SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197742623|ref|YP_002163913.1| from Mycobacterium tuberculosis str. Haarlem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197742623|ref|YP_002163913.1|
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.23e-27
Family PadR-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197742623|ref|YP_002163913.1|
Sequence length 107
Comment hypothetical protein TBHG_03433 [Mycobacterium tuberculosis str. Haarlem]
Sequence
MREFQRAAVRLHILHHAADNEVHGAWLTQELSRHGYRVSPGTLYPTLHRLEADGLLVSEQ
RVVDGRARRVYRATPAGRAALTEDRRALEELAREVLGGQSHTAGNGT
Download sequence
Identical sequences A0A045HAG3 A0A0H3LEW3 A0A109SRX3 A0A120J364 A0A197J0X8 A0A1S1BGQ0 A5U8G3 F8M7S3 G0TIY9 I6X7F9 L0TFS7 M8C8X1 O06351 R4MAU8 R4MNA7
gi|15610624|ref|NP_218005.1| gi|339633491|ref|YP_004725133.1| gi|392433969|ref|YP_006475013.1| gi|385992714|ref|YP_005911012.1| gi|525675921|ref|YP_008227576.1| gi|494701940|ref|YP_007967422.1| Rv3488 gi|386006314|ref|YP_005924593.1| gi|148824696|ref|YP_001289450.1| gi|253800531|ref|YP_003033532.1| gi|148663352|ref|YP_001284875.1| gi|386000275|ref|YP_005918574.1| gi|471339566|ref|YP_007612279.1| gi|392388087|ref|YP_005309716.1| NP_218005.1.84033 WP_003418948.1.100000 WP_003418948.1.100021 WP_003418948.1.100069 WP_003418948.1.100087 WP_003418948.1.10015 WP_003418948.1.100208 WP_003418948.1.100216 WP_003418948.1.10022 WP_003418948.1.100255 WP_003418948.1.100260 WP_003418948.1.100270 WP_003418948.1.100279 WP_003418948.1.100286 WP_003418948.1.100308 WP_003418948.1.100309 WP_003418948.1.100318 WP_003418948.1.100337 WP_003418948.1.100338 WP_003418948.1.10037 WP_003418948.1.100383 WP_003418948.1.100395 WP_003418948.1.100396 WP_003418948.1.1004 WP_003418948.1.100401 WP_003418948.1.100459 WP_003418948.1.100460 WP_003418948.1.100552 WP_003418948.1.100581 WP_003418948.1.100600 WP_003418948.1.100625 WP_003418948.1.10064 WP_003418948.1.100666 WP_003418948.1.100671 WP_003418948.1.100677 WP_003418948.1.100682 WP_003418948.1.100697 WP_003418948.1.100703 WP_003418948.1.100716 WP_003418948.1.100722 WP_003418948.1.100754 WP_003418948.1.100757 WP_003418948.1.100772 WP_003418948.1.1008 WP_003418948.1.100812 WP_003418948.1.100845 WP_003418948.1.100866 WP_003418948.1.10088 WP_003418948.1.100889 WP_003418948.1.10090 WP_003418948.1.100910 WP_003418948.1.100915 WP_003418948.1.100918 WP_003418948.1.100935 WP_003418948.1.100984 WP_003418948.1.100992 WP_003418948.1.100998 WP_003418948.1.101 WP_003418948.1.101025 WP_003418948.1.101028 WP_003418948.1.10104 WP_003418948.1.101048 WP_003418948.1.101054 WP_003418948.1.101075 WP_003418948.1.101143 WP_003418948.1.10116 WP_003418948.1.10117 WP_003418948.1.101209 WP_003418948.1.10125 WP_003418948.1.101290 WP_003418948.1.101323 WP_003418948.1.101324 WP_003418948.1.101350 WP_003418948.1.101367 WP_003418948.1.101398 WP_003418948.1.101403 WP_003418948.1.101421 WP_003418948.1.10144 WP_003418948.1.101442 WP_003418948.1.10145 WP_003418948.1.101452 WP_003418948.1.101456 WP_003418948.1.101481 WP_003418948.1.101493 WP_003418948.1.101496 WP_003418948.1.101525 WP_003418948.1.101533 WP_003418948.1.101535 WP_003418948.1.101553 WP_003418948.1.101558 WP_003418948.1.10156 WP_003418948.1.101573 WP_003418948.1.101576 WP_003418948.1.10159 WP_003418948.1.101592 WP_003418948.1.101604 WP_003418948.1.101607 WP_003418948.1.101622 WP_003418948.1.101644 WP_003418948.1.101659 WP_003418948.1.101671 WP_003418948.1.101687 WP_003418948.1.101698 WP_003418948.1.10170 WP_003418948.1.101713 WP_003418948.1.101722 WP_003418948.1.101733 WP_003418948.1.101743 WP_003418948.1.101753 WP_003418948.1.101754 WP_003418948.1.101764 WP_003418948.1.101795 WP_003418948.1.101797 WP_003418948.1.101798 WP_003418948.1.101802 WP_003418948.1.101826 WP_003418948.1.101836 WP_003418948.1.101858 WP_003418948.1.101859 WP_003418948.1.101862 WP_003418948.1.101888 WP_003418948.1.101894 WP_003418948.1.101899 WP_003418948.1.1019 WP_003418948.1.101923 WP_003418948.1.101925 WP_003418948.1.10193 WP_003418948.1.102 WP_003418948.1.102008 WP_003418948.1.102017 WP_003418948.1.102053 WP_003418948.1.102055 WP_003418948.1.102063 WP_003418948.1.102099 WP_003418948.1.1021 WP_003418948.1.10211 WP_003418948.1.102119 WP_003418948.1.102121 WP_003418948.1.102143 WP_003418948.1.10216 WP_003418948.1.10224 WP_003418948.1.10253 WP_003418948.1.10262 WP_003418948.1.10272 WP_003418948.1.10277 WP_003418948.1.1033 WP_003418948.1.10350 WP_003418948.1.10362 WP_003418948.1.10366 WP_003418948.1.10376 WP_003418948.1.10396 WP_003418948.1.10410 WP_003418948.1.10414 WP_003418948.1.10421 WP_003418948.1.10430 WP_003418948.1.1044 WP_003418948.1.10440 WP_003418948.1.10445 WP_003418948.1.10471 WP_003418948.1.10472 WP_003418948.1.10489 WP_003418948.1.105 WP_003418948.1.10518 WP_003418948.1.10523 WP_003418948.1.10545 WP_003418948.1.1057 WP_003418948.1.10594 WP_003418948.1.10603 WP_003418948.1.10606 WP_003418948.1.10615 WP_003418948.1.10623 WP_003418948.1.10635 WP_003418948.1.10643 WP_003418948.1.10648 WP_003418948.1.10662 WP_003418948.1.10709 WP_003418948.1.10735 WP_003418948.1.10740 WP_003418948.1.10756 WP_003418948.1.1078 WP_003418948.1.10791 WP_003418948.1.10799 WP_003418948.1.10825 WP_003418948.1.10848 WP_003418948.1.10863 WP_003418948.1.10879 WP_003418948.1.10912 WP_003418948.1.10916 WP_003418948.1.10923 WP_003418948.1.10927 WP_003418948.1.1095 WP_003418948.1.10956 WP_003418948.1.10958 WP_003418948.1.10962 WP_003418948.1.10980 WP_003418948.1.10981 WP_003418948.1.10993 WP_003418948.1.1100 WP_003418948.1.11040 WP_003418948.1.11061 WP_003418948.1.11070 WP_003418948.1.11141 WP_003418948.1.11171 WP_003418948.1.11175 WP_003418948.1.11176 WP_003418948.1.11222 WP_003418948.1.11236 WP_003418948.1.11329 WP_003418948.1.1133 WP_003418948.1.11342 WP_003418948.1.11373 WP_003418948.1.11376 WP_003418948.1.11390 WP_003418948.1.11402 WP_003418948.1.11481 WP_003418948.1.11487 WP_003418948.1.11489 WP_003418948.1.11491 WP_003418948.1.11514 WP_003418948.1.11589 WP_003418948.1.11596 WP_003418948.1.11604 WP_003418948.1.11610 WP_003418948.1.11697 WP_003418948.1.11707 WP_003418948.1.11752 WP_003418948.1.11758 WP_003418948.1.11761 WP_003418948.1.11775 WP_003418948.1.11804 WP_003418948.1.11822 WP_003418948.1.11826 WP_003418948.1.11856 WP_003418948.1.11898 WP_003418948.1.11906 WP_003418948.1.11939 WP_003418948.1.11960 WP_003418948.1.11961 WP_003418948.1.11972 WP_003418948.1.11984 WP_003418948.1.120 WP_003418948.1.12001 WP_003418948.1.12049 WP_003418948.1.12052 WP_003418948.1.12100 WP_003418948.1.12116 WP_003418948.1.12130 WP_003418948.1.12133 WP_003418948.1.12161 WP_003418948.1.12165 WP_003418948.1.12184 WP_003418948.1.12190 WP_003418948.1.12216 WP_003418948.1.12265 WP_003418948.1.12275 WP_003418948.1.12293 WP_003418948.1.12294 WP_003418948.1.123 WP_003418948.1.1231 WP_003418948.1.12314 WP_003418948.1.12327 WP_003418948.1.12338 WP_003418948.1.1236 WP_003418948.1.12371 WP_003418948.1.12372 WP_003418948.1.12389 WP_003418948.1.12406 WP_003418948.1.1241 WP_003418948.1.12421 WP_003418948.1.12424 WP_003418948.1.12446 WP_003418948.1.12464 WP_003418948.1.12479 WP_003418948.1.12519 WP_003418948.1.12523 WP_003418948.1.12526 WP_003418948.1.1255 WP_003418948.1.12550 WP_003418948.1.12551 WP_003418948.1.12563 WP_003418948.1.12611 WP_003418948.1.12669 WP_003418948.1.1267 WP_003418948.1.12672 WP_003418948.1.12692 WP_003418948.1.1271 WP_003418948.1.12768 WP_003418948.1.1279 WP_003418948.1.12794 WP_003418948.1.12804 WP_003418948.1.12821 WP_003418948.1.12841 WP_003418948.1.12854 WP_003418948.1.12871 WP_003418948.1.12901 WP_003418948.1.12941 WP_003418948.1.12947 WP_003418948.1.12957 WP_003418948.1.12972 WP_003418948.1.13028 WP_003418948.1.13043 WP_003418948.1.13086 WP_003418948.1.13087 WP_003418948.1.13090 WP_003418948.1.13096 WP_003418948.1.13163 WP_003418948.1.13175 WP_003418948.1.13183 WP_003418948.1.132 WP_003418948.1.13249 WP_003418948.1.13282 WP_003418948.1.13284 WP_003418948.1.13296 WP_003418948.1.13298 WP_003418948.1.13302 WP_003418948.1.13306 WP_003418948.1.13312 WP_003418948.1.13313 WP_003418948.1.13321 WP_003418948.1.13345 WP_003418948.1.13358 WP_003418948.1.13370 WP_003418948.1.13375 WP_003418948.1.1338 WP_003418948.1.13420 WP_003418948.1.13433 WP_003418948.1.13435 WP_003418948.1.13438 WP_003418948.1.13461 WP_003418948.1.13466 WP_003418948.1.13489 WP_003418948.1.13526 WP_003418948.1.13551 WP_003418948.1.13561 WP_003418948.1.13564 WP_003418948.1.13579 WP_003418948.1.13647 WP_003418948.1.13687 WP_003418948.1.13719 WP_003418948.1.13763 WP_003418948.1.1377 WP_003418948.1.13774 WP_003418948.1.13786 WP_003418948.1.13793 WP_003418948.1.13794 WP_003418948.1.13817 WP_003418948.1.13834 WP_003418948.1.13866 WP_003418948.1.13880 WP_003418948.1.13899 WP_003418948.1.13909 WP_003418948.1.13910 WP_003418948.1.13919 WP_003418948.1.13920 WP_003418948.1.13952 WP_003418948.1.13953 WP_003418948.1.13962 WP_003418948.1.1398 WP_003418948.1.13988 WP_003418948.1.14027 WP_003418948.1.14046 WP_003418948.1.14115 WP_003418948.1.1415 WP_003418948.1.14152 WP_003418948.1.14158 WP_003418948.1.14162 WP_003418948.1.14175 WP_003418948.1.14178 WP_003418948.1.14194 WP_003418948.1.14195 WP_003418948.1.14208 WP_003418948.1.14238 WP_003418948.1.14266 WP_003418948.1.14273 WP_003418948.1.14303 WP_003418948.1.14306 WP_003418948.1.14307 WP_003418948.1.14310 WP_003418948.1.14341 WP_003418948.1.14382 WP_003418948.1.14416 WP_003418948.1.14428 WP_003418948.1.14441 WP_003418948.1.14469 WP_003418948.1.14477 WP_003418948.1.14504 WP_003418948.1.14514 WP_003418948.1.1452 WP_003418948.1.14527 WP_003418948.1.1454 WP_003418948.1.14544 WP_003418948.1.14548 WP_003418948.1.14551 WP_003418948.1.14561 WP_003418948.1.14573 WP_003418948.1.1462 WP_003418948.1.14667 WP_003418948.1.14668 WP_003418948.1.14675 WP_003418948.1.14694 WP_003418948.1.14695 WP_003418948.1.14709 WP_003418948.1.14766 WP_003418948.1.14783 WP_003418948.1.14865 WP_003418948.1.14872 WP_003418948.1.14905 WP_003418948.1.14926 WP_003418948.1.14951 WP_003418948.1.14955 WP_003418948.1.15003 WP_003418948.1.15009 WP_003418948.1.15028 WP_003418948.1.15040 WP_003418948.1.15052 WP_003418948.1.15065 WP_003418948.1.15072 WP_003418948.1.15089 WP_003418948.1.1509 WP_003418948.1.15126 WP_003418948.1.15131 WP_003418948.1.15168 WP_003418948.1.15172 WP_003418948.1.15174 WP_003418948.1.15187 WP_003418948.1.15196 WP_003418948.1.15210 WP_003418948.1.15216 WP_003418948.1.15217 WP_003418948.1.1523 WP_003418948.1.15232 WP_003418948.1.15238 WP_003418948.1.15240 WP_003418948.1.15253 WP_003418948.1.15267 WP_003418948.1.1527 WP_003418948.1.15292 WP_003418948.1.15299 WP_003418948.1.15302 WP_003418948.1.15322 WP_003418948.1.1534 WP_003418948.1.15365 WP_003418948.1.15372 WP_003418948.1.15386 WP_003418948.1.15387 WP_003418948.1.15442 WP_003418948.1.15447 WP_003418948.1.15449 WP_003418948.1.15477 WP_003418948.1.15481 WP_003418948.1.15492 WP_003418948.1.15511 WP_003418948.1.15512 WP_003418948.1.15558 WP_003418948.1.15559 WP_003418948.1.15566 WP_003418948.1.15599 WP_003418948.1.1560 WP_003418948.1.15611 WP_003418948.1.1563 WP_003418948.1.15633 WP_003418948.1.15643 WP_003418948.1.15688 WP_003418948.1.15755 WP_003418948.1.15763 WP_003418948.1.15774 WP_003418948.1.1578 WP_003418948.1.15780 WP_003418948.1.15827 WP_003418948.1.15834 WP_003418948.1.15842 WP_003418948.1.15848 WP_003418948.1.15853 WP_003418948.1.15870 WP_003418948.1.15877 WP_003418948.1.15893 WP_003418948.1.15896 WP_003418948.1.15926 WP_003418948.1.15933 WP_003418948.1.15946 WP_003418948.1.15958 WP_003418948.1.15973 WP_003418948.1.15993 WP_003418948.1.16009 WP_003418948.1.16025 WP_003418948.1.16043 WP_003418948.1.16055 WP_003418948.1.16066 WP_003418948.1.16069 WP_003418948.1.16077 WP_003418948.1.16106 WP_003418948.1.16108 WP_003418948.1.16110 WP_003418948.1.16130 WP_003418948.1.16136 WP_003418948.1.16139 WP_003418948.1.16141 WP_003418948.1.16143 WP_003418948.1.1630 WP_003418948.1.16318 WP_003418948.1.1632 WP_003418948.1.16327 WP_003418948.1.16334 WP_003418948.1.16341 WP_003418948.1.16345 WP_003418948.1.16374 WP_003418948.1.16384 WP_003418948.1.16386 WP_003418948.1.164 WP_003418948.1.1642 WP_003418948.1.16421 WP_003418948.1.16424 WP_003418948.1.16426 WP_003418948.1.16431 WP_003418948.1.16438 WP_003418948.1.1644 WP_003418948.1.16442 WP_003418948.1.16448 WP_003418948.1.16451 WP_003418948.1.16476 WP_003418948.1.16480 WP_003418948.1.16494 WP_003418948.1.1652 WP_003418948.1.16549 WP_003418948.1.16560 WP_003418948.1.16598 WP_003418948.1.16609 WP_003418948.1.16619 WP_003418948.1.16620 WP_003418948.1.16622 WP_003418948.1.16637 WP_003418948.1.1669 WP_003418948.1.16707 WP_003418948.1.16724 WP_003418948.1.16731 WP_003418948.1.16743 WP_003418948.1.1683 WP_003418948.1.16837 WP_003418948.1.16852 WP_003418948.1.16937 WP_003418948.1.16940 WP_003418948.1.16950 WP_003418948.1.16959 WP_003418948.1.16968 WP_003418948.1.1697 WP_003418948.1.16977 WP_003418948.1.16987 WP_003418948.1.17005 WP_003418948.1.17006 WP_003418948.1.17010 WP_003418948.1.17015 WP_003418948.1.17019 WP_003418948.1.17041 WP_003418948.1.17052 WP_003418948.1.17057 WP_003418948.1.17062 WP_003418948.1.1707 WP_003418948.1.17094 WP_003418948.1.17130 WP_003418948.1.17138 WP_003418948.1.17147 WP_003418948.1.17167 WP_003418948.1.17224 WP_003418948.1.17251 WP_003418948.1.17288 WP_003418948.1.17304 WP_003418948.1.17345 WP_003418948.1.17381 WP_003418948.1.17391 WP_003418948.1.17412 WP_003418948.1.1743 WP_003418948.1.17440 WP_003418948.1.17466 WP_003418948.1.17477 WP_003418948.1.17483 WP_003418948.1.17505 WP_003418948.1.17527 WP_003418948.1.17535 WP_003418948.1.17540 WP_003418948.1.17553 WP_003418948.1.17558 WP_003418948.1.17599 WP_003418948.1.17635 WP_003418948.1.17655 WP_003418948.1.17679 WP_003418948.1.1768 WP_003418948.1.17687 WP_003418948.1.17700 WP_003418948.1.17710 WP_003418948.1.17713 WP_003418948.1.17722 WP_003418948.1.17746 WP_003418948.1.17788 WP_003418948.1.17798 WP_003418948.1.17803 WP_003418948.1.17816 WP_003418948.1.17821 WP_003418948.1.17830 WP_003418948.1.17868 WP_003418948.1.17878 WP_003418948.1.1792 WP_003418948.1.17923 WP_003418948.1.1795 WP_003418948.1.17955 WP_003418948.1.17973 WP_003418948.1.18009 WP_003418948.1.18013 WP_003418948.1.18033 WP_003418948.1.18057 WP_003418948.1.18065 WP_003418948.1.18070 WP_003418948.1.18116 WP_003418948.1.18120 WP_003418948.1.18126 WP_003418948.1.1817 WP_003418948.1.18170 WP_003418948.1.18206 WP_003418948.1.18216 WP_003418948.1.18240 WP_003418948.1.18257 WP_003418948.1.18297 WP_003418948.1.18306 WP_003418948.1.18364 WP_003418948.1.18399 WP_003418948.1.18411 WP_003418948.1.18444 WP_003418948.1.18448 WP_003418948.1.18467 WP_003418948.1.18476 WP_003418948.1.18522 WP_003418948.1.18580 WP_003418948.1.18582 WP_003418948.1.18587 WP_003418948.1.186 WP_003418948.1.18601 WP_003418948.1.18639 WP_003418948.1.18646 WP_003418948.1.18647 WP_003418948.1.1868 WP_003418948.1.18694 WP_003418948.1.18710 WP_003418948.1.18751 WP_003418948.1.18781 WP_003418948.1.18793 WP_003418948.1.18804 WP_003418948.1.18816 WP_003418948.1.18823 WP_003418948.1.18827 WP_003418948.1.18838 WP_003418948.1.18849 WP_003418948.1.18856 WP_003418948.1.18945 WP_003418948.1.1898 WP_003418948.1.19005 WP_003418948.1.19056 WP_003418948.1.19063 WP_003418948.1.19066 WP_003418948.1.19071 WP_003418948.1.19085 WP_003418948.1.19094 WP_003418948.1.19144 WP_003418948.1.19159 WP_003418948.1.19193 WP_003418948.1.19231 WP_003418948.1.19243 WP_003418948.1.19264 WP_003418948.1.19295 WP_003418948.1.19307 WP_003418948.1.19326 WP_003418948.1.1933 WP_003418948.1.19364 WP_003418948.1.19382 WP_003418948.1.19400 WP_003418948.1.19426 WP_003418948.1.19429 WP_003418948.1.19464 WP_003418948.1.19480 WP_003418948.1.19512 WP_003418948.1.19553 WP_003418948.1.19562 WP_003418948.1.19564 WP_003418948.1.19568 WP_003418948.1.19572 WP_003418948.1.19595 WP_003418948.1.19596 WP_003418948.1.19600 WP_003418948.1.19630 WP_003418948.1.1967 WP_003418948.1.19694 WP_003418948.1.1970 WP_003418948.1.19707 WP_003418948.1.19742 WP_003418948.1.19785 WP_003418948.1.19820 WP_003418948.1.19868 WP_003418948.1.19874 WP_003418948.1.19890 WP_003418948.1.19900 WP_003418948.1.19922 WP_003418948.1.19936 WP_003418948.1.19946 WP_003418948.1.19949 WP_003418948.1.19960 WP_003418948.1.19964 WP_003418948.1.20007 WP_003418948.1.20016 WP_003418948.1.20028 WP_003418948.1.2003 WP_003418948.1.20037 WP_003418948.1.20039 WP_003418948.1.20082 WP_003418948.1.20085 WP_003418948.1.20097 WP_003418948.1.20116 WP_003418948.1.20130 WP_003418948.1.20140 WP_003418948.1.20141 WP_003418948.1.20142 WP_003418948.1.20158 WP_003418948.1.20239 WP_003418948.1.20243 WP_003418948.1.20259 WP_003418948.1.20262 WP_003418948.1.20268 WP_003418948.1.20272 WP_003418948.1.20273 WP_003418948.1.20280 WP_003418948.1.20294 WP_003418948.1.20300 WP_003418948.1.20309 WP_003418948.1.20322 WP_003418948.1.2037 WP_003418948.1.20372 WP_003418948.1.20381 WP_003418948.1.204 WP_003418948.1.20427 WP_003418948.1.20432 WP_003418948.1.20457 WP_003418948.1.20459 WP_003418948.1.20460 WP_003418948.1.20542 WP_003418948.1.20578 WP_003418948.1.20608 WP_003418948.1.20624 WP_003418948.1.20628 WP_003418948.1.2066 WP_003418948.1.20707 WP_003418948.1.20722 WP_003418948.1.20729 WP_003418948.1.20742 WP_003418948.1.20751 WP_003418948.1.20776 WP_003418948.1.20843 WP_003418948.1.20850 WP_003418948.1.2086 WP_003418948.1.20868 WP_003418948.1.20876 WP_003418948.1.20897 WP_003418948.1.20898 WP_003418948.1.2090 WP_003418948.1.20911 WP_003418948.1.20916 WP_003418948.1.20921 WP_003418948.1.20926 WP_003418948.1.20927 WP_003418948.1.20951 WP_003418948.1.20970 WP_003418948.1.2104 WP_003418948.1.21070 WP_003418948.1.21127 WP_003418948.1.21135 WP_003418948.1.21173 WP_003418948.1.21187 WP_003418948.1.212 WP_003418948.1.2120 WP_003418948.1.21218 WP_003418948.1.21219 WP_003418948.1.2123 WP_003418948.1.21231 WP_003418948.1.21234 WP_003418948.1.2126 WP_003418948.1.21292 WP_003418948.1.21307 WP_003418948.1.2131 WP_003418948.1.21311 WP_003418948.1.21321 WP_003418948.1.21365 WP_003418948.1.2137 WP_003418948.1.21392 WP_003418948.1.21397 WP_003418948.1.21403 WP_003418948.1.21415 WP_003418948.1.21418 WP_003418948.1.21430 WP_003418948.1.21434 WP_003418948.1.21444 WP_003418948.1.21468 WP_003418948.1.21498 WP_003418948.1.21509 WP_003418948.1.21513 WP_003418948.1.21560 WP_003418948.1.21565 WP_003418948.1.21586 WP_003418948.1.21591 WP_003418948.1.21594 WP_003418948.1.21602 WP_003418948.1.21615 WP_003418948.1.21638 WP_003418948.1.21639 WP_003418948.1.21655 WP_003418948.1.21658 WP_003418948.1.2168 WP_003418948.1.2174 WP_003418948.1.21741 WP_003418948.1.21777 WP_003418948.1.21786 WP_003418948.1.21795 WP_003418948.1.218 WP_003418948.1.21826 WP_003418948.1.21829 WP_003418948.1.21840 WP_003418948.1.21843 WP_003418948.1.21872 WP_003418948.1.21873 WP_003418948.1.2188 WP_003418948.1.21882 WP_003418948.1.21906 WP_003418948.1.21912 WP_003418948.1.2194 WP_003418948.1.21941 WP_003418948.1.21956 WP_003418948.1.21958 WP_003418948.1.21960 WP_003418948.1.21971 WP_003418948.1.21973 WP_003418948.1.21983 WP_003418948.1.22003 WP_003418948.1.22013 WP_003418948.1.22025 WP_003418948.1.22036 WP_003418948.1.22075 WP_003418948.1.22092 WP_003418948.1.2212 WP_003418948.1.22127 WP_003418948.1.22140 WP_003418948.1.22233 WP_003418948.1.22255 WP_003418948.1.22277 WP_003418948.1.22305 WP_003418948.1.22348 WP_003418948.1.22356 WP_003418948.1.22366 WP_003418948.1.2238 WP_003418948.1.22380 WP_003418948.1.22437 WP_003418948.1.22438 WP_003418948.1.22445 WP_003418948.1.22490 WP_003418948.1.22511 WP_003418948.1.22524 WP_003418948.1.2253 WP_003418948.1.22585 WP_003418948.1.22589 WP_003418948.1.22606 WP_003418948.1.22608 WP_003418948.1.22609 WP_003418948.1.22618 WP_003418948.1.2262 WP_003418948.1.22624 WP_003418948.1.22629 WP_003418948.1.22647 WP_003418948.1.22664 WP_003418948.1.22665 WP_003418948.1.22670 WP_003418948.1.22674 WP_003418948.1.22725 WP_003418948.1.22728 WP_003418948.1.22733 WP_003418948.1.22737 WP_003418948.1.2275 WP_003418948.1.22754 WP_003418948.1.22797 WP_003418948.1.22800 WP_003418948.1.22804 WP_003418948.1.22829 WP_003418948.1.22840 WP_003418948.1.22844 WP_003418948.1.22963 WP_003418948.1.22970 WP_003418948.1.22996 WP_003418948.1.22997 WP_003418948.1.22999 WP_003418948.1.23015 WP_003418948.1.23032 WP_003418948.1.231 WP_003418948.1.23101 WP_003418948.1.2312 WP_003418948.1.23153 WP_003418948.1.23171 WP_003418948.1.23199 WP_003418948.1.2320 WP_003418948.1.23204 WP_003418948.1.23216 WP_003418948.1.23229 WP_003418948.1.23233 WP_003418948.1.2326 WP_003418948.1.23261 WP_003418948.1.23272 WP_003418948.1.23289 WP_003418948.1.2329 WP_003418948.1.23308 WP_003418948.1.23316 WP_003418948.1.23321 WP_003418948.1.23325 WP_003418948.1.2339 WP_003418948.1.23406 WP_003418948.1.23438 WP_003418948.1.23445 WP_003418948.1.23447 WP_003418948.1.23452 WP_003418948.1.23461 WP_003418948.1.2349 WP_003418948.1.23496 WP_003418948.1.23506 WP_003418948.1.23530 WP_003418948.1.23539 WP_003418948.1.23546 WP_003418948.1.23551 WP_003418948.1.23573 WP_003418948.1.23583 WP_003418948.1.23588 WP_003418948.1.23628 WP_003418948.1.23677 WP_003418948.1.23683 WP_003418948.1.23692 WP_003418948.1.23694 WP_003418948.1.23699 WP_003418948.1.2371 WP_003418948.1.23803 WP_003418948.1.23807 WP_003418948.1.23825 WP_003418948.1.23832 WP_003418948.1.2384 WP_003418948.1.23843 WP_003418948.1.23863 WP_003418948.1.2387 WP_003418948.1.23894 WP_003418948.1.23993 WP_003418948.1.2400 WP_003418948.1.24007 WP_003418948.1.24008 WP_003418948.1.24046 WP_003418948.1.24057 WP_003418948.1.24113 WP_003418948.1.24119 WP_003418948.1.24128 WP_003418948.1.24140 WP_003418948.1.24176 WP_003418948.1.24190 WP_003418948.1.24202 WP_003418948.1.24244 WP_003418948.1.24261 WP_003418948.1.24284 WP_003418948.1.24294 WP_003418948.1.24357 WP_003418948.1.24396 WP_003418948.1.24414 WP_003418948.1.24423 WP_003418948.1.2443 WP_003418948.1.24446 WP_003418948.1.24461 WP_003418948.1.24507 WP_003418948.1.24509 WP_003418948.1.24529 WP_003418948.1.24553 WP_003418948.1.24599 WP_003418948.1.24629 WP_003418948.1.24638 WP_003418948.1.24648 WP_003418948.1.2466 WP_003418948.1.24767 WP_003418948.1.24824 WP_003418948.1.24831 WP_003418948.1.24840 WP_003418948.1.24848 WP_003418948.1.24857 WP_003418948.1.2487 WP_003418948.1.24893 WP_003418948.1.24907 WP_003418948.1.24933 WP_003418948.1.24956 WP_003418948.1.24958 WP_003418948.1.24985 WP_003418948.1.2499 WP_003418948.1.25004 WP_003418948.1.2505 WP_003418948.1.25051 WP_003418948.1.2507 WP_003418948.1.25096 WP_003418948.1.25103 WP_003418948.1.25129 WP_003418948.1.25171 WP_003418948.1.25184 WP_003418948.1.25247 WP_003418948.1.25252 WP_003418948.1.25278 WP_003418948.1.25283 WP_003418948.1.25309 WP_003418948.1.25313 WP_003418948.1.25338 WP_003418948.1.25342 WP_003418948.1.25343 WP_003418948.1.25367 WP_003418948.1.25393 WP_003418948.1.25406 WP_003418948.1.25435 WP_003418948.1.25437 WP_003418948.1.25445 WP_003418948.1.25455 WP_003418948.1.25473 WP_003418948.1.25504 WP_003418948.1.25513 WP_003418948.1.25542 WP_003418948.1.25579 WP_003418948.1.25606 WP_003418948.1.25645 WP_003418948.1.2566 WP_003418948.1.25673 WP_003418948.1.25674 WP_003418948.1.25693 WP_003418948.1.25699 WP_003418948.1.25727 WP_003418948.1.25736 WP_003418948.1.25738 WP_003418948.1.25756 WP_003418948.1.25759 WP_003418948.1.2580 WP_003418948.1.25813 WP_003418948.1.25853 WP_003418948.1.25854 WP_003418948.1.25874 WP_003418948.1.25885 WP_003418948.1.25892 WP_003418948.1.25906 WP_003418948.1.25914 WP_003418948.1.25916 WP_003418948.1.2594 WP_003418948.1.25954 WP_003418948.1.25972 WP_003418948.1.26017 WP_003418948.1.26032 WP_003418948.1.26038 WP_003418948.1.26072 WP_003418948.1.26089 WP_003418948.1.26097 WP_003418948.1.26098 WP_003418948.1.26108 WP_003418948.1.26109 WP_003418948.1.26118 WP_003418948.1.26126 WP_003418948.1.2614 WP_003418948.1.26168 WP_003418948.1.26182 WP_003418948.1.26190 WP_003418948.1.2620 WP_003418948.1.26234 WP_003418948.1.26243 WP_003418948.1.26267 WP_003418948.1.26292 WP_003418948.1.26310 WP_003418948.1.26328 WP_003418948.1.26349 WP_003418948.1.26366 WP_003418948.1.26374 WP_003418948.1.26407 WP_003418948.1.26454 WP_003418948.1.26464 WP_003418948.1.2653 WP_003418948.1.26560 WP_003418948.1.26571 WP_003418948.1.2659 WP_003418948.1.26597 WP_003418948.1.26603 WP_003418948.1.26629 WP_003418948.1.26651 WP_003418948.1.26702 WP_003418948.1.26707 WP_003418948.1.26710 WP_003418948.1.26719 WP_003418948.1.26737 WP_003418948.1.26738 WP_003418948.1.26745 WP_003418948.1.26756 WP_003418948.1.2676 WP_003418948.1.2677 WP_003418948.1.26779 WP_003418948.1.26780 WP_003418948.1.26798 WP_003418948.1.26854 WP_003418948.1.26868 WP_003418948.1.26876 WP_003418948.1.26888 WP_003418948.1.26914 WP_003418948.1.26945 WP_003418948.1.26959 WP_003418948.1.26969 WP_003418948.1.26984 WP_003418948.1.26992 WP_003418948.1.27004 WP_003418948.1.27017 WP_003418948.1.27045 WP_003418948.1.27074 WP_003418948.1.27075 WP_003418948.1.27128 WP_003418948.1.27130 WP_003418948.1.27139 WP_003418948.1.27152 WP_003418948.1.27162 WP_003418948.1.27164 WP_003418948.1.27193 WP_003418948.1.27235 WP_003418948.1.27278 WP_003418948.1.27343 WP_003418948.1.27352 WP_003418948.1.27369 WP_003418948.1.27391 WP_003418948.1.27398 WP_003418948.1.27402 WP_003418948.1.27410 WP_003418948.1.27411 WP_003418948.1.27449 WP_003418948.1.27460 WP_003418948.1.27463 WP_003418948.1.2749 WP_003418948.1.27492 WP_003418948.1.27528 WP_003418948.1.27541 WP_003418948.1.27576 WP_003418948.1.27582 WP_003418948.1.27596 WP_003418948.1.27607 WP_003418948.1.2766 WP_003418948.1.277 WP_003418948.1.27724 WP_003418948.1.27730 WP_003418948.1.27736 WP_003418948.1.27743 WP_003418948.1.27750 WP_003418948.1.27771 WP_003418948.1.27779 WP_003418948.1.27795 WP_003418948.1.27803 WP_003418948.1.27819 WP_003418948.1.27915 WP_003418948.1.27935 WP_003418948.1.27962 WP_003418948.1.28053 WP_003418948.1.28092 WP_003418948.1.28106 WP_003418948.1.28131 WP_003418948.1.28142 WP_003418948.1.28159 WP_003418948.1.2816 WP_003418948.1.28161 WP_003418948.1.28192 WP_003418948.1.28202 WP_003418948.1.28241 WP_003418948.1.28242 WP_003418948.1.28251 WP_003418948.1.28255 WP_003418948.1.28269 WP_003418948.1.28293 WP_003418948.1.28331 WP_003418948.1.28367 WP_003418948.1.28378 WP_003418948.1.28391 WP_003418948.1.2842 WP_003418948.1.28448 WP_003418948.1.2847 WP_003418948.1.28471 WP_003418948.1.28473 WP_003418948.1.28493 WP_003418948.1.28497 WP_003418948.1.28530 WP_003418948.1.28545 WP_003418948.1.28561 WP_003418948.1.28567 WP_003418948.1.28585 WP_003418948.1.286 WP_003418948.1.28610 WP_003418948.1.28617 WP_003418948.1.28634 WP_003418948.1.28642 WP_003418948.1.28671 WP_003418948.1.28682 WP_003418948.1.28698 WP_003418948.1.28703 WP_003418948.1.28739 WP_003418948.1.28758 WP_003418948.1.28781 WP_003418948.1.28787 WP_003418948.1.28827 WP_003418948.1.28839 WP_003418948.1.28847 WP_003418948.1.28850 WP_003418948.1.28851 WP_003418948.1.28865 WP_003418948.1.28897 WP_003418948.1.28914 WP_003418948.1.28935 WP_003418948.1.28936 WP_003418948.1.28939 WP_003418948.1.28943 WP_003418948.1.28952 WP_003418948.1.28975 WP_003418948.1.2899 WP_003418948.1.28993 WP_003418948.1.29000 WP_003418948.1.2901 WP_003418948.1.29028 WP_003418948.1.29033 WP_003418948.1.29058 WP_003418948.1.29078 WP_003418948.1.29102 WP_003418948.1.29115 WP_003418948.1.2916 WP_003418948.1.29217 WP_003418948.1.29223 WP_003418948.1.29234 WP_003418948.1.29264 WP_003418948.1.29275 WP_003418948.1.29306 WP_003418948.1.29339 WP_003418948.1.29348 WP_003418948.1.29364 WP_003418948.1.29367 WP_003418948.1.2938 WP_003418948.1.29399 WP_003418948.1.29426 WP_003418948.1.2944 WP_003418948.1.29449 WP_003418948.1.29450 WP_003418948.1.29452 WP_003418948.1.29510 WP_003418948.1.29515 WP_003418948.1.29525 WP_003418948.1.2953 WP_003418948.1.29587 WP_003418948.1.2959 WP_003418948.1.29592 WP_003418948.1.29599 WP_003418948.1.29611 WP_003418948.1.29632 WP_003418948.1.29649 WP_003418948.1.2965 WP_003418948.1.29659 WP_003418948.1.2969 WP_003418948.1.29696 WP_003418948.1.29698 WP_003418948.1.29718 WP_003418948.1.29742 WP_003418948.1.29745 WP_003418948.1.29747 WP_003418948.1.29769 WP_003418948.1.29825 WP_003418948.1.29830 WP_003418948.1.29847 WP_003418948.1.29861 WP_003418948.1.29869 WP_003418948.1.29883 WP_003418948.1.29890 WP_003418948.1.299 WP_003418948.1.29931 WP_003418948.1.29960 WP_003418948.1.30014 WP_003418948.1.3004 WP_003418948.1.30040 WP_003418948.1.30043 WP_003418948.1.30074 WP_003418948.1.30097 WP_003418948.1.30101 WP_003418948.1.30106 WP_003418948.1.30114 WP_003418948.1.30126 WP_003418948.1.30131 WP_003418948.1.30139 WP_003418948.1.30145 WP_003418948.1.30211 WP_003418948.1.30224 WP_003418948.1.30235 WP_003418948.1.30237 WP_003418948.1.3027 WP_003418948.1.30279 WP_003418948.1.30282 WP_003418948.1.30283 WP_003418948.1.30291 WP_003418948.1.30363 WP_003418948.1.30374 WP_003418948.1.30404 WP_003418948.1.3043 WP_003418948.1.30433 WP_003418948.1.30438 WP_003418948.1.30462 WP_003418948.1.30464 WP_003418948.1.30468 WP_003418948.1.30500 WP_003418948.1.3057 WP_003418948.1.30574 WP_003418948.1.30628 WP_003418948.1.30641 WP_003418948.1.30642 WP_003418948.1.30661 WP_003418948.1.30683 WP_003418948.1.30699 WP_003418948.1.30709 WP_003418948.1.30713 WP_003418948.1.30716 WP_003418948.1.30719 WP_003418948.1.30730 WP_003418948.1.30736 WP_003418948.1.30745 WP_003418948.1.30760 WP_003418948.1.30791 WP_003418948.1.308 WP_003418948.1.30807 WP_003418948.1.30818 WP_003418948.1.30824 WP_003418948.1.30877 WP_003418948.1.30888 WP_003418948.1.30901 WP_003418948.1.30903 WP_003418948.1.30912 WP_003418948.1.30913 WP_003418948.1.30914 WP_003418948.1.30919 WP_003418948.1.30977 WP_003418948.1.3100 WP_003418948.1.31002 WP_003418948.1.3101 WP_003418948.1.31034 WP_003418948.1.31047 WP_003418948.1.31070 WP_003418948.1.31074 WP_003418948.1.31102 WP_003418948.1.31127 WP_003418948.1.31184 WP_003418948.1.31199 WP_003418948.1.31226 WP_003418948.1.31230 WP_003418948.1.31233 WP_003418948.1.31263 WP_003418948.1.31264 WP_003418948.1.31270 WP_003418948.1.31287 WP_003418948.1.31290 WP_003418948.1.31304 WP_003418948.1.31346 WP_003418948.1.31348 WP_003418948.1.31354 WP_003418948.1.31390 WP_003418948.1.31414 WP_003418948.1.31417 WP_003418948.1.31428 WP_003418948.1.3143 WP_003418948.1.31458 WP_003418948.1.31483 WP_003418948.1.3149 WP_003418948.1.31498 WP_003418948.1.31507 WP_003418948.1.31537 WP_003418948.1.31548 WP_003418948.1.31569 WP_003418948.1.31573 WP_003418948.1.316 WP_003418948.1.31629 WP_003418948.1.31666 WP_003418948.1.31693 WP_003418948.1.31703 WP_003418948.1.31744 WP_003418948.1.31745 WP_003418948.1.31770 WP_003418948.1.31776 WP_003418948.1.31783 WP_003418948.1.318 WP_003418948.1.3184 WP_003418948.1.31840 WP_003418948.1.31880 WP_003418948.1.31911 WP_003418948.1.31930 WP_003418948.1.31932 WP_003418948.1.31955 WP_003418948.1.31985 WP_003418948.1.31991 WP_003418948.1.31995 WP_003418948.1.32004 WP_003418948.1.32039 WP_003418948.1.3204 WP_003418948.1.32045 WP_003418948.1.32071 WP_003418948.1.32098 WP_003418948.1.32132 WP_003418948.1.32157 WP_003418948.1.32164 WP_003418948.1.32179 WP_003418948.1.32198 WP_003418948.1.32297 WP_003418948.1.32317 WP_003418948.1.32383 WP_003418948.1.32400 WP_003418948.1.32403 WP_003418948.1.32416 WP_003418948.1.32421 WP_003418948.1.32433 WP_003418948.1.32461 WP_003418948.1.32482 WP_003418948.1.32503 WP_003418948.1.32556 WP_003418948.1.32562 WP_003418948.1.32569 WP_003418948.1.32592 WP_003418948.1.32620 WP_003418948.1.32647 WP_003418948.1.32653 WP_003418948.1.32654 WP_003418948.1.3268 WP_003418948.1.32695 WP_003418948.1.32706 WP_003418948.1.32716 WP_003418948.1.32738 WP_003418948.1.32752 WP_003418948.1.32780 WP_003418948.1.32781 WP_003418948.1.32793 WP_003418948.1.32799 WP_003418948.1.32833 WP_003418948.1.32862 WP_003418948.1.32880 WP_003418948.1.32897 WP_003418948.1.32909 WP_003418948.1.32935 WP_003418948.1.32974 WP_003418948.1.33007 WP_003418948.1.3302 WP_003418948.1.33028 WP_003418948.1.33035 WP_003418948.1.33044 WP_003418948.1.33054 WP_003418948.1.33082 WP_003418948.1.33141 WP_003418948.1.33148 WP_003418948.1.33155 WP_003418948.1.33168 WP_003418948.1.3321 WP_003418948.1.33215 WP_003418948.1.3325 WP_003418948.1.3327 WP_003418948.1.33278 WP_003418948.1.33288 WP_003418948.1.33305 WP_003418948.1.3331 WP_003418948.1.33319 WP_003418948.1.3333 WP_003418948.1.33393 WP_003418948.1.33403 WP_003418948.1.33452 WP_003418948.1.33467 WP_003418948.1.33477 WP_003418948.1.3349 WP_003418948.1.33519 WP_003418948.1.33542 WP_003418948.1.33601 WP_003418948.1.33602 WP_003418948.1.33633 WP_003418948.1.33646 WP_003418948.1.33673 WP_003418948.1.3369 WP_003418948.1.33705 WP_003418948.1.33762 WP_003418948.1.33783 WP_003418948.1.33789 WP_003418948.1.3383 WP_003418948.1.33832 WP_003418948.1.33839 WP_003418948.1.33848 WP_003418948.1.3387 WP_003418948.1.33886 WP_003418948.1.33895 WP_003418948.1.33906 WP_003418948.1.33912 WP_003418948.1.33954 WP_003418948.1.3399 WP_003418948.1.34042 WP_003418948.1.3405 WP_003418948.1.34055 WP_003418948.1.34056 WP_003418948.1.34065 WP_003418948.1.34090 WP_003418948.1.34109 WP_003418948.1.34131 WP_003418948.1.34152 WP_003418948.1.34153 WP_003418948.1.34163 WP_003418948.1.34181 WP_003418948.1.34197 WP_003418948.1.34198 WP_003418948.1.34215 WP_003418948.1.34219 WP_003418948.1.34255 WP_003418948.1.34260 WP_003418948.1.34275 WP_003418948.1.343 WP_003418948.1.34347 WP_003418948.1.34392 WP_003418948.1.344 WP_003418948.1.34428 WP_003418948.1.3443 WP_003418948.1.34435 WP_003418948.1.34446 WP_003418948.1.34499 WP_003418948.1.34505 WP_003418948.1.34516 WP_003418948.1.34529 WP_003418948.1.34551 WP_003418948.1.34563 WP_003418948.1.34576 WP_003418948.1.34581 WP_003418948.1.34588 WP_003418948.1.34596 WP_003418948.1.34599 WP_003418948.1.34639 WP_003418948.1.34673 WP_003418948.1.34724 WP_003418948.1.34740 WP_003418948.1.34755 WP_003418948.1.34777 WP_003418948.1.34783 WP_003418948.1.34841 WP_003418948.1.34908 WP_003418948.1.34919 WP_003418948.1.3492 WP_003418948.1.34933 WP_003418948.1.34945 WP_003418948.1.34946 WP_003418948.1.34954 WP_003418948.1.34960 WP_003418948.1.34961 WP_003418948.1.34963 WP_003418948.1.34965 WP_003418948.1.34968 WP_003418948.1.35023 WP_003418948.1.35069 WP_003418948.1.35072 WP_003418948.1.35078 WP_003418948.1.35100 WP_003418948.1.35146 WP_003418948.1.35156 WP_003418948.1.35160 WP_003418948.1.35162 WP_003418948.1.35176 WP_003418948.1.3520 WP_003418948.1.35213 WP_003418948.1.35221 WP_003418948.1.35246 WP_003418948.1.35278 WP_003418948.1.35301 WP_003418948.1.35311 WP_003418948.1.35312 WP_003418948.1.35317 WP_003418948.1.35319 WP_003418948.1.35347 WP_003418948.1.35363 WP_003418948.1.35382 WP_003418948.1.35385 WP_003418948.1.35396 WP_003418948.1.35397 WP_003418948.1.35426 WP_003418948.1.35439 WP_003418948.1.35455 WP_003418948.1.3548 WP_003418948.1.35484 WP_003418948.1.35492 WP_003418948.1.3553 WP_003418948.1.35553 WP_003418948.1.35555 WP_003418948.1.35561 WP_003418948.1.35602 WP_003418948.1.35610 WP_003418948.1.35635 WP_003418948.1.35657 WP_003418948.1.35687 WP_003418948.1.35689 WP_003418948.1.35707 WP_003418948.1.35732 WP_003418948.1.35754 WP_003418948.1.35767 WP_003418948.1.35770 WP_003418948.1.35771 WP_003418948.1.35780 WP_003418948.1.35805 WP_003418948.1.35811 WP_003418948.1.35821 WP_003418948.1.3584 WP_003418948.1.35848 WP_003418948.1.35864 WP_003418948.1.35874 WP_003418948.1.35876 WP_003418948.1.35897 WP_003418948.1.35899 WP_003418948.1.35923 WP_003418948.1.3593 WP_003418948.1.35954 WP_003418948.1.36005 WP_003418948.1.36014 WP_003418948.1.36023 WP_003418948.1.36051 WP_003418948.1.36053 WP_003418948.1.36075 WP_003418948.1.36089 WP_003418948.1.36097 WP_003418948.1.36098 WP_003418948.1.36116 WP_003418948.1.36145 WP_003418948.1.36156 WP_003418948.1.36205 WP_003418948.1.36228 WP_003418948.1.36252 WP_003418948.1.36260 WP_003418948.1.36270 WP_003418948.1.36271 WP_003418948.1.36303 WP_003418948.1.36309 WP_003418948.1.36315 WP_003418948.1.36319 WP_003418948.1.36321 WP_003418948.1.36326 WP_003418948.1.3634 WP_003418948.1.36356 WP_003418948.1.36357 WP_003418948.1.3636 WP_003418948.1.36385 WP_003418948.1.36399 WP_003418948.1.36436 WP_003418948.1.36465 WP_003418948.1.36469 WP_003418948.1.36473 WP_003418948.1.36485 WP_003418948.1.36508 WP_003418948.1.36540 WP_003418948.1.36561 WP_003418948.1.36571 WP_003418948.1.36573 WP_003418948.1.36578 WP_003418948.1.36585 WP_003418948.1.36597 WP_003418948.1.36614 WP_003418948.1.36674 WP_003418948.1.36720 WP_003418948.1.36727 WP_003418948.1.36733 WP_003418948.1.36785 WP_003418948.1.36810 WP_003418948.1.36844 WP_003418948.1.36851 WP_003418948.1.36862 WP_003418948.1.36893 WP_003418948.1.36901 WP_003418948.1.36921 WP_003418948.1.36935 WP_003418948.1.36941 WP_003418948.1.3695 WP_003418948.1.36951 WP_003418948.1.36968 WP_003418948.1.3700 WP_003418948.1.37004 WP_003418948.1.37012 WP_003418948.1.37071 WP_003418948.1.37088 WP_003418948.1.37131 WP_003418948.1.37157 WP_003418948.1.37175 WP_003418948.1.37188 WP_003418948.1.37213 WP_003418948.1.37229 WP_003418948.1.3724 WP_003418948.1.37277 WP_003418948.1.37305 WP_003418948.1.37330 WP_003418948.1.37389 WP_003418948.1.37400 WP_003418948.1.37440 WP_003418948.1.37459 WP_003418948.1.37468 WP_003418948.1.37475 WP_003418948.1.37484 WP_003418948.1.37601 WP_003418948.1.37612 WP_003418948.1.37632 WP_003418948.1.37643 WP_003418948.1.37655 WP_003418948.1.37660 WP_003418948.1.37674 WP_003418948.1.37700 WP_003418948.1.37701 WP_003418948.1.37709 WP_003418948.1.37711 WP_003418948.1.37721 WP_003418948.1.37722 WP_003418948.1.37747 WP_003418948.1.37765 WP_003418948.1.37772 WP_003418948.1.37804 WP_003418948.1.37809 WP_003418948.1.37859 WP_003418948.1.37877 WP_003418948.1.37912 WP_003418948.1.37913 WP_003418948.1.37943 WP_003418948.1.37950 WP_003418948.1.37973 WP_003418948.1.37975 WP_003418948.1.37983 WP_003418948.1.38 WP_003418948.1.38002 WP_003418948.1.3802 WP_003418948.1.38039 WP_003418948.1.38040 WP_003418948.1.38067 WP_003418948.1.38068 WP_003418948.1.38138 WP_003418948.1.38144 WP_003418948.1.38158 WP_003418948.1.38159 WP_003418948.1.38210 WP_003418948.1.38240 WP_003418948.1.38299 WP_003418948.1.38332 WP_003418948.1.38347 WP_003418948.1.38354 WP_003418948.1.38380 WP_003418948.1.38384 WP_003418948.1.38389 WP_003418948.1.38398 WP_003418948.1.38402 WP_003418948.1.38418 WP_003418948.1.38421 WP_003418948.1.38466 WP_003418948.1.38477 WP_003418948.1.38483 WP_003418948.1.3849 WP_003418948.1.385 WP_003418948.1.38530 WP_003418948.1.38535 WP_003418948.1.38539 WP_003418948.1.38594 WP_003418948.1.38601 WP_003418948.1.38611 WP_003418948.1.38638 WP_003418948.1.38639 WP_003418948.1.38646 WP_003418948.1.38648 WP_003418948.1.38654 WP_003418948.1.38659 WP_003418948.1.38660 WP_003418948.1.38666 WP_003418948.1.38671 WP_003418948.1.38672 WP_003418948.1.38677 WP_003418948.1.38750 WP_003418948.1.38772 WP_003418948.1.38812 WP_003418948.1.38821 WP_003418948.1.38844 WP_003418948.1.38863 WP_003418948.1.38865 WP_003418948.1.38873 WP_003418948.1.3889 WP_003418948.1.38894 WP_003418948.1.38909 WP_003418948.1.38939 WP_003418948.1.38974 WP_003418948.1.38975 WP_003418948.1.38991 WP_003418948.1.39025 WP_003418948.1.39070 WP_003418948.1.39072 WP_003418948.1.39095 WP_003418948.1.39106 WP_003418948.1.39165 WP_003418948.1.39174 WP_003418948.1.39176 WP_003418948.1.39178 WP_003418948.1.39190 WP_003418948.1.39201 WP_003418948.1.39207 WP_003418948.1.39211 WP_003418948.1.39236 WP_003418948.1.39239 WP_003418948.1.39252 WP_003418948.1.39288 WP_003418948.1.39295 WP_003418948.1.39306 WP_003418948.1.39359 WP_003418948.1.39364 WP_003418948.1.39400 WP_003418948.1.39447 WP_003418948.1.3945 WP_003418948.1.39450 WP_003418948.1.39455 WP_003418948.1.3949 WP_003418948.1.39521 WP_003418948.1.39560 WP_003418948.1.39592 WP_003418948.1.396 WP_003418948.1.39616 WP_003418948.1.39654 WP_003418948.1.39657 WP_003418948.1.39661 WP_003418948.1.39674 WP_003418948.1.39678 WP_003418948.1.3968 WP_003418948.1.39694 WP_003418948.1.3971 WP_003418948.1.39718 WP_003418948.1.39728 WP_003418948.1.39739 WP_003418948.1.39748 WP_003418948.1.39751 WP_003418948.1.39759 WP_003418948.1.39801 WP_003418948.1.39804 WP_003418948.1.39848 WP_003418948.1.39877 WP_003418948.1.39925 WP_003418948.1.3994 WP_003418948.1.39959 WP_003418948.1.3996 WP_003418948.1.39960 WP_003418948.1.3997 WP_003418948.1.39980 WP_003418948.1.40000 WP_003418948.1.40028 WP_003418948.1.40029 WP_003418948.1.4003 WP_003418948.1.40094 WP_003418948.1.40096 WP_003418948.1.40150 WP_003418948.1.40156 WP_003418948.1.40174 WP_003418948.1.40186 WP_003418948.1.40276 WP_003418948.1.40277 WP_003418948.1.40323 WP_003418948.1.40336 WP_003418948.1.40353 WP_003418948.1.4036 WP_003418948.1.40372 WP_003418948.1.40402 WP_003418948.1.40413 WP_003418948.1.40446 WP_003418948.1.40451 WP_003418948.1.40455 WP_003418948.1.40523 WP_003418948.1.40543 WP_003418948.1.40641 WP_003418948.1.40646 WP_003418948.1.40651 WP_003418948.1.40653 WP_003418948.1.4067 WP_003418948.1.40705 WP_003418948.1.40723 WP_003418948.1.40731 WP_003418948.1.40735 WP_003418948.1.40795 WP_003418948.1.40799 WP_003418948.1.40852 WP_003418948.1.40876 WP_003418948.1.40881 WP_003418948.1.40922 WP_003418948.1.40948 WP_003418948.1.4095 WP_003418948.1.40956 WP_003418948.1.40957 WP_003418948.1.40964 WP_003418948.1.4097 WP_003418948.1.410 WP_003418948.1.41000 WP_003418948.1.41055 WP_003418948.1.41108 WP_003418948.1.41123 WP_003418948.1.41177 WP_003418948.1.41202 WP_003418948.1.41231 WP_003418948.1.41249 WP_003418948.1.4127 WP_003418948.1.41296 WP_003418948.1.41355 WP_003418948.1.41376 WP_003418948.1.41430 WP_003418948.1.41447 WP_003418948.1.41469 WP_003418948.1.41553 WP_003418948.1.41564 WP_003418948.1.41616 WP_003418948.1.41632 WP_003418948.1.41635 WP_003418948.1.41636 WP_003418948.1.41648 WP_003418948.1.41660 WP_003418948.1.41685 WP_003418948.1.41695 WP_003418948.1.41704 WP_003418948.1.4171 WP_003418948.1.41719 WP_003418948.1.41733 WP_003418948.1.41744 WP_003418948.1.41774 WP_003418948.1.41791 WP_003418948.1.41803 WP_003418948.1.41820 WP_003418948.1.41828 WP_003418948.1.41829 WP_003418948.1.41860 WP_003418948.1.41912 WP_003418948.1.41921 WP_003418948.1.41933 WP_003418948.1.41944 WP_003418948.1.42043 WP_003418948.1.42075 WP_003418948.1.42078 WP_003418948.1.42094 WP_003418948.1.42112 WP_003418948.1.4212 WP_003418948.1.42122 WP_003418948.1.42134 WP_003418948.1.42183 WP_003418948.1.42188 WP_003418948.1.42202 WP_003418948.1.42208 WP_003418948.1.42247 WP_003418948.1.42255 WP_003418948.1.42273 WP_003418948.1.42278 WP_003418948.1.42304 WP_003418948.1.42309 WP_003418948.1.42370 WP_003418948.1.42385 WP_003418948.1.42400 WP_003418948.1.42409 WP_003418948.1.42414 WP_003418948.1.42430 WP_003418948.1.42461 WP_003418948.1.42465 WP_003418948.1.42467 WP_003418948.1.42473 WP_003418948.1.42474 WP_003418948.1.4248 WP_003418948.1.42494 WP_003418948.1.42519 WP_003418948.1.42524 WP_003418948.1.42534 WP_003418948.1.4255 WP_003418948.1.42562 WP_003418948.1.42568 WP_003418948.1.42570 WP_003418948.1.42618 WP_003418948.1.42660 WP_003418948.1.42695 WP_003418948.1.42704 WP_003418948.1.42705 WP_003418948.1.42722 WP_003418948.1.42777 WP_003418948.1.42782 WP_003418948.1.42835 WP_003418948.1.42839 WP_003418948.1.42842 WP_003418948.1.42905 WP_003418948.1.42916 WP_003418948.1.42930 WP_003418948.1.42971 WP_003418948.1.43005 WP_003418948.1.43009 WP_003418948.1.43053 WP_003418948.1.43082 WP_003418948.1.43087 WP_003418948.1.43098 WP_003418948.1.43208 WP_003418948.1.43236 WP_003418948.1.43246 WP_003418948.1.43255 WP_003418948.1.43266 WP_003418948.1.43269 WP_003418948.1.43273 WP_003418948.1.43296 WP_003418948.1.43306 WP_003418948.1.4335 WP_003418948.1.43368 WP_003418948.1.43395 WP_003418948.1.43457 WP_003418948.1.43462 WP_003418948.1.43475 WP_003418948.1.43478 WP_003418948.1.43484 WP_003418948.1.43557 WP_003418948.1.43578 WP_003418948.1.43588 WP_003418948.1.43643 WP_003418948.1.43664 WP_003418948.1.43684 WP_003418948.1.43686 WP_003418948.1.43706 WP_003418948.1.43716 WP_003418948.1.4377 WP_003418948.1.43781 WP_003418948.1.43794 WP_003418948.1.43815 WP_003418948.1.43846 WP_003418948.1.43861 WP_003418948.1.43863 WP_003418948.1.43866 WP_003418948.1.43872 WP_003418948.1.43885 WP_003418948.1.43897 WP_003418948.1.43902 WP_003418948.1.43921 WP_003418948.1.43936 WP_003418948.1.43937 WP_003418948.1.43960 WP_003418948.1.43965 WP_003418948.1.4399 WP_003418948.1.43993 WP_003418948.1.43996 WP_003418948.1.44 WP_003418948.1.44001 WP_003418948.1.44008 WP_003418948.1.44033 WP_003418948.1.44037 WP_003418948.1.44041 WP_003418948.1.44070 WP_003418948.1.44071 WP_003418948.1.44076 WP_003418948.1.44104 WP_003418948.1.44111 WP_003418948.1.44124 WP_003418948.1.44169 WP_003418948.1.44219 WP_003418948.1.44237 WP_003418948.1.44277 WP_003418948.1.44279 WP_003418948.1.44336 WP_003418948.1.44355 WP_003418948.1.44358 WP_003418948.1.4438 WP_003418948.1.44390 WP_003418948.1.44392 WP_003418948.1.4441 WP_003418948.1.44415 WP_003418948.1.44464 WP_003418948.1.44466 WP_003418948.1.44489 WP_003418948.1.44492 WP_003418948.1.44494 WP_003418948.1.44500 WP_003418948.1.44519 WP_003418948.1.44526 WP_003418948.1.44532 WP_003418948.1.44534 WP_003418948.1.44562 WP_003418948.1.44589 WP_003418948.1.44597 WP_003418948.1.44600 WP_003418948.1.44602 WP_003418948.1.44615 WP_003418948.1.4464 WP_003418948.1.44651 WP_003418948.1.44659 WP_003418948.1.44665 WP_003418948.1.44694 WP_003418948.1.44700 WP_003418948.1.44713 WP_003418948.1.44735 WP_003418948.1.44740 WP_003418948.1.44757 WP_003418948.1.4476 WP_003418948.1.44761 WP_003418948.1.44767 WP_003418948.1.44776 WP_003418948.1.44779 WP_003418948.1.44786 WP_003418948.1.44808 WP_003418948.1.44864 WP_003418948.1.44901 WP_003418948.1.44908 WP_003418948.1.44913 WP_003418948.1.4492 WP_003418948.1.44939 WP_003418948.1.44979 WP_003418948.1.44981 WP_003418948.1.45002 WP_003418948.1.45011 WP_003418948.1.4504 WP_003418948.1.45062 WP_003418948.1.45066 WP_003418948.1.45081 WP_003418948.1.45113 WP_003418948.1.45129 WP_003418948.1.45135 WP_003418948.1.45147 WP_003418948.1.45168 WP_003418948.1.4517 WP_003418948.1.45181 WP_003418948.1.45185 WP_003418948.1.45192 WP_003418948.1.45200 WP_003418948.1.45205 WP_003418948.1.45211 WP_003418948.1.45249 WP_003418948.1.4526 WP_003418948.1.45286 WP_003418948.1.45326 WP_003418948.1.45347 WP_003418948.1.45374 WP_003418948.1.45390 WP_003418948.1.454 WP_003418948.1.45407 WP_003418948.1.45451 WP_003418948.1.45453 WP_003418948.1.45460 WP_003418948.1.45463 WP_003418948.1.45470 WP_003418948.1.45474 WP_003418948.1.45491 WP_003418948.1.45510 WP_003418948.1.45563 WP_003418948.1.45584 WP_003418948.1.45590 WP_003418948.1.45619 WP_003418948.1.45626 WP_003418948.1.45631 WP_003418948.1.45666 WP_003418948.1.45697 WP_003418948.1.4571 WP_003418948.1.45731 WP_003418948.1.45743 WP_003418948.1.45765 WP_003418948.1.45776 WP_003418948.1.45783 WP_003418948.1.45805 WP_003418948.1.45815 WP_003418948.1.45849 WP_003418948.1.45867 WP_003418948.1.45884 WP_003418948.1.4590 WP_003418948.1.45923 WP_003418948.1.45926 WP_003418948.1.45963 WP_003418948.1.45989 WP_003418948.1.45992 WP_003418948.1.46025 WP_003418948.1.46083 WP_003418948.1.46090 WP_003418948.1.46092 WP_003418948.1.46100 WP_003418948.1.46101 WP_003418948.1.46103 WP_003418948.1.46107 WP_003418948.1.46127 WP_003418948.1.46128 WP_003418948.1.46129 WP_003418948.1.46141 WP_003418948.1.46150 WP_003418948.1.46201 WP_003418948.1.46226 WP_003418948.1.4624 WP_003418948.1.46253 WP_003418948.1.46268 WP_003418948.1.46285 WP_003418948.1.46300 WP_003418948.1.46313 WP_003418948.1.46336 WP_003418948.1.46365 WP_003418948.1.46370 WP_003418948.1.46381 WP_003418948.1.46402 WP_003418948.1.46411 WP_003418948.1.4644 WP_003418948.1.46442 WP_003418948.1.46453 WP_003418948.1.46463 WP_003418948.1.46478 WP_003418948.1.46492 WP_003418948.1.46521 WP_003418948.1.4653 WP_003418948.1.46539 WP_003418948.1.46568 WP_003418948.1.46585 WP_003418948.1.46609 WP_003418948.1.46613 WP_003418948.1.46625 WP_003418948.1.46642 WP_003418948.1.46647 WP_003418948.1.46674 WP_003418948.1.46724 WP_003418948.1.46758 WP_003418948.1.46773 WP_003418948.1.46777 WP_003418948.1.46786 WP_003418948.1.46792 WP_003418948.1.46847 WP_003418948.1.46851 WP_003418948.1.4687 WP_003418948.1.46897 WP_003418948.1.46936 WP_003418948.1.46980 WP_003418948.1.47011 WP_003418948.1.47012 WP_003418948.1.47066 WP_003418948.1.47077 WP_003418948.1.47083 WP_003418948.1.47106 WP_003418948.1.47142 WP_003418948.1.47147 WP_003418948.1.47166 WP_003418948.1.47178 WP_003418948.1.47179 WP_003418948.1.47194 WP_003418948.1.47207 WP_003418948.1.47210 WP_003418948.1.47261 WP_003418948.1.47262 WP_003418948.1.47402 WP_003418948.1.47423 WP_003418948.1.47467 WP_003418948.1.47502 WP_003418948.1.4751 WP_003418948.1.47511 WP_003418948.1.47537 WP_003418948.1.47540 WP_003418948.1.47568 WP_003418948.1.47572 WP_003418948.1.47588 WP_003418948.1.47636 WP_003418948.1.4764 WP_003418948.1.47653 WP_003418948.1.47679 WP_003418948.1.47681 WP_003418948.1.47690 WP_003418948.1.4771 WP_003418948.1.47717 WP_003418948.1.47743 WP_003418948.1.47754 WP_003418948.1.47773 WP_003418948.1.47776 WP_003418948.1.47780 WP_003418948.1.47805 WP_003418948.1.47832 WP_003418948.1.47847 WP_003418948.1.47858 WP_003418948.1.47861 WP_003418948.1.47868 WP_003418948.1.47893 WP_003418948.1.47899 WP_003418948.1.479 WP_003418948.1.47912 WP_003418948.1.47913 WP_003418948.1.47926 WP_003418948.1.4794 WP_003418948.1.47943 WP_003418948.1.47944 WP_003418948.1.47959 WP_003418948.1.47974 WP_003418948.1.47993 WP_003418948.1.48004 WP_003418948.1.48039 WP_003418948.1.48050 WP_003418948.1.48084 WP_003418948.1.48097 WP_003418948.1.48101 WP_003418948.1.4813 WP_003418948.1.48130 WP_003418948.1.48135 WP_003418948.1.48143 WP_003418948.1.48152 WP_003418948.1.48155 WP_003418948.1.48170 WP_003418948.1.48173 WP_003418948.1.48177 WP_003418948.1.48185 WP_003418948.1.48219 WP_003418948.1.4823 WP_003418948.1.48240 WP_003418948.1.48256 WP_003418948.1.48264 WP_003418948.1.48287 WP_003418948.1.48330 WP_003418948.1.48333 WP_003418948.1.48348 WP_003418948.1.48354 WP_003418948.1.48372 WP_003418948.1.48383 WP_003418948.1.48388 WP_003418948.1.48419 WP_003418948.1.48423 WP_003418948.1.48443 WP_003418948.1.48450 WP_003418948.1.48462 WP_003418948.1.48543 WP_003418948.1.48550 WP_003418948.1.48605 WP_003418948.1.48618 WP_003418948.1.4863 WP_003418948.1.48648 WP_003418948.1.48658 WP_003418948.1.48666 WP_003418948.1.48687 WP_003418948.1.48779 WP_003418948.1.4878 WP_003418948.1.48798 WP_003418948.1.48802 WP_003418948.1.48826 WP_003418948.1.48831 WP_003418948.1.48843 WP_003418948.1.48857 WP_003418948.1.4890 WP_003418948.1.48946 WP_003418948.1.48979 WP_003418948.1.49017 WP_003418948.1.49048 WP_003418948.1.49059 WP_003418948.1.4906 WP_003418948.1.4907 WP_003418948.1.49103 WP_003418948.1.49110 WP_003418948.1.49111 WP_003418948.1.49112 WP_003418948.1.4919 WP_003418948.1.49251 WP_003418948.1.49254 WP_003418948.1.49263 WP_003418948.1.49291 WP_003418948.1.49296 WP_003418948.1.49335 WP_003418948.1.49337 WP_003418948.1.49419 WP_003418948.1.49426 WP_003418948.1.49437 WP_003418948.1.49439 WP_003418948.1.49474 WP_003418948.1.49506 WP_003418948.1.49516 WP_003418948.1.49523 WP_003418948.1.49526 WP_003418948.1.49532 WP_003418948.1.49588 WP_003418948.1.4959 WP_003418948.1.49678 WP_003418948.1.49687 WP_003418948.1.49699 WP_003418948.1.49709 WP_003418948.1.4971 WP_003418948.1.4972 WP_003418948.1.49736 WP_003418948.1.49746 WP_003418948.1.49764 WP_003418948.1.49773 WP_003418948.1.49796 WP_003418948.1.49814 WP_003418948.1.49815 WP_003418948.1.49816 WP_003418948.1.49839 WP_003418948.1.49857 WP_003418948.1.49878 WP_003418948.1.49880 WP_003418948.1.49944 WP_003418948.1.4999 WP_003418948.1.49990 WP_003418948.1.50068 WP_003418948.1.50077 WP_003418948.1.5008 WP_003418948.1.50081 WP_003418948.1.50122 WP_003418948.1.50126 WP_003418948.1.50149 WP_003418948.1.50162 WP_003418948.1.5018 WP_003418948.1.50194 WP_003418948.1.50218 WP_003418948.1.50235 WP_003418948.1.50249 WP_003418948.1.50265 WP_003418948.1.50271 WP_003418948.1.50324 WP_003418948.1.50347 WP_003418948.1.50372 WP_003418948.1.50398 WP_003418948.1.50407 WP_003418948.1.50444 WP_003418948.1.50466 WP_003418948.1.50472 WP_003418948.1.5048 WP_003418948.1.50498 WP_003418948.1.5050 WP_003418948.1.50540 WP_003418948.1.50554 WP_003418948.1.50557 WP_003418948.1.50601 WP_003418948.1.50610 WP_003418948.1.50632 WP_003418948.1.50633 WP_003418948.1.50642 WP_003418948.1.50655 WP_003418948.1.50659 WP_003418948.1.50683 WP_003418948.1.50689 WP_003418948.1.50692 WP_003418948.1.50714 WP_003418948.1.50729 WP_003418948.1.50756 WP_003418948.1.50784 WP_003418948.1.50794 WP_003418948.1.50841 WP_003418948.1.50860 WP_003418948.1.50877 WP_003418948.1.5096 WP_003418948.1.50981 WP_003418948.1.50987 WP_003418948.1.51003 WP_003418948.1.51009 WP_003418948.1.51037 WP_003418948.1.51074 WP_003418948.1.51082 WP_003418948.1.51101 WP_003418948.1.51116 WP_003418948.1.51149 WP_003418948.1.51156 WP_003418948.1.51157 WP_003418948.1.51213 WP_003418948.1.51232 WP_003418948.1.51239 WP_003418948.1.51247 WP_003418948.1.51266 WP_003418948.1.51279 WP_003418948.1.51291 WP_003418948.1.51294 WP_003418948.1.51301 WP_003418948.1.51329 WP_003418948.1.51391 WP_003418948.1.51422 WP_003418948.1.51445 WP_003418948.1.51455 WP_003418948.1.51466 WP_003418948.1.51468 WP_003418948.1.51478 WP_003418948.1.51497 WP_003418948.1.51520 WP_003418948.1.51593 WP_003418948.1.51628 WP_003418948.1.5164 WP_003418948.1.51647 WP_003418948.1.51660 WP_003418948.1.51696 WP_003418948.1.51721 WP_003418948.1.51788 WP_003418948.1.51795 WP_003418948.1.51801 WP_003418948.1.51817 WP_003418948.1.51819 WP_003418948.1.51854 WP_003418948.1.51923 WP_003418948.1.51942 WP_003418948.1.51948 WP_003418948.1.51963 WP_003418948.1.51969 WP_003418948.1.52000 WP_003418948.1.52001 WP_003418948.1.52003 WP_003418948.1.52006 WP_003418948.1.52036 WP_003418948.1.52038 WP_003418948.1.52046 WP_003418948.1.52059 WP_003418948.1.52069 WP_003418948.1.52082 WP_003418948.1.52102 WP_003418948.1.52106 WP_003418948.1.52166 WP_003418948.1.52168 WP_003418948.1.52173 WP_003418948.1.52178 WP_003418948.1.52206 WP_003418948.1.52216 WP_003418948.1.52238 WP_003418948.1.52241 WP_003418948.1.52280 WP_003418948.1.52314 WP_003418948.1.52385 WP_003418948.1.52390 WP_003418948.1.524 WP_003418948.1.52460 WP_003418948.1.52485 WP_003418948.1.52486 WP_003418948.1.52495 WP_003418948.1.52504 WP_003418948.1.52522 WP_003418948.1.52531 WP_003418948.1.52533 WP_003418948.1.52545 WP_003418948.1.52553 WP_003418948.1.52563 WP_003418948.1.52564 WP_003418948.1.52574 WP_003418948.1.52641 WP_003418948.1.52673 WP_003418948.1.52674 WP_003418948.1.52708 WP_003418948.1.52713 WP_003418948.1.52761 WP_003418948.1.52778 WP_003418948.1.52791 WP_003418948.1.52797 WP_003418948.1.52818 WP_003418948.1.52872 WP_003418948.1.52873 WP_003418948.1.52891 WP_003418948.1.52892 WP_003418948.1.52909 WP_003418948.1.52970 WP_003418948.1.52998 WP_003418948.1.53053 WP_003418948.1.53056 WP_003418948.1.5306 WP_003418948.1.53088 WP_003418948.1.5309 WP_003418948.1.531 WP_003418948.1.53117 WP_003418948.1.53118 WP_003418948.1.53142 WP_003418948.1.53143 WP_003418948.1.53157 WP_003418948.1.53200 WP_003418948.1.53204 WP_003418948.1.53213 WP_003418948.1.53217 WP_003418948.1.53226 WP_003418948.1.53229 WP_003418948.1.53230 WP_003418948.1.53237 WP_003418948.1.53254 WP_003418948.1.53257 WP_003418948.1.5327 WP_003418948.1.53276 WP_003418948.1.53278 WP_003418948.1.533 WP_003418948.1.53302 WP_003418948.1.53306 WP_003418948.1.5334 WP_003418948.1.5335 WP_003418948.1.53353 WP_003418948.1.53381 WP_003418948.1.53413 WP_003418948.1.53458 WP_003418948.1.53460 WP_003418948.1.53480 WP_003418948.1.53517 WP_003418948.1.53522 WP_003418948.1.53525 WP_003418948.1.53526 WP_003418948.1.53553 WP_003418948.1.53606 WP_003418948.1.53609 WP_003418948.1.53628 WP_003418948.1.53643 WP_003418948.1.53667 WP_003418948.1.53679 WP_003418948.1.53715 WP_003418948.1.53730 WP_003418948.1.53742 WP_003418948.1.53743 WP_003418948.1.53754 WP_003418948.1.53775 WP_003418948.1.53787 WP_003418948.1.53803 WP_003418948.1.53818 WP_003418948.1.53822 WP_003418948.1.53853 WP_003418948.1.53865 WP_003418948.1.53888 WP_003418948.1.53900 WP_003418948.1.53912 WP_003418948.1.53914 WP_003418948.1.53952 WP_003418948.1.5398 WP_003418948.1.54089 WP_003418948.1.54093 WP_003418948.1.54099 WP_003418948.1.54112 WP_003418948.1.54125 WP_003418948.1.54141 WP_003418948.1.54162 WP_003418948.1.54179 WP_003418948.1.54206 WP_003418948.1.54218 WP_003418948.1.54225 WP_003418948.1.54227 WP_003418948.1.54232 WP_003418948.1.54241 WP_003418948.1.54245 WP_003418948.1.54247 WP_003418948.1.54260 WP_003418948.1.54275 WP_003418948.1.54280 WP_003418948.1.5429 WP_003418948.1.54294 WP_003418948.1.54314 WP_003418948.1.54347 WP_003418948.1.54351 WP_003418948.1.54370 WP_003418948.1.54428 WP_003418948.1.54449 WP_003418948.1.54494 WP_003418948.1.54514 WP_003418948.1.54519 WP_003418948.1.5452 WP_003418948.1.54531 WP_003418948.1.54537 WP_003418948.1.54553 WP_003418948.1.54555 WP_003418948.1.54575 WP_003418948.1.54633 WP_003418948.1.54686 WP_003418948.1.54687 WP_003418948.1.54705 WP_003418948.1.54730 WP_003418948.1.54732 WP_003418948.1.5475 WP_003418948.1.54797 WP_003418948.1.54807 WP_003418948.1.54836 WP_003418948.1.54838 WP_003418948.1.54860 WP_003418948.1.54888 WP_003418948.1.54897 WP_003418948.1.54905 WP_003418948.1.54909 WP_003418948.1.54937 WP_003418948.1.54939 WP_003418948.1.54944 WP_003418948.1.54945 WP_003418948.1.54953 WP_003418948.1.54964 WP_003418948.1.55015 WP_003418948.1.55022 WP_003418948.1.55023 WP_003418948.1.55051 WP_003418948.1.55072 WP_003418948.1.55088 WP_003418948.1.55106 WP_003418948.1.55126 WP_003418948.1.55128 WP_003418948.1.55140 WP_003418948.1.55150 WP_003418948.1.55210 WP_003418948.1.55227 WP_003418948.1.55248 WP_003418948.1.55257 WP_003418948.1.55258 WP_003418948.1.55267 WP_003418948.1.55279 WP_003418948.1.55307 WP_003418948.1.55326 WP_003418948.1.55328 WP_003418948.1.5533 WP_003418948.1.55345 WP_003418948.1.55396 WP_003418948.1.55398 WP_003418948.1.55441 WP_003418948.1.55459 WP_003418948.1.55501 WP_003418948.1.55504 WP_003418948.1.55578 WP_003418948.1.55626 WP_003418948.1.55641 WP_003418948.1.5569 WP_003418948.1.55723 WP_003418948.1.55735 WP_003418948.1.5574 WP_003418948.1.55772 WP_003418948.1.55802 WP_003418948.1.55807 WP_003418948.1.55819 WP_003418948.1.55821 WP_003418948.1.5583 WP_003418948.1.55849 WP_003418948.1.55856 WP_003418948.1.55860 WP_003418948.1.55882 WP_003418948.1.55883 WP_003418948.1.55894 WP_003418948.1.55902 WP_003418948.1.55909 WP_003418948.1.5591 WP_003418948.1.55961 WP_003418948.1.55977 WP_003418948.1.55983 WP_003418948.1.56028 WP_003418948.1.56057 WP_003418948.1.56060 WP_003418948.1.56107 WP_003418948.1.56132 WP_003418948.1.56163 WP_003418948.1.56167 WP_003418948.1.56178 WP_003418948.1.56287 WP_003418948.1.56292 WP_003418948.1.56327 WP_003418948.1.56341 WP_003418948.1.56359 WP_003418948.1.56365 WP_003418948.1.56394 WP_003418948.1.56443 WP_003418948.1.56473 WP_003418948.1.56478 WP_003418948.1.56500 WP_003418948.1.56517 WP_003418948.1.56534 WP_003418948.1.5656 WP_003418948.1.56577 WP_003418948.1.56593 WP_003418948.1.56625 WP_003418948.1.56637 WP_003418948.1.56670 WP_003418948.1.56697 WP_003418948.1.567 WP_003418948.1.56701 WP_003418948.1.56709 WP_003418948.1.56743 WP_003418948.1.56755 WP_003418948.1.56764 WP_003418948.1.56769 WP_003418948.1.56770 WP_003418948.1.56795 WP_003418948.1.5681 WP_003418948.1.56827 WP_003418948.1.56839 WP_003418948.1.56863 WP_003418948.1.56868 WP_003418948.1.56869 WP_003418948.1.56915 WP_003418948.1.56926 WP_003418948.1.56961 WP_003418948.1.56971 WP_003418948.1.56972 WP_003418948.1.57023 WP_003418948.1.57035 WP_003418948.1.57077 WP_003418948.1.57087 WP_003418948.1.57134 WP_003418948.1.57151 WP_003418948.1.57169 WP_003418948.1.57208 WP_003418948.1.57212 WP_003418948.1.57230 WP_003418948.1.5724 WP_003418948.1.5725 WP_003418948.1.5727 WP_003418948.1.57273 WP_003418948.1.573 WP_003418948.1.57314 WP_003418948.1.57326 WP_003418948.1.57328 WP_003418948.1.57331 WP_003418948.1.57340 WP_003418948.1.57351 WP_003418948.1.57352 WP_003418948.1.57380 WP_003418948.1.57430 WP_003418948.1.5744 WP_003418948.1.57440 WP_003418948.1.5745 WP_003418948.1.57461 WP_003418948.1.57469 WP_003418948.1.57489 WP_003418948.1.575 WP_003418948.1.57509 WP_003418948.1.57519 WP_003418948.1.57525 WP_003418948.1.57551 WP_003418948.1.5758 WP_003418948.1.57596 WP_003418948.1.57604 WP_003418948.1.57617 WP_003418948.1.57619 WP_003418948.1.57627 WP_003418948.1.57642 WP_003418948.1.57658 WP_003418948.1.57667 WP_003418948.1.57675 WP_003418948.1.57689 WP_003418948.1.57708 WP_003418948.1.57794 WP_003418948.1.57821 WP_003418948.1.57825 WP_003418948.1.57843 WP_003418948.1.57906 WP_003418948.1.57924 WP_003418948.1.57926 WP_003418948.1.57930 WP_003418948.1.57957 WP_003418948.1.57960 WP_003418948.1.57964 WP_003418948.1.57991 WP_003418948.1.58086 WP_003418948.1.58103 WP_003418948.1.58108 WP_003418948.1.5811 WP_003418948.1.58121 WP_003418948.1.58145 WP_003418948.1.58164 WP_003418948.1.58174 WP_003418948.1.582 WP_003418948.1.58202 WP_003418948.1.58209 WP_003418948.1.58215 WP_003418948.1.5824 WP_003418948.1.58250 WP_003418948.1.58259 WP_003418948.1.58283 WP_003418948.1.58288 WP_003418948.1.5830 WP_003418948.1.58303 WP_003418948.1.58311 WP_003418948.1.58330 WP_003418948.1.58359 WP_003418948.1.58386 WP_003418948.1.58393 WP_003418948.1.58431 WP_003418948.1.5844 WP_003418948.1.58457 WP_003418948.1.58488 WP_003418948.1.58518 WP_003418948.1.58534 WP_003418948.1.58559 WP_003418948.1.58567 WP_003418948.1.58573 WP_003418948.1.58602 WP_003418948.1.58612 WP_003418948.1.58619 WP_003418948.1.58630 WP_003418948.1.5865 WP_003418948.1.58671 WP_003418948.1.58690 WP_003418948.1.58702 WP_003418948.1.58743 WP_003418948.1.58754 WP_003418948.1.5879 WP_003418948.1.5881 WP_003418948.1.58824 WP_003418948.1.58848 WP_003418948.1.58857 WP_003418948.1.58891 WP_003418948.1.58892 WP_003418948.1.5890 WP_003418948.1.58904 WP_003418948.1.58921 WP_003418948.1.58930 WP_003418948.1.58939 WP_003418948.1.58941 WP_003418948.1.58953 WP_003418948.1.58961 WP_003418948.1.5898 WP_003418948.1.59025 WP_003418948.1.59029 WP_003418948.1.59037 WP_003418948.1.59044 WP_003418948.1.59085 WP_003418948.1.59088 WP_003418948.1.59130 WP_003418948.1.5914 WP_003418948.1.59147 WP_003418948.1.59166 WP_003418948.1.59205 WP_003418948.1.59209 WP_003418948.1.59237 WP_003418948.1.59240 WP_003418948.1.59253 WP_003418948.1.59254 WP_003418948.1.59262 WP_003418948.1.59270 WP_003418948.1.5928 WP_003418948.1.59304 WP_003418948.1.59305 WP_003418948.1.59309 WP_003418948.1.59316 WP_003418948.1.59326 WP_003418948.1.59328 WP_003418948.1.59333 WP_003418948.1.59338 WP_003418948.1.59388 WP_003418948.1.59428 WP_003418948.1.59487 WP_003418948.1.59537 WP_003418948.1.59561 WP_003418948.1.59677 WP_003418948.1.59722 WP_003418948.1.59727 WP_003418948.1.59732 WP_003418948.1.59738 WP_003418948.1.59750 WP_003418948.1.59757 WP_003418948.1.59761 WP_003418948.1.59808 WP_003418948.1.59850 WP_003418948.1.59856 WP_003418948.1.59860 WP_003418948.1.59861 WP_003418948.1.5987 WP_003418948.1.59878 WP_003418948.1.59888 WP_003418948.1.59952 WP_003418948.1.5996 WP_003418948.1.59961 WP_003418948.1.59974 WP_003418948.1.6000 WP_003418948.1.60007 WP_003418948.1.60016 WP_003418948.1.6003 WP_003418948.1.60047 WP_003418948.1.6007 WP_003418948.1.60091 WP_003418948.1.60121 WP_003418948.1.60125 WP_003418948.1.60139 WP_003418948.1.60152 WP_003418948.1.60171 WP_003418948.1.60197 WP_003418948.1.6020 WP_003418948.1.60205 WP_003418948.1.60207 WP_003418948.1.60215 WP_003418948.1.60217 WP_003418948.1.60267 WP_003418948.1.60288 WP_003418948.1.60291 WP_003418948.1.60301 WP_003418948.1.60305 WP_003418948.1.60312 WP_003418948.1.60313 WP_003418948.1.60314 WP_003418948.1.60367 WP_003418948.1.60376 WP_003418948.1.60403 WP_003418948.1.60413 WP_003418948.1.60421 WP_003418948.1.60451 WP_003418948.1.60460 WP_003418948.1.60479 WP_003418948.1.60512 WP_003418948.1.60573 WP_003418948.1.60583 WP_003418948.1.60632 WP_003418948.1.60657 WP_003418948.1.60687 WP_003418948.1.60689 WP_003418948.1.60727 WP_003418948.1.60738 WP_003418948.1.60763 WP_003418948.1.6077 WP_003418948.1.60791 WP_003418948.1.60834 WP_003418948.1.60870 WP_003418948.1.60878 WP_003418948.1.60879 WP_003418948.1.60913 WP_003418948.1.60978 WP_003418948.1.61000 WP_003418948.1.61001 WP_003418948.1.61012 WP_003418948.1.61014 WP_003418948.1.61015 WP_003418948.1.61037 WP_003418948.1.61052 WP_003418948.1.61065 WP_003418948.1.61100 WP_003418948.1.61101 WP_003418948.1.61138 WP_003418948.1.61142 WP_003418948.1.61198 WP_003418948.1.612 WP_003418948.1.61234 WP_003418948.1.61281 WP_003418948.1.61314 WP_003418948.1.61321 WP_003418948.1.61326 WP_003418948.1.61328 WP_003418948.1.61368 WP_003418948.1.61391 WP_003418948.1.61406 WP_003418948.1.61409 WP_003418948.1.61420 WP_003418948.1.61422 WP_003418948.1.61425 WP_003418948.1.61428 WP_003418948.1.61469 WP_003418948.1.61494 WP_003418948.1.61522 WP_003418948.1.61552 WP_003418948.1.61557 WP_003418948.1.61567 WP_003418948.1.61571 WP_003418948.1.61573 WP_003418948.1.61584 WP_003418948.1.61586 WP_003418948.1.6159 WP_003418948.1.61592 WP_003418948.1.6160 WP_003418948.1.61614 WP_003418948.1.6163 WP_003418948.1.61655 WP_003418948.1.61665 WP_003418948.1.61669 WP_003418948.1.61682 WP_003418948.1.61692 WP_003418948.1.61719 WP_003418948.1.61728 WP_003418948.1.61750 WP_003418948.1.61754 WP_003418948.1.61755 WP_003418948.1.61757 WP_003418948.1.6179 WP_003418948.1.61793 WP_003418948.1.61816 WP_003418948.1.61842 WP_003418948.1.61850 WP_003418948.1.61862 WP_003418948.1.61865 WP_003418948.1.61868 WP_003418948.1.61911 WP_003418948.1.61925 WP_003418948.1.61941 WP_003418948.1.61953 WP_003418948.1.61979 WP_003418948.1.61986 WP_003418948.1.61987 WP_003418948.1.62021 WP_003418948.1.62087 WP_003418948.1.62089 WP_003418948.1.62101 WP_003418948.1.62104 WP_003418948.1.6211 WP_003418948.1.62132 WP_003418948.1.62162 WP_003418948.1.62225 WP_003418948.1.62230 WP_003418948.1.62238 WP_003418948.1.62249 WP_003418948.1.62270 WP_003418948.1.62281 WP_003418948.1.62307 WP_003418948.1.6231 WP_003418948.1.62359 WP_003418948.1.62371 WP_003418948.1.62379 WP_003418948.1.62395 WP_003418948.1.62408 WP_003418948.1.62449 WP_003418948.1.62468 WP_003418948.1.6248 WP_003418948.1.62508 WP_003418948.1.62565 WP_003418948.1.62594 WP_003418948.1.62606 WP_003418948.1.62616 WP_003418948.1.62666 WP_003418948.1.62687 WP_003418948.1.62715 WP_003418948.1.62730 WP_003418948.1.62738 WP_003418948.1.62761 WP_003418948.1.62766 WP_003418948.1.62786 WP_003418948.1.62813 WP_003418948.1.62839 WP_003418948.1.62841 WP_003418948.1.62909 WP_003418948.1.62936 WP_003418948.1.6294 WP_003418948.1.6295 WP_003418948.1.62962 WP_003418948.1.63007 WP_003418948.1.63019 WP_003418948.1.63032 WP_003418948.1.63037 WP_003418948.1.63064 WP_003418948.1.63066 WP_003418948.1.63072 WP_003418948.1.6308 WP_003418948.1.63081 WP_003418948.1.63096 WP_003418948.1.63106 WP_003418948.1.6314 WP_003418948.1.63144 WP_003418948.1.63154 WP_003418948.1.63160 WP_003418948.1.63161 WP_003418948.1.63166 WP_003418948.1.63175 WP_003418948.1.63194 WP_003418948.1.6322 WP_003418948.1.63222 WP_003418948.1.63247 WP_003418948.1.6328 WP_003418948.1.63291 WP_003418948.1.63312 WP_003418948.1.63317 WP_003418948.1.63331 WP_003418948.1.63373 WP_003418948.1.63384 WP_003418948.1.63403 WP_003418948.1.63424 WP_003418948.1.63428 WP_003418948.1.6345 WP_003418948.1.63464 WP_003418948.1.63483 WP_003418948.1.63502 WP_003418948.1.63504 WP_003418948.1.63522 WP_003418948.1.63530 WP_003418948.1.63538 WP_003418948.1.63564 WP_003418948.1.63567 WP_003418948.1.63596 WP_003418948.1.63600 WP_003418948.1.63623 WP_003418948.1.63624 WP_003418948.1.63625 WP_003418948.1.63627 WP_003418948.1.63654 WP_003418948.1.63662 WP_003418948.1.63711 WP_003418948.1.63734 WP_003418948.1.63807 WP_003418948.1.63819 WP_003418948.1.63844 WP_003418948.1.63888 WP_003418948.1.63913 WP_003418948.1.63915 WP_003418948.1.63918 WP_003418948.1.63961 WP_003418948.1.63970 WP_003418948.1.64000 WP_003418948.1.64027 WP_003418948.1.64058 WP_003418948.1.64065 WP_003418948.1.6407 WP_003418948.1.64082 WP_003418948.1.64091 WP_003418948.1.64102 WP_003418948.1.64104 WP_003418948.1.64119 WP_003418948.1.64169 WP_003418948.1.64219 WP_003418948.1.6422 WP_003418948.1.64222 WP_003418948.1.64223 WP_003418948.1.64228 WP_003418948.1.64235 WP_003418948.1.64249 WP_003418948.1.6427 WP_003418948.1.64278 WP_003418948.1.64287 WP_003418948.1.64414 WP_003418948.1.64419 WP_003418948.1.6443 WP_003418948.1.64480 WP_003418948.1.64497 WP_003418948.1.64506 WP_003418948.1.64511 WP_003418948.1.64513 WP_003418948.1.64514 WP_003418948.1.64515 WP_003418948.1.64522 WP_003418948.1.64526 WP_003418948.1.64543 WP_003418948.1.6456 WP_003418948.1.64567 WP_003418948.1.64588 WP_003418948.1.64589 WP_003418948.1.64594 WP_003418948.1.64595 WP_003418948.1.64608 WP_003418948.1.64619 WP_003418948.1.64629 WP_003418948.1.6464 WP_003418948.1.64664 WP_003418948.1.64669 WP_003418948.1.64672 WP_003418948.1.64680 WP_003418948.1.64682 WP_003418948.1.64727 WP_003418948.1.64729 WP_003418948.1.64774 WP_003418948.1.64776 WP_003418948.1.64802 WP_003418948.1.64832 WP_003418948.1.6486 WP_003418948.1.64870 WP_003418948.1.64898 WP_003418948.1.64922 WP_003418948.1.64924 WP_003418948.1.6493 WP_003418948.1.64937 WP_003418948.1.64941 WP_003418948.1.64973 WP_003418948.1.65001 WP_003418948.1.65026 WP_003418948.1.65053 WP_003418948.1.65070 WP_003418948.1.65079 WP_003418948.1.65102 WP_003418948.1.65157 WP_003418948.1.65181 WP_003418948.1.65212 WP_003418948.1.65229 WP_003418948.1.6523 WP_003418948.1.65253 WP_003418948.1.65289 WP_003418948.1.65291 WP_003418948.1.65315 WP_003418948.1.65329 WP_003418948.1.65359 WP_003418948.1.6536 WP_003418948.1.65374 WP_003418948.1.65386 WP_003418948.1.65414 WP_003418948.1.65416 WP_003418948.1.65433 WP_003418948.1.65455 WP_003418948.1.65467 WP_003418948.1.65488 WP_003418948.1.65529 WP_003418948.1.65539 WP_003418948.1.65583 WP_003418948.1.65612 WP_003418948.1.65623 WP_003418948.1.65635 WP_003418948.1.65637 WP_003418948.1.65648 WP_003418948.1.65683 WP_003418948.1.65686 WP_003418948.1.65688 WP_003418948.1.65707 WP_003418948.1.65733 WP_003418948.1.65746 WP_003418948.1.65747 WP_003418948.1.65759 WP_003418948.1.65816 WP_003418948.1.65830 WP_003418948.1.65858 WP_003418948.1.65862 WP_003418948.1.65869 WP_003418948.1.65893 WP_003418948.1.65929 WP_003418948.1.65932 WP_003418948.1.65958 WP_003418948.1.65974 WP_003418948.1.66004 WP_003418948.1.6606 WP_003418948.1.66089 WP_003418948.1.66149 WP_003418948.1.66151 WP_003418948.1.66229 WP_003418948.1.66276 WP_003418948.1.66293 WP_003418948.1.66297 WP_003418948.1.66323 WP_003418948.1.66325 WP_003418948.1.6633 WP_003418948.1.66334 WP_003418948.1.66355 WP_003418948.1.66367 WP_003418948.1.66394 WP_003418948.1.66396 WP_003418948.1.66451 WP_003418948.1.66455 WP_003418948.1.66457 WP_003418948.1.66464 WP_003418948.1.66466 WP_003418948.1.66487 WP_003418948.1.66504 WP_003418948.1.66544 WP_003418948.1.66558 WP_003418948.1.66580 WP_003418948.1.66582 WP_003418948.1.66612 WP_003418948.1.66615 WP_003418948.1.66617 WP_003418948.1.66635 WP_003418948.1.66656 WP_003418948.1.66663 WP_003418948.1.66675 WP_003418948.1.66715 WP_003418948.1.66718 WP_003418948.1.66762 WP_003418948.1.66776 WP_003418948.1.66808 WP_003418948.1.66817 WP_003418948.1.66819 WP_003418948.1.66826 WP_003418948.1.66830 WP_003418948.1.66842 WP_003418948.1.66868 WP_003418948.1.66878 WP_003418948.1.66880 WP_003418948.1.66893 WP_003418948.1.66961 WP_003418948.1.67005 WP_003418948.1.6704 WP_003418948.1.67044 WP_003418948.1.67061 WP_003418948.1.67098 WP_003418948.1.67146 WP_003418948.1.67170 WP_003418948.1.67197 WP_003418948.1.67198 WP_003418948.1.6720 WP_003418948.1.67207 WP_003418948.1.67218 WP_003418948.1.67220 WP_003418948.1.67225 WP_003418948.1.67231 WP_003418948.1.6724 WP_003418948.1.67257 WP_003418948.1.67298 WP_003418948.1.67307 WP_003418948.1.67324 WP_003418948.1.67332 WP_003418948.1.67346 WP_003418948.1.67354 WP_003418948.1.67360 WP_003418948.1.67381 WP_003418948.1.67396 WP_003418948.1.67417 WP_003418948.1.67422 WP_003418948.1.67453 WP_003418948.1.67459 WP_003418948.1.6746 WP_003418948.1.67473 WP_003418948.1.67481 WP_003418948.1.67482 WP_003418948.1.67496 WP_003418948.1.67499 WP_003418948.1.67516 WP_003418948.1.67523 WP_003418948.1.67536 WP_003418948.1.67575 WP_003418948.1.67587 WP_003418948.1.67598 WP_003418948.1.67600 WP_003418948.1.67602 WP_003418948.1.67630 WP_003418948.1.67679 WP_003418948.1.67692 WP_003418948.1.67744 WP_003418948.1.6775 WP_003418948.1.67750 WP_003418948.1.6777 WP_003418948.1.67809 WP_003418948.1.67816 WP_003418948.1.67844 WP_003418948.1.67848 WP_003418948.1.67870 WP_003418948.1.67888 WP_003418948.1.67915 WP_003418948.1.67945 WP_003418948.1.67949 WP_003418948.1.67980 WP_003418948.1.67982 WP_003418948.1.68022 WP_003418948.1.68029 WP_003418948.1.68037 WP_003418948.1.68038 WP_003418948.1.68045 WP_003418948.1.68057 WP_003418948.1.68083 WP_003418948.1.68088 WP_003418948.1.68106 WP_003418948.1.68110 WP_003418948.1.68153 WP_003418948.1.68164 WP_003418948.1.68169 WP_003418948.1.68193 WP_003418948.1.68212 WP_003418948.1.68243 WP_003418948.1.6825 WP_003418948.1.68297 WP_003418948.1.68309 WP_003418948.1.68325 WP_003418948.1.68329 WP_003418948.1.68340 WP_003418948.1.68384 WP_003418948.1.68388 WP_003418948.1.68429 WP_003418948.1.6843 WP_003418948.1.68433 WP_003418948.1.68444 WP_003418948.1.68465 WP_003418948.1.68484 WP_003418948.1.68518 WP_003418948.1.68569 WP_003418948.1.68576 WP_003418948.1.68580 WP_003418948.1.68586 WP_003418948.1.68623 WP_003418948.1.68624 WP_003418948.1.68637 WP_003418948.1.68646 WP_003418948.1.68667 WP_003418948.1.68669 WP_003418948.1.68672 WP_003418948.1.68684 WP_003418948.1.68704 WP_003418948.1.68708 WP_003418948.1.6872 WP_003418948.1.68730 WP_003418948.1.68734 WP_003418948.1.68748 WP_003418948.1.68754 WP_003418948.1.6876 WP_003418948.1.68761 WP_003418948.1.68763 WP_003418948.1.68766 WP_003418948.1.68774 WP_003418948.1.68796 WP_003418948.1.68824 WP_003418948.1.68832 WP_003418948.1.68833 WP_003418948.1.68841 WP_003418948.1.68859 WP_003418948.1.68876 WP_003418948.1.68906 WP_003418948.1.68916 WP_003418948.1.68923 WP_003418948.1.68945 WP_003418948.1.6896 WP_003418948.1.68981 WP_003418948.1.68984 WP_003418948.1.68997 WP_003418948.1.69008 WP_003418948.1.69076 WP_003418948.1.69079 WP_003418948.1.6908 WP_003418948.1.69082 WP_003418948.1.69178 WP_003418948.1.69208 WP_003418948.1.69256 WP_003418948.1.69311 WP_003418948.1.69315 WP_003418948.1.69322 WP_003418948.1.69342 WP_003418948.1.6935 WP_003418948.1.6936 WP_003418948.1.69369 WP_003418948.1.69374 WP_003418948.1.69398 WP_003418948.1.69401 WP_003418948.1.69426 WP_003418948.1.69427 WP_003418948.1.69429 WP_003418948.1.6949 WP_003418948.1.6951 WP_003418948.1.69511 WP_003418948.1.69526 WP_003418948.1.69528 WP_003418948.1.69547 WP_003418948.1.69573 WP_003418948.1.69581 WP_003418948.1.6960 WP_003418948.1.69617 WP_003418948.1.69634 WP_003418948.1.69647 WP_003418948.1.69659 WP_003418948.1.69673 WP_003418948.1.69682 WP_003418948.1.69684 WP_003418948.1.69686 WP_003418948.1.69707 WP_003418948.1.69709 WP_003418948.1.69723 WP_003418948.1.69736 WP_003418948.1.69778 WP_003418948.1.69800 WP_003418948.1.69802 WP_003418948.1.69845 WP_003418948.1.69870 WP_003418948.1.69873 WP_003418948.1.69898 WP_003418948.1.69913 WP_003418948.1.69925 WP_003418948.1.69931 WP_003418948.1.69938 WP_003418948.1.69955 WP_003418948.1.69957 WP_003418948.1.69981 WP_003418948.1.69990 WP_003418948.1.70 WP_003418948.1.70000 WP_003418948.1.70017 WP_003418948.1.70032 WP_003418948.1.70055 WP_003418948.1.70062 WP_003418948.1.70072 WP_003418948.1.70131 WP_003418948.1.70132 WP_003418948.1.7022 WP_003418948.1.70227 WP_003418948.1.70255 WP_003418948.1.70271 WP_003418948.1.70274 WP_003418948.1.7029 WP_003418948.1.70325 WP_003418948.1.70328 WP_003418948.1.70356 WP_003418948.1.70364 WP_003418948.1.70368 WP_003418948.1.70369 WP_003418948.1.70418 WP_003418948.1.70422 WP_003418948.1.70435 WP_003418948.1.70444 WP_003418948.1.70463 WP_003418948.1.70471 WP_003418948.1.70480 WP_003418948.1.70494 WP_003418948.1.70498 WP_003418948.1.70505 WP_003418948.1.70525 WP_003418948.1.70573 WP_003418948.1.70577 WP_003418948.1.70610 WP_003418948.1.70615 WP_003418948.1.70618 WP_003418948.1.70622 WP_003418948.1.70626 WP_003418948.1.70668 WP_003418948.1.70699 WP_003418948.1.70704 WP_003418948.1.70729 WP_003418948.1.70757 WP_003418948.1.70782 WP_003418948.1.70796 WP_003418948.1.70830 WP_003418948.1.70834 WP_003418948.1.7084 WP_003418948.1.70840 WP_003418948.1.70864 WP_003418948.1.70871 WP_003418948.1.70915 WP_003418948.1.70955 WP_003418948.1.70958 WP_003418948.1.70964 WP_003418948.1.70976 WP_003418948.1.71015 WP_003418948.1.71026 WP_003418948.1.71063 WP_003418948.1.71076 WP_003418948.1.71083 WP_003418948.1.7111 WP_003418948.1.71118 WP_003418948.1.71128 WP_003418948.1.7113 WP_003418948.1.71187 WP_003418948.1.71191 WP_003418948.1.71258 WP_003418948.1.71259 WP_003418948.1.71289 WP_003418948.1.71326 WP_003418948.1.71329 WP_003418948.1.71331 WP_003418948.1.71344 WP_003418948.1.71390 WP_003418948.1.71399 WP_003418948.1.71414 WP_003418948.1.71440 WP_003418948.1.71457 WP_003418948.1.7146 WP_003418948.1.71464 WP_003418948.1.71490 WP_003418948.1.71492 WP_003418948.1.71509 WP_003418948.1.71516 WP_003418948.1.71517 WP_003418948.1.71527 WP_003418948.1.71532 WP_003418948.1.71545 WP_003418948.1.71546 WP_003418948.1.71569 WP_003418948.1.71604 WP_003418948.1.71630 WP_003418948.1.71638 WP_003418948.1.71654 WP_003418948.1.71664 WP_003418948.1.71665 WP_003418948.1.71683 WP_003418948.1.71701 WP_003418948.1.71718 WP_003418948.1.71731 WP_003418948.1.71778 WP_003418948.1.71781 WP_003418948.1.71803 WP_003418948.1.71847 WP_003418948.1.7185 WP_003418948.1.71851 WP_003418948.1.71871 WP_003418948.1.71909 WP_003418948.1.71957 WP_003418948.1.71970 WP_003418948.1.72047 WP_003418948.1.72061 WP_003418948.1.72062 WP_003418948.1.72072 WP_003418948.1.72111 WP_003418948.1.72122 WP_003418948.1.72128 WP_003418948.1.72143 WP_003418948.1.7216 WP_003418948.1.72168 WP_003418948.1.72179 WP_003418948.1.72209 WP_003418948.1.72227 WP_003418948.1.7224 WP_003418948.1.72268 WP_003418948.1.72332 WP_003418948.1.72380 WP_003418948.1.72401 WP_003418948.1.72405 WP_003418948.1.72420 WP_003418948.1.72441 WP_003418948.1.72451 WP_003418948.1.72452 WP_003418948.1.72457 WP_003418948.1.72459 WP_003418948.1.72460 WP_003418948.1.72466 WP_003418948.1.72487 WP_003418948.1.72488 WP_003418948.1.72492 WP_003418948.1.72506 WP_003418948.1.72543 WP_003418948.1.7256 WP_003418948.1.72576 WP_003418948.1.72578 WP_003418948.1.72585 WP_003418948.1.72591 WP_003418948.1.72592 WP_003418948.1.72640 WP_003418948.1.72661 WP_003418948.1.72684 WP_003418948.1.72739 WP_003418948.1.72744 WP_003418948.1.72755 WP_003418948.1.72759 WP_003418948.1.72784 WP_003418948.1.72792 WP_003418948.1.72826 WP_003418948.1.72831 WP_003418948.1.72852 WP_003418948.1.72853 WP_003418948.1.72879 WP_003418948.1.72880 WP_003418948.1.72938 WP_003418948.1.72954 WP_003418948.1.72957 WP_003418948.1.72959 WP_003418948.1.72973 WP_003418948.1.7298 WP_003418948.1.72982 WP_003418948.1.72988 WP_003418948.1.72993 WP_003418948.1.73006 WP_003418948.1.73013 WP_003418948.1.73025 WP_003418948.1.73028 WP_003418948.1.73042 WP_003418948.1.73045 WP_003418948.1.73092 WP_003418948.1.73118 WP_003418948.1.7312 WP_003418948.1.73127 WP_003418948.1.73134 WP_003418948.1.73150 WP_003418948.1.73154 WP_003418948.1.73163 WP_003418948.1.73182 WP_003418948.1.73205 WP_003418948.1.7321 WP_003418948.1.73310 WP_003418948.1.73365 WP_003418948.1.73391 WP_003418948.1.73404 WP_003418948.1.73424 WP_003418948.1.73436 WP_003418948.1.73445 WP_003418948.1.73453 WP_003418948.1.73465 WP_003418948.1.73466 WP_003418948.1.73470 WP_003418948.1.73471 WP_003418948.1.73478 WP_003418948.1.73482 WP_003418948.1.73507 WP_003418948.1.73532 WP_003418948.1.73550 WP_003418948.1.73564 WP_003418948.1.73623 WP_003418948.1.73629 WP_003418948.1.73644 WP_003418948.1.7366 WP_003418948.1.73661 WP_003418948.1.7368 WP_003418948.1.73688 WP_003418948.1.73723 WP_003418948.1.73744 WP_003418948.1.73750 WP_003418948.1.73760 WP_003418948.1.73774 WP_003418948.1.7379 WP_003418948.1.73813 WP_003418948.1.73840 WP_003418948.1.73876 WP_003418948.1.7389 WP_003418948.1.73986 WP_003418948.1.74016 WP_003418948.1.74039 WP_003418948.1.74083 WP_003418948.1.74101 WP_003418948.1.74107 WP_003418948.1.74120 WP_003418948.1.74129 WP_003418948.1.74144 WP_003418948.1.7417 WP_003418948.1.74190 WP_003418948.1.74210 WP_003418948.1.7423 WP_003418948.1.74259 WP_003418948.1.74262 WP_003418948.1.74269 WP_003418948.1.74282 WP_003418948.1.74291 WP_003418948.1.74296 WP_003418948.1.74304 WP_003418948.1.7432 WP_003418948.1.74347 WP_003418948.1.7436 WP_003418948.1.74378 WP_003418948.1.74382 WP_003418948.1.74395 WP_003418948.1.74400 WP_003418948.1.74401 WP_003418948.1.74432 WP_003418948.1.74442 WP_003418948.1.74487 WP_003418948.1.74499 WP_003418948.1.74504 WP_003418948.1.74511 WP_003418948.1.74523 WP_003418948.1.74525 WP_003418948.1.74551 WP_003418948.1.74555 WP_003418948.1.74628 WP_003418948.1.74641 WP_003418948.1.74653 WP_003418948.1.74660 WP_003418948.1.74683 WP_003418948.1.7469 WP_003418948.1.74725 WP_003418948.1.74760 WP_003418948.1.74786 WP_003418948.1.74809 WP_003418948.1.74820 WP_003418948.1.74870 WP_003418948.1.74881 WP_003418948.1.74888 WP_003418948.1.74952 WP_003418948.1.7496 WP_003418948.1.74988 WP_003418948.1.75043 WP_003418948.1.75045 WP_003418948.1.75055 WP_003418948.1.75078 WP_003418948.1.75081 WP_003418948.1.75120 WP_003418948.1.75163 WP_003418948.1.75188 WP_003418948.1.75200 WP_003418948.1.75202 WP_003418948.1.75234 WP_003418948.1.75239 WP_003418948.1.75250 WP_003418948.1.75263 WP_003418948.1.75281 WP_003418948.1.75342 WP_003418948.1.7535 WP_003418948.1.75376 WP_003418948.1.75391 WP_003418948.1.75395 WP_003418948.1.75441 WP_003418948.1.75510 WP_003418948.1.75581 WP_003418948.1.75598 WP_003418948.1.75635 WP_003418948.1.75645 WP_003418948.1.75665 WP_003418948.1.75671 WP_003418948.1.75741 WP_003418948.1.75749 WP_003418948.1.75772 WP_003418948.1.75774 WP_003418948.1.75811 WP_003418948.1.75833 WP_003418948.1.7585 WP_003418948.1.75864 WP_003418948.1.75868 WP_003418948.1.75878 WP_003418948.1.75927 WP_003418948.1.75946 WP_003418948.1.75968 WP_003418948.1.75974 WP_003418948.1.76007 WP_003418948.1.76016 WP_003418948.1.76032 WP_003418948.1.76037 WP_003418948.1.7604 WP_003418948.1.76045 WP_003418948.1.76052 WP_003418948.1.76058 WP_003418948.1.76064 WP_003418948.1.76110 WP_003418948.1.76126 WP_003418948.1.76133 WP_003418948.1.76138 WP_003418948.1.76157 WP_003418948.1.76172 WP_003418948.1.76177 WP_003418948.1.76183 WP_003418948.1.76209 WP_003418948.1.76239 WP_003418948.1.76272 WP_003418948.1.76277 WP_003418948.1.76280 WP_003418948.1.76281 WP_003418948.1.76291 WP_003418948.1.76297 WP_003418948.1.76360 WP_003418948.1.76379 WP_003418948.1.76403 WP_003418948.1.76413 WP_003418948.1.76414 WP_003418948.1.76427 WP_003418948.1.76436 WP_003418948.1.76442 WP_003418948.1.76443 WP_003418948.1.76456 WP_003418948.1.76521 WP_003418948.1.76533 WP_003418948.1.76616 WP_003418948.1.76625 WP_003418948.1.76629 WP_003418948.1.76635 WP_003418948.1.76638 WP_003418948.1.76639 WP_003418948.1.76640 WP_003418948.1.76644 WP_003418948.1.76677 WP_003418948.1.76678 WP_003418948.1.76679 WP_003418948.1.76734 WP_003418948.1.76744 WP_003418948.1.76750 WP_003418948.1.76754 WP_003418948.1.76757 WP_003418948.1.76781 WP_003418948.1.76818 WP_003418948.1.76824 WP_003418948.1.76835 WP_003418948.1.76873 WP_003418948.1.76881 WP_003418948.1.76888 WP_003418948.1.7691 WP_003418948.1.76947 WP_003418948.1.76954 WP_003418948.1.76955 WP_003418948.1.76963 WP_003418948.1.770 WP_003418948.1.77000 WP_003418948.1.77008 WP_003418948.1.77021 WP_003418948.1.77056 WP_003418948.1.77065 WP_003418948.1.77075 WP_003418948.1.77107 WP_003418948.1.77115 WP_003418948.1.77118 WP_003418948.1.77125 WP_003418948.1.77141 WP_003418948.1.77142 WP_003418948.1.77250 WP_003418948.1.77252 WP_003418948.1.77260 WP_003418948.1.77266 WP_003418948.1.77280 WP_003418948.1.77285 WP_003418948.1.77312 WP_003418948.1.77348 WP_003418948.1.77351 WP_003418948.1.77352 WP_003418948.1.77361 WP_003418948.1.774 WP_003418948.1.7740 WP_003418948.1.77404 WP_003418948.1.77425 WP_003418948.1.77463 WP_003418948.1.77474 WP_003418948.1.7748 WP_003418948.1.77484 WP_003418948.1.77491 WP_003418948.1.77499 WP_003418948.1.77510 WP_003418948.1.77530 WP_003418948.1.77554 WP_003418948.1.77559 WP_003418948.1.77599 WP_003418948.1.77605 WP_003418948.1.7762 WP_003418948.1.77627 WP_003418948.1.77649 WP_003418948.1.77654 WP_003418948.1.7766 WP_003418948.1.77667 WP_003418948.1.77704 WP_003418948.1.77706 WP_003418948.1.77726 WP_003418948.1.77774 WP_003418948.1.7778 WP_003418948.1.77790 WP_003418948.1.77809 WP_003418948.1.77820 WP_003418948.1.77843 WP_003418948.1.77855 WP_003418948.1.77865 WP_003418948.1.77868 WP_003418948.1.77890 WP_003418948.1.77909 WP_003418948.1.77911 WP_003418948.1.77931 WP_003418948.1.77984 WP_003418948.1.78020 WP_003418948.1.78024 WP_003418948.1.78075 WP_003418948.1.78084 WP_003418948.1.78086 WP_003418948.1.7809 WP_003418948.1.78098 WP_003418948.1.78105 WP_003418948.1.78113 WP_003418948.1.78136 WP_003418948.1.78162 WP_003418948.1.7817 WP_003418948.1.78200 WP_003418948.1.78216 WP_003418948.1.78236 WP_003418948.1.78238 WP_003418948.1.78322 WP_003418948.1.78338 WP_003418948.1.7836 WP_003418948.1.78360 WP_003418948.1.78386 WP_003418948.1.78435 WP_003418948.1.7844 WP_003418948.1.78459 WP_003418948.1.78488 WP_003418948.1.7849 WP_003418948.1.78499 WP_003418948.1.785 WP_003418948.1.78516 WP_003418948.1.78524 WP_003418948.1.78526 WP_003418948.1.78538 WP_003418948.1.78545 WP_003418948.1.78547 WP_003418948.1.78574 WP_003418948.1.78580 WP_003418948.1.7860 WP_003418948.1.78620 WP_003418948.1.78646 WP_003418948.1.78648 WP_003418948.1.78649 WP_003418948.1.78655 WP_003418948.1.78657 WP_003418948.1.78659 WP_003418948.1.7869 WP_003418948.1.78692 WP_003418948.1.78760 WP_003418948.1.78766 WP_003418948.1.78776 WP_003418948.1.78778 WP_003418948.1.78784 WP_003418948.1.78788 WP_003418948.1.78790 WP_003418948.1.78793 WP_003418948.1.78860 WP_003418948.1.7887 WP_003418948.1.78884 WP_003418948.1.78932 WP_003418948.1.78969 WP_003418948.1.78977 WP_003418948.1.78980 WP_003418948.1.79005 WP_003418948.1.79016 WP_003418948.1.79064 WP_003418948.1.79066 WP_003418948.1.79068 WP_003418948.1.79077 WP_003418948.1.79095 WP_003418948.1.79112 WP_003418948.1.79122 WP_003418948.1.79145 WP_003418948.1.79152 WP_003418948.1.79163 WP_003418948.1.79182 WP_003418948.1.79198 WP_003418948.1.79213 WP_003418948.1.79218 WP_003418948.1.79268 WP_003418948.1.79273 WP_003418948.1.79278 WP_003418948.1.79290 WP_003418948.1.79319 WP_003418948.1.79326 WP_003418948.1.7933 WP_003418948.1.79330 WP_003418948.1.79339 WP_003418948.1.79394 WP_003418948.1.79399 WP_003418948.1.79413 WP_003418948.1.79422 WP_003418948.1.79445 WP_003418948.1.79447 WP_003418948.1.79455 WP_003418948.1.79471 WP_003418948.1.79480 WP_003418948.1.79482 WP_003418948.1.79500 WP_003418948.1.79502 WP_003418948.1.79508 WP_003418948.1.79514 WP_003418948.1.79561 WP_003418948.1.79565 WP_003418948.1.79578 WP_003418948.1.79588 WP_003418948.1.79598 WP_003418948.1.79615 WP_003418948.1.79698 WP_003418948.1.797 WP_003418948.1.79744 WP_003418948.1.79784 WP_003418948.1.79802 WP_003418948.1.79806 WP_003418948.1.79819 WP_003418948.1.79826 WP_003418948.1.79828 WP_003418948.1.79851 WP_003418948.1.79853 WP_003418948.1.79863 WP_003418948.1.79881 WP_003418948.1.79885 WP_003418948.1.79898 WP_003418948.1.7990 WP_003418948.1.79900 WP_003418948.1.79913 WP_003418948.1.79918 WP_003418948.1.79947 WP_003418948.1.79948 WP_003418948.1.7995 WP_003418948.1.7997 WP_003418948.1.80004 WP_003418948.1.80015 WP_003418948.1.80022 WP_003418948.1.80030 WP_003418948.1.80054 WP_003418948.1.80084 WP_003418948.1.80099 WP_003418948.1.80129 WP_003418948.1.80177 WP_003418948.1.80234 WP_003418948.1.8026 WP_003418948.1.80275 WP_003418948.1.8029 WP_003418948.1.80299 WP_003418948.1.80300 WP_003418948.1.80304 WP_003418948.1.80326 WP_003418948.1.80351 WP_003418948.1.8037 WP_003418948.1.80370 WP_003418948.1.80387 WP_003418948.1.80399 WP_003418948.1.8044 WP_003418948.1.80451 WP_003418948.1.80458 WP_003418948.1.80490 WP_003418948.1.80503 WP_003418948.1.80507 WP_003418948.1.80552 WP_003418948.1.80576 WP_003418948.1.80588 WP_003418948.1.80599 WP_003418948.1.8060 WP_003418948.1.80624 WP_003418948.1.80636 WP_003418948.1.80673 WP_003418948.1.80711 WP_003418948.1.80714 WP_003418948.1.80743 WP_003418948.1.80784 WP_003418948.1.80815 WP_003418948.1.80853 WP_003418948.1.80918 WP_003418948.1.8093 WP_003418948.1.80967 WP_003418948.1.8097 WP_003418948.1.80988 WP_003418948.1.81007 WP_003418948.1.81013 WP_003418948.1.8105 WP_003418948.1.81059 WP_003418948.1.81063 WP_003418948.1.81066 WP_003418948.1.81075 WP_003418948.1.81091 WP_003418948.1.81119 WP_003418948.1.81125 WP_003418948.1.81136 WP_003418948.1.8114 WP_003418948.1.81189 WP_003418948.1.81192 WP_003418948.1.812 WP_003418948.1.81230 WP_003418948.1.81249 WP_003418948.1.81250 WP_003418948.1.81264 WP_003418948.1.8128 WP_003418948.1.81287 WP_003418948.1.81297 WP_003418948.1.8138 WP_003418948.1.81407 WP_003418948.1.8143 WP_003418948.1.81439 WP_003418948.1.81465 WP_003418948.1.81505 WP_003418948.1.81529 WP_003418948.1.81538 WP_003418948.1.81541 WP_003418948.1.81560 WP_003418948.1.81561 WP_003418948.1.81567 WP_003418948.1.81583 WP_003418948.1.81686 WP_003418948.1.81712 WP_003418948.1.81720 WP_003418948.1.81731 WP_003418948.1.81774 WP_003418948.1.81788 WP_003418948.1.81809 WP_003418948.1.81820 WP_003418948.1.81850 WP_003418948.1.81883 WP_003418948.1.81891 WP_003418948.1.81911 WP_003418948.1.81918 WP_003418948.1.82011 WP_003418948.1.82048 WP_003418948.1.82069 WP_003418948.1.82071 WP_003418948.1.82108 WP_003418948.1.82136 WP_003418948.1.82142 WP_003418948.1.8215 WP_003418948.1.82158 WP_003418948.1.8217 WP_003418948.1.82209 WP_003418948.1.82210 WP_003418948.1.82228 WP_003418948.1.82236 WP_003418948.1.82251 WP_003418948.1.82271 WP_003418948.1.82305 WP_003418948.1.82307 WP_003418948.1.82309 WP_003418948.1.82317 WP_003418948.1.8232 WP_003418948.1.82346 WP_003418948.1.82374 WP_003418948.1.82385 WP_003418948.1.82429 WP_003418948.1.82460 WP_003418948.1.82462 WP_003418948.1.82483 WP_003418948.1.82494 WP_003418948.1.82531 WP_003418948.1.82546 WP_003418948.1.82547 WP_003418948.1.82549 WP_003418948.1.82577 WP_003418948.1.82592 WP_003418948.1.82597 WP_003418948.1.82598 WP_003418948.1.82625 WP_003418948.1.82642 WP_003418948.1.82651 WP_003418948.1.82653 WP_003418948.1.8271 WP_003418948.1.82712 WP_003418948.1.8273 WP_003418948.1.82743 WP_003418948.1.82757 WP_003418948.1.82774 WP_003418948.1.82803 WP_003418948.1.82836 WP_003418948.1.82860 WP_003418948.1.82871 WP_003418948.1.82892 WP_003418948.1.82935 WP_003418948.1.82957 WP_003418948.1.82973 WP_003418948.1.82981 WP_003418948.1.82983 WP_003418948.1.83004 WP_003418948.1.83009 WP_003418948.1.83044 WP_003418948.1.83065 WP_003418948.1.83074 WP_003418948.1.83110 WP_003418948.1.83146 WP_003418948.1.83149 WP_003418948.1.83159 WP_003418948.1.8317 WP_003418948.1.83173 WP_003418948.1.83181 WP_003418948.1.83182 WP_003418948.1.83191 WP_003418948.1.83197 WP_003418948.1.83212 WP_003418948.1.8326 WP_003418948.1.83262 WP_003418948.1.83273 WP_003418948.1.83309 WP_003418948.1.83332 WP_003418948.1.83334 WP_003418948.1.83341 WP_003418948.1.83349 WP_003418948.1.8335 WP_003418948.1.83353 WP_003418948.1.83367 WP_003418948.1.83380 WP_003418948.1.83381 WP_003418948.1.83389 WP_003418948.1.83408 WP_003418948.1.83409 WP_003418948.1.83435 WP_003418948.1.83470 WP_003418948.1.83524 WP_003418948.1.83526 WP_003418948.1.8358 WP_003418948.1.83589 WP_003418948.1.83601 WP_003418948.1.83611 WP_003418948.1.83638 WP_003418948.1.83648 WP_003418948.1.83656 WP_003418948.1.83667 WP_003418948.1.83689 WP_003418948.1.83692 WP_003418948.1.83705 WP_003418948.1.83766 WP_003418948.1.83793 WP_003418948.1.83794 WP_003418948.1.83802 WP_003418948.1.83805 WP_003418948.1.83839 WP_003418948.1.83842 WP_003418948.1.83850 WP_003418948.1.83861 WP_003418948.1.83884 WP_003418948.1.83920 WP_003418948.1.83929 WP_003418948.1.83975 WP_003418948.1.83991 WP_003418948.1.8400 WP_003418948.1.84027 WP_003418948.1.8404 WP_003418948.1.84057 WP_003418948.1.84070 WP_003418948.1.8409 WP_003418948.1.84112 WP_003418948.1.84146 WP_003418948.1.8415 WP_003418948.1.84176 WP_003418948.1.84186 WP_003418948.1.84192 WP_003418948.1.84228 WP_003418948.1.8424 WP_003418948.1.84244 WP_003418948.1.84259 WP_003418948.1.8426 WP_003418948.1.84277 WP_003418948.1.84287 WP_003418948.1.8434 WP_003418948.1.84388 WP_003418948.1.84408 WP_003418948.1.84409 WP_003418948.1.84438 WP_003418948.1.84460 WP_003418948.1.84488 WP_003418948.1.84504 WP_003418948.1.84525 WP_003418948.1.84620 WP_003418948.1.84623 WP_003418948.1.84641 WP_003418948.1.84655 WP_003418948.1.84666 WP_003418948.1.84670 WP_003418948.1.84739 WP_003418948.1.84748 WP_003418948.1.84766 WP_003418948.1.84772 WP_003418948.1.84774 WP_003418948.1.848 WP_003418948.1.84812 WP_003418948.1.84836 WP_003418948.1.84839 WP_003418948.1.84846 WP_003418948.1.84873 WP_003418948.1.84938 WP_003418948.1.84968 WP_003418948.1.84973 WP_003418948.1.84981 WP_003418948.1.84985 WP_003418948.1.8503 WP_003418948.1.85038 WP_003418948.1.85041 WP_003418948.1.85043 WP_003418948.1.8505 WP_003418948.1.85074 WP_003418948.1.8509 WP_003418948.1.8512 WP_003418948.1.85148 WP_003418948.1.8518 WP_003418948.1.8522 WP_003418948.1.85242 WP_003418948.1.85276 WP_003418948.1.85281 WP_003418948.1.85284 WP_003418948.1.85314 WP_003418948.1.85319 WP_003418948.1.85330 WP_003418948.1.85341 WP_003418948.1.85346 WP_003418948.1.8535 WP_003418948.1.85363 WP_003418948.1.85371 WP_003418948.1.85377 WP_003418948.1.85387 WP_003418948.1.85399 WP_003418948.1.85458 WP_003418948.1.8546 WP_003418948.1.85464 WP_003418948.1.85478 WP_003418948.1.85480 WP_003418948.1.85488 WP_003418948.1.85495 WP_003418948.1.85551 WP_003418948.1.85557 WP_003418948.1.85577 WP_003418948.1.85597 WP_003418948.1.85599 WP_003418948.1.85610 WP_003418948.1.8563 WP_003418948.1.85648 WP_003418948.1.85679 WP_003418948.1.85704 WP_003418948.1.85717 WP_003418948.1.85727 WP_003418948.1.85737 WP_003418948.1.85763 WP_003418948.1.85808 WP_003418948.1.85819 WP_003418948.1.85820 WP_003418948.1.85823 WP_003418948.1.85832 WP_003418948.1.8586 WP_003418948.1.85872 WP_003418948.1.85894 WP_003418948.1.85909 WP_003418948.1.85913 WP_003418948.1.85953 WP_003418948.1.85986 WP_003418948.1.86000 WP_003418948.1.86024 WP_003418948.1.86025 WP_003418948.1.86032 WP_003418948.1.86048 WP_003418948.1.86052 WP_003418948.1.86067 WP_003418948.1.86103 WP_003418948.1.86122 WP_003418948.1.86124 WP_003418948.1.86160 WP_003418948.1.86164 WP_003418948.1.86168 WP_003418948.1.86190 WP_003418948.1.86204 WP_003418948.1.86208 WP_003418948.1.86235 WP_003418948.1.86249 WP_003418948.1.86260 WP_003418948.1.86290 WP_003418948.1.863 WP_003418948.1.86327 WP_003418948.1.86334 WP_003418948.1.86337 WP_003418948.1.86368 WP_003418948.1.86377 WP_003418948.1.86425 WP_003418948.1.86459 WP_003418948.1.8649 WP_003418948.1.86499 WP_003418948.1.86520 WP_003418948.1.86561 WP_003418948.1.86568 WP_003418948.1.86575 WP_003418948.1.86584 WP_003418948.1.86605 WP_003418948.1.86626 WP_003418948.1.86648 WP_003418948.1.8666 WP_003418948.1.86684 WP_003418948.1.86696 WP_003418948.1.86705 WP_003418948.1.86718 WP_003418948.1.86725 WP_003418948.1.86757 WP_003418948.1.86766 WP_003418948.1.86801 WP_003418948.1.86814 WP_003418948.1.86820 WP_003418948.1.86825 WP_003418948.1.86834 WP_003418948.1.8685 WP_003418948.1.86851 WP_003418948.1.86855 WP_003418948.1.86867 WP_003418948.1.86877 WP_003418948.1.86883 WP_003418948.1.8689 WP_003418948.1.86892 WP_003418948.1.86933 WP_003418948.1.86941 WP_003418948.1.86950 WP_003418948.1.86962 WP_003418948.1.86963 WP_003418948.1.86979 WP_003418948.1.8700 WP_003418948.1.87001 WP_003418948.1.87002 WP_003418948.1.87031 WP_003418948.1.87116 WP_003418948.1.87117 WP_003418948.1.8714 WP_003418948.1.87162 WP_003418948.1.87178 WP_003418948.1.87191 WP_003418948.1.87201 WP_003418948.1.87209 WP_003418948.1.87240 WP_003418948.1.87266 WP_003418948.1.87273 WP_003418948.1.87275 WP_003418948.1.8733 WP_003418948.1.87345 WP_003418948.1.87369 WP_003418948.1.8737 WP_003418948.1.87401 WP_003418948.1.87404 WP_003418948.1.87406 WP_003418948.1.87409 WP_003418948.1.87444 WP_003418948.1.87446 WP_003418948.1.87459 WP_003418948.1.87472 WP_003418948.1.87489 WP_003418948.1.87494 WP_003418948.1.87496 WP_003418948.1.87582 WP_003418948.1.87588 WP_003418948.1.87617 WP_003418948.1.87619 WP_003418948.1.87620 WP_003418948.1.87634 WP_003418948.1.87643 WP_003418948.1.8765 WP_003418948.1.87650 WP_003418948.1.87654 WP_003418948.1.87658 WP_003418948.1.87665 WP_003418948.1.87676 WP_003418948.1.87677 WP_003418948.1.87684 WP_003418948.1.87692 WP_003418948.1.87707 WP_003418948.1.87732 WP_003418948.1.87784 WP_003418948.1.87796 WP_003418948.1.87809 WP_003418948.1.87817 WP_003418948.1.87827 WP_003418948.1.87831 WP_003418948.1.87835 WP_003418948.1.87837 WP_003418948.1.87866 WP_003418948.1.8789 WP_003418948.1.87911 WP_003418948.1.87924 WP_003418948.1.87951 WP_003418948.1.87955 WP_003418948.1.87956 WP_003418948.1.87991 WP_003418948.1.88 WP_003418948.1.88002 WP_003418948.1.88037 WP_003418948.1.88039 WP_003418948.1.88072 WP_003418948.1.88077 WP_003418948.1.88121 WP_003418948.1.88180 WP_003418948.1.88191 WP_003418948.1.88205 WP_003418948.1.88217 WP_003418948.1.88219 WP_003418948.1.88245 WP_003418948.1.88253 WP_003418948.1.88294 WP_003418948.1.88315 WP_003418948.1.88316 WP_003418948.1.88320 WP_003418948.1.88338 WP_003418948.1.8840 WP_003418948.1.88437 WP_003418948.1.88453 WP_003418948.1.88469 WP_003418948.1.88489 WP_003418948.1.88521 WP_003418948.1.88530 WP_003418948.1.88537 WP_003418948.1.88541 WP_003418948.1.88592 WP_003418948.1.88616 WP_003418948.1.88618 WP_003418948.1.88625 WP_003418948.1.88632 WP_003418948.1.88634 WP_003418948.1.88649 WP_003418948.1.8870 WP_003418948.1.88737 WP_003418948.1.888 WP_003418948.1.88824 WP_003418948.1.88886 WP_003418948.1.88965 WP_003418948.1.88985 WP_003418948.1.8902 WP_003418948.1.89025 WP_003418948.1.89041 WP_003418948.1.89046 WP_003418948.1.89082 WP_003418948.1.89162 WP_003418948.1.89168 WP_003418948.1.8917 WP_003418948.1.89193 WP_003418948.1.89205 WP_003418948.1.89207 WP_003418948.1.89225 WP_003418948.1.8925 WP_003418948.1.89277 WP_003418948.1.89286 WP_003418948.1.89293 WP_003418948.1.89320 WP_003418948.1.8935 WP_003418948.1.89371 WP_003418948.1.89378 WP_003418948.1.89392 WP_003418948.1.89406 WP_003418948.1.89451 WP_003418948.1.89453 WP_003418948.1.89473 WP_003418948.1.89475 WP_003418948.1.89483 WP_003418948.1.895 WP_003418948.1.89513 WP_003418948.1.89517 WP_003418948.1.89522 WP_003418948.1.8954 WP_003418948.1.89543 WP_003418948.1.89567 WP_003418948.1.8957 WP_003418948.1.89572 WP_003418948.1.89589 WP_003418948.1.89607 WP_003418948.1.89613 WP_003418948.1.89625 WP_003418948.1.89648 WP_003418948.1.8967 WP_003418948.1.89670 WP_003418948.1.89676 WP_003418948.1.89729 WP_003418948.1.89739 WP_003418948.1.89762 WP_003418948.1.8977 WP_003418948.1.89808 WP_003418948.1.8982 WP_003418948.1.89829 WP_003418948.1.89844 WP_003418948.1.89849 WP_003418948.1.8989 WP_003418948.1.89901 WP_003418948.1.89903 WP_003418948.1.89909 WP_003418948.1.89922 WP_003418948.1.89926 WP_003418948.1.89963 WP_003418948.1.89971 WP_003418948.1.8998 WP_003418948.1.89987 WP_003418948.1.900 WP_003418948.1.90048 WP_003418948.1.9007 WP_003418948.1.90080 WP_003418948.1.90130 WP_003418948.1.90134 WP_003418948.1.90137 WP_003418948.1.90157 WP_003418948.1.90184 WP_003418948.1.90199 WP_003418948.1.90231 WP_003418948.1.90245 WP_003418948.1.90308 WP_003418948.1.90322 WP_003418948.1.90328 WP_003418948.1.90372 WP_003418948.1.90439 WP_003418948.1.90481 WP_003418948.1.90499 WP_003418948.1.9050 WP_003418948.1.90527 WP_003418948.1.90550 WP_003418948.1.90560 WP_003418948.1.90612 WP_003418948.1.90640 WP_003418948.1.90672 WP_003418948.1.90691 WP_003418948.1.90711 WP_003418948.1.90722 WP_003418948.1.9075 WP_003418948.1.90756 WP_003418948.1.90767 WP_003418948.1.90771 WP_003418948.1.90785 WP_003418948.1.90788 WP_003418948.1.90800 WP_003418948.1.90810 WP_003418948.1.90816 WP_003418948.1.90819 WP_003418948.1.9082 WP_003418948.1.90831 WP_003418948.1.90884 WP_003418948.1.90899 WP_003418948.1.90906 WP_003418948.1.90958 WP_003418948.1.90976 WP_003418948.1.90977 WP_003418948.1.90987 WP_003418948.1.9102 WP_003418948.1.91026 WP_003418948.1.91032 WP_003418948.1.91043 WP_003418948.1.91053 WP_003418948.1.91082 WP_003418948.1.91106 WP_003418948.1.91144 WP_003418948.1.91151 WP_003418948.1.91157 WP_003418948.1.91167 WP_003418948.1.91169 WP_003418948.1.91192 WP_003418948.1.91201 WP_003418948.1.91207 WP_003418948.1.91208 WP_003418948.1.91211 WP_003418948.1.91214 WP_003418948.1.91230 WP_003418948.1.91244 WP_003418948.1.91251 WP_003418948.1.91260 WP_003418948.1.91265 WP_003418948.1.91284 WP_003418948.1.91294 WP_003418948.1.91303 WP_003418948.1.91322 WP_003418948.1.91352 WP_003418948.1.91386 WP_003418948.1.9139 WP_003418948.1.91398 WP_003418948.1.91430 WP_003418948.1.91436 WP_003418948.1.91483 WP_003418948.1.91496 WP_003418948.1.91507 WP_003418948.1.91576 WP_003418948.1.91589 WP_003418948.1.91694 WP_003418948.1.91695 WP_003418948.1.91713 WP_003418948.1.91716 WP_003418948.1.91717 WP_003418948.1.91728 WP_003418948.1.91743 WP_003418948.1.91759 WP_003418948.1.91784 WP_003418948.1.91785 WP_003418948.1.91786 WP_003418948.1.91802 WP_003418948.1.91822 WP_003418948.1.91828 WP_003418948.1.9189 WP_003418948.1.91896 WP_003418948.1.9190 WP_003418948.1.91915 WP_003418948.1.91931 WP_003418948.1.91937 WP_003418948.1.91944 WP_003418948.1.91953 WP_003418948.1.91957 WP_003418948.1.91976 WP_003418948.1.91978 WP_003418948.1.92021 WP_003418948.1.92083 WP_003418948.1.92127 WP_003418948.1.92144 WP_003418948.1.92150 WP_003418948.1.92153 WP_003418948.1.92190 WP_003418948.1.92192 WP_003418948.1.92200 WP_003418948.1.92220 WP_003418948.1.92221 WP_003418948.1.92222 WP_003418948.1.92273 WP_003418948.1.92289 WP_003418948.1.9229 WP_003418948.1.92294 WP_003418948.1.92300 WP_003418948.1.92317 WP_003418948.1.92334 WP_003418948.1.92338 WP_003418948.1.92345 WP_003418948.1.92356 WP_003418948.1.92364 WP_003418948.1.92380 WP_003418948.1.92416 WP_003418948.1.92428 WP_003418948.1.92447 WP_003418948.1.92456 WP_003418948.1.92467 WP_003418948.1.92471 WP_003418948.1.92490 WP_003418948.1.92508 WP_003418948.1.9251 WP_003418948.1.92511 WP_003418948.1.92523 WP_003418948.1.92527 WP_003418948.1.92536 WP_003418948.1.92592 WP_003418948.1.92597 WP_003418948.1.92603 WP_003418948.1.92606 WP_003418948.1.92610 WP_003418948.1.92613 WP_003418948.1.9263 WP_003418948.1.9265 WP_003418948.1.92650 WP_003418948.1.92660 WP_003418948.1.92677 WP_003418948.1.92685 WP_003418948.1.92689 WP_003418948.1.92690 WP_003418948.1.92706 WP_003418948.1.92714 WP_003418948.1.92736 WP_003418948.1.9274 WP_003418948.1.92752 WP_003418948.1.92760 WP_003418948.1.92777 WP_003418948.1.92803 WP_003418948.1.92833 WP_003418948.1.92856 WP_003418948.1.92881 WP_003418948.1.92892 WP_003418948.1.92907 WP_003418948.1.92908 WP_003418948.1.9291 WP_003418948.1.92917 WP_003418948.1.92996 WP_003418948.1.93006 WP_003418948.1.93009 WP_003418948.1.93015 WP_003418948.1.93043 WP_003418948.1.9307 WP_003418948.1.93083 WP_003418948.1.93097 WP_003418948.1.93137 WP_003418948.1.93192 WP_003418948.1.93199 WP_003418948.1.93203 WP_003418948.1.93212 WP_003418948.1.93234 WP_003418948.1.93245 WP_003418948.1.93257 WP_003418948.1.93265 WP_003418948.1.93297 WP_003418948.1.93320 WP_003418948.1.93328 WP_003418948.1.93337 WP_003418948.1.93343 WP_003418948.1.93349 WP_003418948.1.93363 WP_003418948.1.93377 WP_003418948.1.9338 WP_003418948.1.93407 WP_003418948.1.93417 WP_003418948.1.93419 WP_003418948.1.93426 WP_003418948.1.9344 WP_003418948.1.93443 WP_003418948.1.93447 WP_003418948.1.93470 WP_003418948.1.93483 WP_003418948.1.93487 WP_003418948.1.93495 WP_003418948.1.93499 WP_003418948.1.93516 WP_003418948.1.93536 WP_003418948.1.93544 WP_003418948.1.93555 WP_003418948.1.93560 WP_003418948.1.93564 WP_003418948.1.9357 WP_003418948.1.93573 WP_003418948.1.93576 WP_003418948.1.93588 WP_003418948.1.9363 WP_003418948.1.93645 WP_003418948.1.93649 WP_003418948.1.93659 WP_003418948.1.93677 WP_003418948.1.9368 WP_003418948.1.93689 WP_003418948.1.93693 WP_003418948.1.93698 WP_003418948.1.93706 WP_003418948.1.9371 WP_003418948.1.93792 WP_003418948.1.93823 WP_003418948.1.93871 WP_003418948.1.9388 WP_003418948.1.93894 WP_003418948.1.93903 WP_003418948.1.93907 WP_003418948.1.93913 WP_003418948.1.93946 WP_003418948.1.93950 WP_003418948.1.93953 WP_003418948.1.93954 WP_003418948.1.93988 WP_003418948.1.9407 WP_003418948.1.94143 WP_003418948.1.94154 WP_003418948.1.94204 WP_003418948.1.94205 WP_003418948.1.94226 WP_003418948.1.94231 WP_003418948.1.94256 WP_003418948.1.94261 WP_003418948.1.94281 WP_003418948.1.94292 WP_003418948.1.94297 WP_003418948.1.9431 WP_003418948.1.94326 WP_003418948.1.94339 WP_003418948.1.94392 WP_003418948.1.94416 WP_003418948.1.94421 WP_003418948.1.94456 WP_003418948.1.94470 WP_003418948.1.94480 WP_003418948.1.94495 WP_003418948.1.94511 WP_003418948.1.94512 WP_003418948.1.94525 WP_003418948.1.94528 WP_003418948.1.94564 WP_003418948.1.946 WP_003418948.1.94602 WP_003418948.1.94623 WP_003418948.1.94629 WP_003418948.1.9465 WP_003418948.1.94673 WP_003418948.1.94714 WP_003418948.1.94730 WP_003418948.1.94736 WP_003418948.1.94776 WP_003418948.1.9478 WP_003418948.1.94834 WP_003418948.1.94852 WP_003418948.1.94872 WP_003418948.1.9488 WP_003418948.1.94902 WP_003418948.1.94916 WP_003418948.1.94979 WP_003418948.1.94994 WP_003418948.1.94996 WP_003418948.1.94998 WP_003418948.1.95007 WP_003418948.1.95015 WP_003418948.1.95034 WP_003418948.1.95068 WP_003418948.1.95081 WP_003418948.1.95082 WP_003418948.1.9509 WP_003418948.1.95096 WP_003418948.1.95112 WP_003418948.1.95138 WP_003418948.1.9514 WP_003418948.1.95179 WP_003418948.1.95188 WP_003418948.1.95190 WP_003418948.1.95234 WP_003418948.1.95241 WP_003418948.1.95245 WP_003418948.1.95257 WP_003418948.1.95279 WP_003418948.1.9531 WP_003418948.1.95335 WP_003418948.1.95344 WP_003418948.1.9535 WP_003418948.1.95370 WP_003418948.1.95392 WP_003418948.1.95416 WP_003418948.1.95417 WP_003418948.1.95454 WP_003418948.1.95455 WP_003418948.1.95491 WP_003418948.1.95497 WP_003418948.1.95508 WP_003418948.1.95509 WP_003418948.1.95529 WP_003418948.1.95556 WP_003418948.1.95557 WP_003418948.1.95565 WP_003418948.1.95578 WP_003418948.1.95580 WP_003418948.1.95585 WP_003418948.1.95643 WP_003418948.1.95679 WP_003418948.1.95685 WP_003418948.1.957 WP_003418948.1.95724 WP_003418948.1.95727 WP_003418948.1.95730 WP_003418948.1.95735 WP_003418948.1.95758 WP_003418948.1.95772 WP_003418948.1.95797 WP_003418948.1.95839 WP_003418948.1.9585 WP_003418948.1.9590 WP_003418948.1.95902 WP_003418948.1.95924 WP_003418948.1.95926 WP_003418948.1.95953 WP_003418948.1.95958 WP_003418948.1.95964 WP_003418948.1.95973 WP_003418948.1.96006 WP_003418948.1.9602 WP_003418948.1.96036 WP_003418948.1.96062 WP_003418948.1.96065 WP_003418948.1.96098 WP_003418948.1.96146 WP_003418948.1.96166 WP_003418948.1.96171 WP_003418948.1.96182 WP_003418948.1.96204 WP_003418948.1.96230 WP_003418948.1.96235 WP_003418948.1.96242 WP_003418948.1.96245 WP_003418948.1.96254 WP_003418948.1.96259 WP_003418948.1.96286 WP_003418948.1.96313 WP_003418948.1.96318 WP_003418948.1.96345 WP_003418948.1.96360 WP_003418948.1.96373 WP_003418948.1.96456 WP_003418948.1.96486 WP_003418948.1.96560 WP_003418948.1.96569 WP_003418948.1.96573 WP_003418948.1.96575 WP_003418948.1.96576 WP_003418948.1.96611 WP_003418948.1.96621 WP_003418948.1.9667 WP_003418948.1.96681 WP_003418948.1.96726 WP_003418948.1.96733 WP_003418948.1.96742 WP_003418948.1.96754 WP_003418948.1.9678 WP_003418948.1.96832 WP_003418948.1.9685 WP_003418948.1.97008 WP_003418948.1.97009 WP_003418948.1.97056 WP_003418948.1.97084 WP_003418948.1.97087 WP_003418948.1.97094 WP_003418948.1.97096 WP_003418948.1.97099 WP_003418948.1.97108 WP_003418948.1.97113 WP_003418948.1.97122 WP_003418948.1.97127 WP_003418948.1.97129 WP_003418948.1.97136 WP_003418948.1.9716 WP_003418948.1.97176 WP_003418948.1.97222 WP_003418948.1.97223 WP_003418948.1.97237 WP_003418948.1.97242 WP_003418948.1.97270 WP_003418948.1.97283 WP_003418948.1.97296 WP_003418948.1.97321 WP_003418948.1.97325 WP_003418948.1.97366 WP_003418948.1.97376 WP_003418948.1.97380 WP_003418948.1.9739 WP_003418948.1.97462 WP_003418948.1.97517 WP_003418948.1.97519 WP_003418948.1.97535 WP_003418948.1.97540 WP_003418948.1.97545 WP_003418948.1.97546 WP_003418948.1.97550 WP_003418948.1.97577 WP_003418948.1.97584 WP_003418948.1.9759 WP_003418948.1.97591 WP_003418948.1.97609 WP_003418948.1.97618 WP_003418948.1.9763 WP_003418948.1.97669 WP_003418948.1.97673 WP_003418948.1.97700 WP_003418948.1.97701 WP_003418948.1.9773 WP_003418948.1.97730 WP_003418948.1.97740 WP_003418948.1.97751 WP_003418948.1.97754 WP_003418948.1.97797 WP_003418948.1.9782 WP_003418948.1.9784 WP_003418948.1.97888 WP_003418948.1.9790 WP_003418948.1.9795 WP_003418948.1.97951 WP_003418948.1.97958 WP_003418948.1.97966 WP_003418948.1.97977 WP_003418948.1.97979 WP_003418948.1.97995 WP_003418948.1.98018 WP_003418948.1.98034 WP_003418948.1.98052 WP_003418948.1.98071 WP_003418948.1.98072 WP_003418948.1.98113 WP_003418948.1.98114 WP_003418948.1.98128 WP_003418948.1.98181 WP_003418948.1.98188 WP_003418948.1.98189 WP_003418948.1.98213 WP_003418948.1.98225 WP_003418948.1.98291 WP_003418948.1.98335 WP_003418948.1.98350 WP_003418948.1.98395 WP_003418948.1.98412 WP_003418948.1.98441 WP_003418948.1.98443 WP_003418948.1.98462 WP_003418948.1.9848 WP_003418948.1.98482 WP_003418948.1.98486 WP_003418948.1.98488 WP_003418948.1.98503 WP_003418948.1.98516 WP_003418948.1.98524 WP_003418948.1.98536 WP_003418948.1.98541 WP_003418948.1.98566 WP_003418948.1.98576 WP_003418948.1.98590 WP_003418948.1.98594 WP_003418948.1.98599 WP_003418948.1.98629 WP_003418948.1.98645 WP_003418948.1.98646 WP_003418948.1.98649 WP_003418948.1.98656 WP_003418948.1.9867 WP_003418948.1.98674 WP_003418948.1.98697 WP_003418948.1.98701 WP_003418948.1.98739 WP_003418948.1.98749 WP_003418948.1.98765 WP_003418948.1.98770 WP_003418948.1.98777 WP_003418948.1.98778 WP_003418948.1.98802 WP_003418948.1.98838 WP_003418948.1.98850 WP_003418948.1.98906 WP_003418948.1.98935 WP_003418948.1.98948 WP_003418948.1.98953 WP_003418948.1.98984 WP_003418948.1.99000 WP_003418948.1.99023 WP_003418948.1.99030 WP_003418948.1.99055 WP_003418948.1.99062 WP_003418948.1.99086 WP_003418948.1.99115 WP_003418948.1.99117 WP_003418948.1.99161 WP_003418948.1.99176 WP_003418948.1.99205 WP_003418948.1.99211 WP_003418948.1.99216 WP_003418948.1.99222 WP_003418948.1.99251 WP_003418948.1.99294 WP_003418948.1.99312 WP_003418948.1.99315 WP_003418948.1.99316 WP_003418948.1.99322 WP_003418948.1.99328 WP_003418948.1.99365 WP_003418948.1.99368 WP_003418948.1.99379 WP_003418948.1.99396 WP_003418948.1.99402 WP_003418948.1.99404 WP_003418948.1.99419 WP_003418948.1.99438 WP_003418948.1.99460 WP_003418948.1.99468 WP_003418948.1.99473 WP_003418948.1.99513 WP_003418948.1.99529 WP_003418948.1.99548 WP_003418948.1.99572 WP_003418948.1.99575 WP_003418948.1.99578 WP_003418948.1.99605 WP_003418948.1.99609 WP_003418948.1.99617 WP_003418948.1.99635 WP_003418948.1.99650 WP_003418948.1.99672 WP_003418948.1.99701 WP_003418948.1.99711 WP_003418948.1.99716 WP_003418948.1.99740 WP_003418948.1.99745 WP_003418948.1.99749 WP_003418948.1.9976 WP_003418948.1.99798 WP_003418948.1.99817 WP_003418948.1.99832 WP_003418948.1.99847 WP_003418948.1.99852 WP_003418948.1.99886 WP_003418948.1.99897 WP_003418948.1.99899 WP_003418948.1.99915 WP_003418948.1.9993 WP_003418948.1.99982 WP_003418948.1.99991 gi|479316485|ref|YP_007856537.1| gi|15610624|ref|NP_218005.1| gi|433628627|ref|YP_007262256.1| gi|479057480|ref|YP_007353286.1| gi|506928090|ref|YP_008008540.1| gi|494693927|ref|YP_007959470.1| gi|375297757|ref|YP_005102024.1| gi|197742623|ref|YP_002163913.1| gi|506928090|ref|YP_008008540.1| gi|494697875|ref|YP_007963378.1| gi|340628456|ref|YP_004746908.1| 336982.TBFG_13523 419947.MRA_3528 478434.TBMG_03534 83331.MT3592 83332.Rv3488 gi|15843100|ref|NP_338137.1| gi|383309213|ref|YP_005362024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]