SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478450738|ref|YP_007721180.1| from Chlamydia trachomatis L2b/Ams5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478450738|ref|YP_007721180.1|
Domain Number 1 Region: 7-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.14e-77
Family Ribosomal protein L1 0.000000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478450738|ref|YP_007721180.1|
Sequence length 232
Comment 50S ribosomal protein L1 [Chlamydia trachomatis L2b/Ams5]
Sequence
MTKHGKRIRGIQETYDLAKSYSLGEAIDILKQCPTVRFDQTVDVSVKLGIDPRKSDQQVR
GSVSLPHGTGKVLRILVFAAGDKAAEAIEAGADFVGSDDLVEKIKGGWVDFDVAVATPDM
MREVGKLGKVLGPRNLMPTPKAGTVTTDVVKTIAELRKGKIEFKADRAGVCNVGVAKLSF
DSAQIKENVEALCAALVKAKPATAKGQYLVNFTISSTMGPGVTVDTRELIAL
Download sequence
Identical sequences A0A0E9G275 B0BBU9
gi|478452538|ref|YP_007720286.1| gi|478449837|ref|YP_007719394.1| gi|478453451|ref|YP_007717613.1| gi|478463375|ref|YP_007739187.1| gi|478467873|ref|YP_007742746.1| 471473.CTLon_0566 gi|478462476|ref|YP_007738297.1| gi|478454343|ref|YP_007716722.1| WP_012263640.1.101735 WP_012263640.1.18643 WP_012263640.1.25195 WP_012263640.1.27753 WP_012263640.1.38181 WP_012263640.1.38794 WP_012263640.1.40464 WP_012263640.1.42718 WP_012263640.1.45552 WP_012263640.1.48923 WP_012263640.1.49465 WP_012263640.1.51159 WP_012263640.1.53299 WP_012263640.1.5416 WP_012263640.1.58308 WP_012263640.1.5967 WP_012263640.1.64162 WP_012263640.1.79775 WP_012263640.1.97423 gi|478470581|ref|YP_007729222.1| gi|478465173|ref|YP_007741855.1| gi|478466972|ref|YP_007718504.1| gi|478469682|ref|YP_007722962.1| gi|478448037|ref|YP_007722071.1| gi|478451638|ref|YP_007714944.1| gi|166155403|ref|YP_001653658.1| gi|478471472|ref|YP_007740075.1| gi|478464273|ref|YP_007740965.1| gi|478450738|ref|YP_007721180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]