SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|78441|fgenesh1_pg.C_scaffold_31000112 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|78441|fgenesh1_pg.C_scaffold_31000112
Domain Number 1 Region: 425-747
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 2.51e-85
Family Phosphotransacetylase 0.000000586
Further Details:      
 
Domain Number 2 Region: 54-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000186
Family Nitrogenase iron protein-like 0.088
Further Details:      
 
Domain Number 3 Region: 253-374
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000000000000022
Family DRTGG domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|78441|fgenesh1_pg.C_scaffold_31000112
Sequence length 760
Sequence
MWTLRRSLRRSTASATLPTRRALTAASIAQGKVPIENLYVTSTEVTKKTAPVLIGLAHVL
EQKFSKVGYFRPIQPSRDSSMADHHVDVMRQQLELSQDVEQLYGVTSSRAMEAMLTGKGD
DVVEEILDRYEQCRKGHDFMIIEGSQISKHESAMSWKINVDIAKAIGSPVLMVTDFGDSS
AVNGELLEEMVSRTLMGRDQADAAGLNYLGTIANRVRAKDAEALRAELKKTVSGKEIPFL
GFLPMDEIIASKRLNEVTHQLGATQLFGNSIANDAVVTSAVVAASALKDLFAHLKKYKDG
AMIITSGDRSDLMLGLMVSRLPGVLPNISAIVLTNGNYPHSNTQEILKGVEALDKTGLSL
PIFSTPNDTFSTADGFAKVSTDILPSSKLKIDRSKQLFDEFVEKEMLIGELDQGMVVNRS
PKQFQHFLFSKSRAVQRRIVLTEGEDIRVLQAADQILRQNLSKITILGDPDEILLNAKTS
NLDLSRANIVRPADSDLLEKYVDYFYEKRKHKGVTKELARDYCKDETYFGTLMVEMGDAD
GMVSGACHTTANTIRPALQLIKTTPNRPIVSSVFFMCLEDGVRIYGDCAVNTDPSAADLA
QIAVTSAESAEAFGLIPKVALLSYATGDSNSGPIIDKVREATKIAQELRPDLDIYGPIQY
DAAVDASIAKTKLKAIPSGAKVGGQANVLIFPDLNTGNNTYKAVQQSTGCVAMGPMLQGL
RKPVNDLSRGATVKDIVTTVAITAIQADQVILKREAATKK
Download sequence
Identical sequences H3GP50
jgi|Phyra1_1|78441|fgenesh1_pg.C_scaffold_31000112 164328.JGI78441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]