SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|80577|fgenesh1_pg.C_scaffold_50000085 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|80577|fgenesh1_pg.C_scaffold_50000085
Domain Number 1 Region: 57-86,133-210
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|80577|fgenesh1_pg.C_scaffold_50000085
Sequence length 244
Sequence
MTFVAVNLVSLDVGMLIGVGIAILNFLLGYVRLPVVNRQPRTSDAARTLEERRVLEHKRD
AIAFFELSGFLFFGSSVQILDGVQKAVYVHKKLPGSDDEVGANYLGDADMPLTPEENRKP
LIECLDGTSVTDPDAVPTEYVVMDFTGVTAMDATAARSAFLILQKYCSNHNITVLYAGAL
PDIRDVLVKNEITGQESFYSSADSALKFCEDQLLRGVTGAETAAARVSSHREEAISLEVQ
GQPE
Download sequence
Identical sequences H3GTT3
jgi|Phyra1_1|80577|fgenesh1_pg.C_scaffold_50000085 164328.JGI80577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]