003412229.1.99745 WP_003412229.1.99749 WP_003412229.1.9976 WP_003412229.1.99798 WP_003412229.1.99832 WP_003412229.1.99847 WP_003412229.1.99852 WP_003412229.1.99897 WP_003412229.1.99915 WP_003412229.1.9993 WP_003412229.1.99982 WP_003412229.1.99991 gi|494700801|ref|YP_007966283.1| gi|15609503|ref|NP_216882.1| gi|479056328|ref|YP_007352134.1| gi|449064427|ref|YP_007431510.1| 233413.Mb2387c 336982.TBFG_12392 410289.BCG_2380c 419947.MRA_2390 478434.TBMG_01609 561275.JTY_2374 83332.Rv2366c gi|197740960|ref|YP_002162274.1| gi|378772096|ref|YP_005171829.1| gi|31793543|ref|NP_856036.1| gi|15609503|ref|NP_216882.1| gi|253798556|ref|YP_003031557.1| gi|383308157|ref|YP_005360968.1| gi|121638245|ref|YP_978469.1| gi|385999146|ref|YP_005917445.1| gi|525674948|ref|YP_008226458.1| gi|148823569|ref|YP_001288323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]