SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|85375|fgenesh1_pg.C_scaffold_172000003 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|85375|fgenesh1_pg.C_scaffold_172000003
Domain Number 1 Region: 604-922
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.67e-95
Family Reverse transcriptase 0.00013
Further Details:      
 
Weak hits

Sequence:  jgi|Phyra1_1|85375|fgenesh1_pg.C_scaffold_172000003
Domain Number - Region: 312-420
Classification Level Classification E-value
Superfamily Acid proteases 0.000186
Family Retroviral protease (retropepsin) 0.056
Further Details:      
 
Domain Number - Region: 236-258
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0558
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|85375|fgenesh1_pg.C_scaffold_172000003
Sequence length 928
Sequence
MTAVTASTTPKPASDGAPRAKPLMVSLKTFEGKEGENLLLWIREVEMAMASAILQTEQQR
VVLAVSKLDGRAREWALTCGTSVDSAFPSWEQLKLQLSRVLSPPNQAYRVRSRFLATRQG
KKKLVDFVQELRTLIAGMAADPLPGAVTVTIFMEGLRTGVARTEVFRVHPTSFEEAVSVA
LNAEFNFKSARAGWGTSQTNSSGAAGSSGGPEPMDLSHAEDEEADLLAAEQRIGIRRCFV
CGSTQHLRPGCPLRKQRQAPASRSPASYQKPGAGRPTGEELRSVEPQQGGQQGLAPKSTV
LFNTERVCKPGLLVVEATVKGFDKPWTILIDSGASVNYARRSTMEGSRQYAEALVARTSD
IITVRLATGTRVTVPKVPVNLGVKFLDFDSVERCLVLDLDSRYDLILGMAWLERHEPWID
WRQESRRGLSEGIVGIALMMRVKRPRFSAERSSPDVEFDVDAPMKQQEVETPEDTFGVNM
QASPRPARRKASVMAQQVSGVVDSEQLYTLVNGVTGEVAGDVNLEAVPAADALLELDEMS
IAEFGEALKAGELAEVAIIRLEDELNSSSLMDETVLEDTKQALSARSGSTILKDPSDPYY
PLVKEYQDVVSNDPPSGLPPDRGALAREQCDVIDAFFRAKHEAGVVRERKSPHSTPTFCV
RKSNGKWRIVHAFNKLNAATIPVQTPIPRKDVLQNNMVGCTTYSALDLVDGYYQLLMRAS
DIPLTAVSTPSGMLWEWLVMPQGLSNAPATFNRLVTQLFRPHRAYAQTYFDDIFVHSRAE
HGKSDVDNHIDHLRAVLECMRTNKLYANASKCIFGAEEIPFLGCFIGKRGLRADPAKVKA
IVDWPVPKNQKDLRKWLGLANYLHKYSENYADMARPLSNLLKKDAEWAWDTEHQVVFEAV
KESLLHAPILALPDPDRPFSVTPKGVNA
Download sequence
Identical sequences H3H492
164328.JGI85375 jgi|Phyra1_1|85375|fgenesh1_pg.C_scaffold_172000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]