SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507525692|ref|YP_008047315.1| from Burkholderia sp. RPE64

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507525692|ref|YP_008047315.1|
Domain Number 1 Region: 469-607
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.99e-31
Family Flavohemoglobin, C-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 362-462
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.36e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00046
Further Details:      
 
Domain Number 3 Region: 595-711
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.47e-18
Family 2Fe-2S ferredoxin-related 0.03
Further Details:      
 
Domain Number 4 Region: 203-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0000000000524
Family PNP-oxidase like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507525692|ref|YP_008047315.1|
Sequence length 716
Comment pyridoxamine 5'-phosphate oxidase-related FMN-binding [Burkholderia sp. RPE64]
Sequence
MTRRRRRTRAAVTPGVWRHTIMSTLAVPPVAPVATPSPWHRGEIKLQKAAGAYERMDSAG
RRVVRNYMPEQHRQFFAQLPFIVAGAVDERGDPWATLLAGHPGFMQTTNTTTLAIDRARD
PLDPADAGMNDGASIGLLGIELHTRRRNRVNGVIHRDGANARFDMAVEQSFGNCPQYIQL
RDFEFVRDPAVPSPVQPVLLDALTPRAREMITGADTLFVASYFDREDGHRQVDVSHRGGK
PGFVRLSDDGVLTIPDFAGNLFFNTLGNILENGRAGLVFADFETGTLLQMSGNAEVLLDS
PEIAAFQGAERLWRFTPRRIVYREQALPLRWAARRDGASPNSLMTGDWRQVAERIRATTL
ANAWRTFRVSKIVDESDSIRSFHLIPADDAGLIPHKAGQHLPIRVTLPGEARPQIRTYTL
SVAPSDGVYRISVKRDGRVSAYLHDTLKTGGTLEARAPAGDFTIDALEPRPAVLMAAGVG
ITPMLAMLRHVVYEGLRKRRVRPVWMIVSAHALASRAFAREIDDLAQAAGGAVHVIRVLS
DTQGAELARDYDMSGRIDLDLLTSRLPFNDYDFYLCGPGAFMQSIYDGLRKLNVSDTRIH
AEAFGPSSLKRTADRGADVKPMRPAAAEPVKVSFVKSGTDAQWKPDSGTLLELAEASGLA
PEFNCRGGTCGTCRTRIVKGAVSYESEPAFHVGDDEALICCAVPAGDEGGGLELDL
Download sequence
Identical sequences R4WUN6
gi|507525692|ref|YP_008047315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]